Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

D68 Enterovirus Mexico Sequences Include Novel AFP Sub-clade

Featured Replies

  • Author
LOCUS       KR081327                 453 bp    RNA     linear   VRL 18-APR-2015
DEFINITION  Enterovirus D68 isolate MEX3080/14 viral protein 1 gene, partial
            cds.
ACCESSION   KR081327
VERSION     KR081327.1  GI:806981400
KEYWORDS    .
SOURCE      Enterovirus D68 (EV-D68)
  ORGANISM  Enterovirus D68
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Picornavirales; Picornaviridae; Enterovirus; Enterovirus D.
REFERENCE   1  (bases 1 to 453)
  AUTHORS   Vazquez-Perez,J.A., Moreno-Valencia,Y., Hernandez-Hernandez,V.A.,
            Romero-Espinoza,J.I., Castillejo-Lopez,M., Hernandez,A.,
            Ramirez-Gonzalez,J.E. and Diaz-Quinones,A.
  TITLE     EV-D68 infection in children with asthma exacerbation and pneumonia
            in Mexico City during 2014 autumn
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 453)
  AUTHORS   Vazquez-Perez,J.A., Hernandez-Hernandez,V.A., Romero-Espinoza,J.I.,
            Coronel-Tellez,R.H. and Moreno-Valencia,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-APR-2015) Virology and Mycology Research, National
            Institute of Respiratory Diseases, Calzada de Tlalpan 4502, Seccion
            XVI Tlalpan, Mexico City, Mexico D.F. 14080, Mexico
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..453
                     /organism="Enterovirus D68"
                     /mol_type="genomic RNA"
                     /isolate="MEX3080/14"
                     /isolation_source="pediatric respiratory sample"
                     /host="Homo sapiens"
                     /db_xref="taxon:42789"
                     /country="Mexico"
                     /collection_date="Oct-2014"
     CDS             <1..>453
                     /note="VP1"
                     /codon_start=1
                     /product="viral protein 1"
                     /protein_id="AKC32639.1"
                     /db_xref="GI:806981401"
                     /translation="GVSETLVENFLSRAALVSKRSFEYKDHTSSAAQADKNFFKWTIN
                     TRSFVQLRRKLELFTYLRFDAEITILTTVAVNGSSNNTYVGLPDLTLQAMFVPTGALT
                     PEKQDSFHWQSGSNASVFFKISDPPARITIPFMCINSAYSVFYDGFAGF"
ORIGIN      
        1 ggtgtgtccg agactctagt ggagaatttt ctcagtagag cagctttggt atcaaagaga
       61 agttttgaat acaaagatca tacttcgtct gcagcacaag cagacaagaa ctttttcaaa
      121 tggacaatta acaccagatc ctttgtacag ttaagaagaa aattagaatt attcacatac
      181 cttagatttg atgctgagat cactatactc acaactgtag cagtgaatgg tagtagtaat
      241 aatacatacg tgggtcttcc tgacttgaca cttcaagcaa tgtttgtacc cactggtgct
      301 cttaccccag aaaagcagga ctcattccac tggcaatcag gcagtaatgc tagtgtattc
      361 tttaaaatct ctgacccccc agccagaata accatacctt ttatgtgcat taactcagca
      421 tactcagttt tttatgatgg ctttgccgga ttt

Please sign in to comment

You will be able to leave a comment after signing in

Sign In Now

Recently Browsing 0

  • No registered users viewing this page.

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.