niman Posted March 6, 2016 Report Share Posted March 6, 2016 (edited) Zika confirmed in a United States resident who developed symptoms in the Philippines.http://www.nationmultimedia.com/breakingnews/American-tests-positive-for-Zika-virus-while-in-Ph-30280891.html Edited March 6, 2016 by niman Link to comment Share on other sites More sharing options...
niman Posted March 6, 2016 Author Report Share Posted March 6, 2016 American tests positive for Zika virus while in PhilippinesAries Joseph HeginaPhilippine Daily Inquirer March 6, 2016 4:18 pm MANILA - A resident of the United States has tested positive for the deadly Zika virus while staying in the Philippines last January, the Department of Health revealed on Sunday.In a press briefing, Health Secretary Janette Garin said that the unidentified American woman stayed in the Philippines for four weeks.However, the US resident only exhibited symptoms of the virus when she was on the last week of her stay in the country."Currently we are coordinating with US Centres for Disease Control and Prevention for the profile of the patient, including information on places she visited in the Philippines," Garin said.The health official allayed fears that there is now an outbreak of the said disease in the country. "Despite reported case, there is no outbreak of Zika virus in the Philippines. There is no epidemic. The public should not panic," she said.Garin also asked pregnant women and those who are planning to get pregnant to exercise maximum caution to avoid contracting the virus.Zika has become an epidemic in South America last year. The virus, which is spread through mosquito bites, causes mild illness or no symptoms at all.Some pregnant women who get infected by the virus give birth to children with microcephaly.According to the World Health Organisation (WHO), microcephaly is a rare condition where "a baby is born with a small head or the head stops growing after birth."Researchers are still studying the link of the rise of microcephaly cases and the Zika virus. The WHO has declared Zika as a "global emergency." Link to comment Share on other sites More sharing options...
niman Posted March 6, 2016 Author Report Share Posted March 6, 2016 First Case Of Zika Virus Detected In Philippines Since 2012World | Agence France-Presse | Updated: March 06, 2016 15:20 ISTEMAILPRINTCOMMENTS The only previous known case of Zika in the country was a 15-year-old boy infected in 2012.MANILA, PHILIPPINES: An American woman was infected with the Zika virus while visiting the Philippines, health department officials said Sunday, the first case detected in the country for several years.Health Secretary Janette Garin said the US Centers for Disease Control and Prevention (US-CDC) had informed her that a US resident who stayed in the Philippines for four weeks in January had apparently developed symptoms in her last week before returning to America."We were informed that shortly after returning home to the US, an evidence of Zika virus infection was detected from the patient," Garin said in a statement. "Currently, we are coordinating with US-CDC for the profile of the patient, including information on places she visited in the Philippines," Garin said without giving details of the patient.Health department officials said they still had no clue how the American was infected while in the Philippines.The only previous known case of Zika in the country was a 15-year-old boy infected in 2012. He recovered after three weeks.The mosquito-borne disease is usually not life-threatening but has been linked to a rise in birth defects in other countries, where hundreds of babies have been born with unusually small heads in recent years.(This story has not been edited by NDTV staff and is auto-generated from a syndicated feed.)Story First Published:March 06, 2016 15:20 ISThttp://www.ndtv.com/world-news/first-case-of-zika-virus-detected-in-philippines-since-2012-1284421 Link to comment Share on other sites More sharing options...
niman Posted March 6, 2016 Author Report Share Posted March 6, 2016 First case of Zika virus detected in Philippines since 2012A US resident who spent four weeks in the Philippines was found to have been infected with the Zika virus, the first case in the South-east Asian country since 2012. PHOTO: AFPPUBLISHED39 MIN AGOFACEBOOKTWITTEREMAIL MANILA (AFP) - An American woman was infected with the Zika virus while visiting the Philippines, health department officials said on Sunday (March 6), the first case detected in the country for several years.Philippines Health Secretary Janette Garin said the US Centres for Disease Control and Prevention (US-CDC) had informed her that a US resident who stayed in the Philippines for four weeks in January had apparently developed symptoms in her last week before returning to America."We were informed that shortly after returning home to the US, an evidence of Zika virus infection was detected from the patient," Ms Garin said in a statement. "Currently, we are coordinating with US-CDC for the profile of the patient, including information on places she visited in the Philippines," she said, without giving details of the patient.Health department officials said they still had no clue how the American was infected while in the Philippines. The only previous known case of Zika in the country was a 15-year-old boy infected in 2012. He recovered after three weeks.The mosquito-borne disease is usually not life-threatening, but has been linked to a rise in birth defects in other countries, where hundreds of babies have been born with unusually small heads in recent years.http://www.straitstimes.com/asia/se-asia/first-case-of-zika-virus-detected-in-philippines-since-2012 Link to comment Share on other sites More sharing options...
niman Posted March 6, 2016 Author Report Share Posted March 6, 2016 US resident who visited PH tests positive for ZikaHealth Secretary Janette Garin assures the public that there is no cause for alarm as there is no epidemicRappler.comPublished 5:38 PM, March 06, 2016Updated 5:38 PM, March 06, 20162521TwitterRedditEmail521 ZIKA THREAT. The World Health Organization recently declared the virus a global health emergency. MANILA, Philippines – A resident of the United States tested positive for the Zika virus after spending 4 weeks in the Philippines in January 2016, the Department of Health (DOH) said on Sunday, March 6.The DOH cited a report from the US-Centers for Disease Control and Prevention (US-CDC) which indicated that a non-pregnant adult showed symptoms of fever, rash, joint pain, conjunctivitis, and muscle pain during her last week of stay in the Philippines, and was confirmed to have the Zika virus upon returning to the US.Zika is a mild case of the flu transmitted by mosquito species usually found in tropical and sub-tropical regions. Though seemingly minor, however, the virus is suspected to cause serious neurological problems and birth defects in babies born to infected women. (READ: FAST FACTS: Zika virus)Philippine Health Secretary Janette Garin said they are now trying to pinpoint all the provinces the patient may have traveled to during her stay."Currently, we are coordinating with US-CDC for the profile of the patient, including information on places she visited in the Philippines," Garin said.The health chief assured the public that there is no cause for alarm as there is no epidemic, considering that it is just the second confirmed case of Zika virus in the country.The first laboratory confirmed case was in 2012 when a 15-year-old boy tested negative for dengue and Chikungunya but positive for Zika. He recovered after 3 weeks of bed rest and medication.Zika is characterized by fever, rash, and conjunctivitis. Other symptoms include joint pain, muscle pain, headache, and vomiting. These may last for 2 to 7 days.Although most infected individuals do not manifest any symptoms, they are still capable of transmitting the infection through the bite of infected female Aedes mosquitoes, the same ones responsible for dengue and Chikungunya. Other reports also indicated that the virus could be transmitted through sexual contact and blood transfusion.The symptoms of the virus can be treated with medications for common pain and fever, rest, and water. Patients, however, are encouraged to consult the nearest health facility if symptoms persist.The Research Institute for Tropical Medicine (RITM) can test suspected cases. Zika virus kits are also available for those who want to get tested across the country. (READ: 1,000 kids available in PH for Zika virus testing)Garin advised women – pregnant or not – to take precautions to protect themselves.Breeding grounds, Garin added, should be destroyed to prevent the spread of Aedes mosquitoes."We reiterate that cleanliness is still the key against mosquito-borne diseases. The public is reminded to be vigilant and pre-cautious in eliminating mosquito breeding places through the '4S campaign,'" she said."The 4S means search & destroy mosquito breeding places; use self-protection measures, seek early consultation for fever lasting more than two days, and say yes to fogging when there is an impending outbreak."According to the World Health Organization (WHO), 55 countries have reported local Zika cases from January 2007 to March 2016, making it a global threat. – Rappler.comhttp://www.rappler.com/nation/124851-philippines-zika-virus-united-states-resident Link to comment Share on other sites More sharing options...
niman Posted March 6, 2016 Author Report Share Posted March 6, 2016 A resident of the United States has tested positive for the deadly Zika virus while staying in the Philippines last January, the Department of Health (DOH) revealed on Sunday. In a press briefing, Health Secretary Janette Garin said that the unidentified American woman stayed in the Philippines for four weeks. However, the US resident only exhibited symptoms of the virus when she was on her last week in the country.“Currently we are coordinating with US Centers for Disease Control and Prevention for the profile of the patient, including information on places she visited in the PH,” Garin said.The health official allayed fears that there is now an outbreak of the said disease in the country.“Despite reported case, there is no outbreak of Zika virus in the Philippines. There is no epidemic. The public should not panic,” she said.READ: DOH says PH still free of Zika virusGarin also asked pregnant women and those who are planning to get pregnant to exercise maximum caution to avoid contracting the virus.Zika has become an epidemic in South America last year. The virus, which is spread through mosquito bites, causes mild illness or no symptoms at all.Some pregnant women who get infected by the virus give birth to children with microcephaly.According to the World Health Organization (WHO), microcephaly is a rare condition where “a baby is born with a small head or the head stops growing after birth.”Researchers are still studying the link of the rise of microcephaly cases and the Zika virus.The WHO has declared Zika as a “global emergency.” AJH/With reports from Jocelyn Uy, Philippine Daily InquirerRead more: http://globalnation.inquirer.net/137422/american-tested-positive-for-zika-virus-while-in-ph-doh#ixzz427YlVWJd Follow us: @inquirerdotnet on Twitter | inquirerdotnet on Facebook Link to comment Share on other sites More sharing options...
niman Posted March 6, 2016 Author Report Share Posted March 6, 2016 Recent PHL visitor tested positive for Zika Published March 6, 2016 5:02pmBy BIANCA ROSE DABU, GMA News A US resident who visited the Philippines last January tested positive for the Zika virus, the Department of Health (DOH) disclosed on Sunday.The DOH said the report was relayed to them by the US Center for Disease Control.The patient was described as a "non-pregnant adult" who reportedly got sick in her last week in the country. She is now back in the US, according to a report by GMA News reporter Isay Reyes.The DOH said the visitor started to exhibit symptoms of the Zika virus from January 2 to 18.After the case has been confirmed, Philippine and US authorities traced and visited the places that the patient visited and conduct the necessary measures to prevent and control the virus.The DOH gave assurances that that there is no outbreak of the Zika virus in the Philippines and there is absolutely no reason to panic.In a press conference last month, Department of Health Secretary Janette Garin said that The Research Institute for Tropical Medicine will be activating five other government hospitals and laboratories for Zika virus testing. 'The hospitals include: Baguio General Hospital, Vicente Sotto Memorial Medical Center in Cebu City, Southern Philippines Medical Center in Davao, Lung Center of the Philippines in Quezon City, and San Lazaro Hospital in Manila.While there are about 2,000 Zika virus testing kits in the Philippines, the World Health Organization recommended to avoid testing on people without symptoms and to protect existing resources while there is still an immediate need for aggressive production of Zika virus testing kits.The DOH reminds everyone of the importance of cleanliness, and has also started to coordinate with other agencies to promote cleanliness and control the population of mosquitoes—the carrier of the virus. — APG, GMA News - See more at: http://www.gmanetwork.com/news/story/558015/news/nation/recent-phl-visitor-tested-positive-for-zika#sthash.qUg9789C.dpuf Link to comment Share on other sites More sharing options...
niman Posted March 6, 2016 Author Report Share Posted March 6, 2016 (edited) CDCEID journalPast IssuesApril 2015Zika Virus Infection, Philippines, 2012Zika Virus Infection, Philippines, 2012 Recommend on FacebookTweetFigure Volume 21, Number 4—April 2015LetterZika Virus Infection, Philippines, 2012Maria Theresa Alera, Laura Hermann , Ilya A. Tac-An, Chonticha Klungthong, Wiriya Rutvisuttinunt, Wudtichai Manasatienkij, Daisy Villa, Butsaya Thaisomboonsuk, John Mark Velasco, Piyawan Chinnawirotpisan, Catherine B. Lago, Vito G. Roque, Louis R. Macareo, Anon Srikiatkhachorn, Stefan Fernandez, and In-Kyu YoonAuthor affiliations: Philippines-AFRIMS (Armed Forces Research Institute of Medical Sciences), Cebu City, Philippines (M.T. Alera, J.M. Velasco, C.B. Lago);University of Toronto, Toronto, Ontario, Canada (L. Hermann); AFRIMS, Bangkok, Thailand (L. Hermann, C. Klungthong, W. Rutvisuttinunt, W. Manasatienkij, B. Thaisomboonsuk, P. Chinnawirotpisan, L.R. Macareo, S. Fernandez, I.-K. Yoon); Cebu City Health Department, Cebu City (I.A. Tac-An, D. Villa); Department of Health, Manila, Philippines (V.G. Roque, Jr.); University of Massachusetts Medical School, Worcester, Massachusetts, USA (A. Srikiatkhachorn)Main ArticleFigureFigure. Maximum-likelihood phylogenetic tree of fragments of Zika virus was determined using the general time-reversible plus gamma distribution plus invariable site model with 13 reference Zika virus strains from GenBank. The contig sequence, obtained from de novo assembly and blastn (http://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastn&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome), of the Philippines isolate from 2012 (GenBank accession no. KM851038; bold font) was analyzed against 8 reference strains from Africa (GenBank accession nos. KF268948, KF268949, KF268950, LC002520, AY632535, NC012532, HQ234500, HQ234501) and 5 reference strains from Asia (GenBank accession nos. KJ776791, JN860885, EU545988, HQ234499, KF993678). The year of collection is unknown for several strains from Africa. Bootstrap values >70 are indicated at nodes. Scale bar indicates nucleotide substitutions per site. The drawing is not to scale.http://www.ncbi.nlm.nih.gov/pmc/articles/PMC4378478/figure/F1/ Edited March 6, 2016 by niman Link to comment Share on other sites More sharing options...
niman Posted March 6, 2016 Author Report Share Posted March 6, 2016 Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cdsGenBank: KM851038.1FASTA GraphicsGo to:LOCUS KM851038 789 bp RNA linear VRL 25-MAY-2015 DEFINITION Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds. ACCESSION KM851038 VERSION KM851038.1 GI:822599142 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 789) AUTHORS Alera,M.T., Hermann,L., Tac-An,I.A., Klungthong,C., Rutvisuttinunt,W., Manasatienkij,W., Villa,D., Thaisomboonsuk,B., Velasco,J.M., Chinnawirotpisan,P., Lago,C.B., Roque,V.G. Jr., Macareo,L.R., Srikiatkhachorn,A., Fernandez,S. and Yoon,I.K. TITLE Zika virus infection, Philippines, 2012 JOURNAL Emerging Infect. Dis. 21 (4), 722-724 (2015) PUBMED 25811410 REFERENCE 2 (bases 1 to 789) AUTHORS Alera,M.T., Hermann,L., Tac-An,I.A., Klungthong,C., Rutvisuttinunt,W., Villa,D., Thaisomboonsuk,B., Velasco,J.M., Chinnawirotpisan,P., Lago,C.B., Roque,V.G. Jr., Macareo,L.R., Srikiatkhachorn,A., Fernandez,S. and Yoon,I.-K. TITLE Direct Submission JOURNAL Submitted (02-OCT-2014) Virology, USAMC-AFRIMS, 315/6 Rajvithi Road, Bangkok 10400, Thailand COMMENT ##Assembly-Data-START## Assembly Method :: Trinity Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..789 /organism="Zika virus" /mol_type="genomic RNA" /strain="CPC-0740" /host="Homo sapiens" /db_xref="taxon:64320" /country="Philippines" /collection_date="09-May-2012" CDS <1..>789 /note="NS5" /codon_start=1 /product="nonstructural protein 5" /protein_id="AKH87424.1" /db_xref="GI:822599143" /translation="RISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPA EKGKTVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRPE KVTNWLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTG WDNWEEVPFCSHHFNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKS YAQMWQLLYFHRRDLRLMANAICSSVPVDWVPTGRTTWSIHGKGE" ORIGIN 1 cgcatcagca ggtttgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg 61 cacagggcct tggcattggc cataatcaag tacacatacc aaaacaaagt ggtaaaggtc 121 cttagaccag ctgaaaaagg gaagacagtt atggacatta tttcaagaca agaccaaagg 181 gggagcggac aagttgtcac ttacgctctt aatacattca ccaacctggt ggtgcagctc 241 attcggaata tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg 301 ccagagaaag tgaccaactg gttgcaaagc aacggatggg ataggctcaa aagaatggca 361 gtcagtggag atgattgcgt tgtgaaacca attgatgata ggtttgcaca tgccctcagg 421 ttcttgaatg atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga 481 tgggacaact gggaagaagt tccgttttgc tcccaccact tcaacaaact ccatcttaag 541 gacgggaggt ccattgtggt tccctgccgc caccaagatg aactgattgg ccgagcccgc 601 gtatcaccag gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg 661 caaatgtggc agctccttta tttccacaga agggacctcc gactgatggc caatgccatt 721 tgttcatctg tgccagttga ttgggttcca actgggagaa ctacctggtc aatccatgga 781 aagggagaa Link to comment Share on other sites More sharing options...
niman Posted March 6, 2016 Author Report Share Posted March 6, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome14241424100%0.0100%KU681082.3Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds14241424100%0.0100%KM851038.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds13791379100%0.099%EU545988.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds13611361100%0.098%JN860885.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome13551355100%0.098%KU509998.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds13551355100%0.098%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds13551355100%0.098%KU501216.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds13551355100%0.098%KF993678.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds13551355100%0.098%KJ776791.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome13521352100%0.098%KU497555.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds13521352100%0.098%KU647676.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds13461346100%0.098%KU729217.2Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds13461346100%0.098%KU820897.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome13461346100%0.098%KU707826.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome13461346100%0.098%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds13461346100%0.098%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds13461346100%0.098%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds13461346100%0.098%KU365777.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome13461346100%0.098%KU321639.1Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds13421342100%0.098%KU761564.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome13421342100%0.098%KU744693.1Select seq gb|KU740184.1|Zika virus isolate GD01 polyprotein gene, complete cds13421342100%0.098%KU740184.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome13421342100%0.098%KU527068.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds13421342100%0.098%KU312312.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds13371337100%0.098%KU729218.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds13371337100%0.098%KU365778.1Select seq gb|KU820899.1|Zika virus isolate ZJ03 polyprotein gene, complete cds13331333100%0.097%KU820899.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome13331333100%0.097%KU681081.3Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds13331333100%0.097%KM851039.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds1312131296%0.098%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds1310131096%0.098%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds1308130896%0.098%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds1305130596%0.098%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds1305130596%0.098%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds1305130596%0.098%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds1303130396%0.098%KM078929.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds1294129495%0.098%KU179098.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1276127694%0.098%KJ873160.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds12611261100%0.095%HQ234499.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1178117887%0.098%KJ873161.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds10401040100%0.089%KU720415.1 Link to comment Share on other sites More sharing options...
niman Posted March 6, 2016 Author Report Share Posted March 6, 2016 American tests positive for Zika virus after Philippine trip Resize Text Print Article Comments 0 Book mark article Read later list Saved to Reading List By Associated Press March 6 at 6:40 AMMANILA, Philippines — The Philippine government says an American woman who visited the country in January has tested positive for the Zika virus in the United States.Health Secretary Janet Garin said Sunday that her department was coordinating with the U.S. Centers for Disease Control and Prevention to get more information about the woman and find out where she stayed during her Jan. 2-28 visit to the Philippines.Garin said it was only the second Zika case to be reported in the Philippines and stresses that there has been no report of an outbreak, adding that the public should not be alarmed but should take steps to prevent infection.A 15-year-old boy got infected in Cebu city in the central Philippines in 2012, but recovered fully, according to the health department.https://www.washingtonpost.com/world/asia_pacific/american-tests-positive-for-zika-virus-after-philippine-trip/2016/03/06/30612b06-e390-11e5-a9ce-681055c7a05f_story.html?tid=twisira Link to comment Share on other sites More sharing options...
MANILA, Philippines — The Philippine government says an American woman who visited the country in January has tested positive for the Zika virus in the United States.Health Secretary Janet Garin said Sunday that her department was coordinating with the U.S. Centers for Disease Control and Prevention to get more information about the woman and find out where she stayed during her Jan. 2-28 visit to the Philippines.Garin said it was only the second Zika case to be reported in the Philippines and stresses that there has been no report of an outbreak, adding that the public should not be alarmed but should take steps to prevent infection.A 15-year-old boy got infected in Cebu city in the central Philippines in 2012, but recovered fully, according to the health department.https://www.washingtonpost.com/world/asia_pacific/american-tests-positive-for-zika-virus-after-philippine-trip/2016/03/06/30612b06-e390-11e5-a9ce-681055c7a05f_story.html?tid=twisira
Recommended Posts
Please sign in to comment
You will be able to leave a comment after signing in
Sign In Now