niman Posted March 17, 2016 Report Share Posted March 17, 2016 (edited) Partial NS2 sequence, Dominican Rep-Rus-2016, from Moscow ex-Dominican Republic Feb 2016 urine collectionhttp://www.ncbi.nlm.nih.gov/nuccore/KU872850 Edited March 17, 2016 by niman Link to comment Share on other sites More sharing options...
niman Posted March 17, 2016 Author Report Share Posted March 17, 2016 LOCUS KU872850 459 bp ss-RNA linear VRL 07-MAR-2016 DEFINITION Zika virus isolate Dominican Rep-Rus-2016, NS2 partial cds. ACCESSION KU872850 VERSION KU872850.1 GI:1003121936 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 459) AUTHORS Karan,L.S., Maleev,V.V., Fedorova,M.V., Grigorieva,Y.E., Kotiv,S.I., Voldokhina,A.V., Shipulin,G.A. and Pokrovsky,V.I. TITLE First case of imported Zika virus disease in Russia from Dominican Republic, February 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 459) AUTHORS Karan,L.S., Maleev,V.V., Fedorova,M.V., Grigorieva,Y.E., Kotiv,S.I. and Voldokhina,A.V. TITLE Direct Submission JOURNAL Submitted (07-MAR-2016) Central Research Institute of Epidemiology, Novogireevskaya Str, 3a, Moscow 111123, Russia COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..459 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Dominican Rep-Rus-2016" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="Russia" /collection_date="Feb-2016" /note="type: Asian" CDS <1..>459 /codon_start=1 /product="NS2" /protein_id="AMO25682.1" /db_xref="GI:1003121937" /translation="TAISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALT PLARGTLLVAWRAGLATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGL LLLTRSGKRSWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSY" ORIGIN 1 actgcgatct ccgccttgga gggcgacctg atggttctca tcaatggttt tgctttggcc 61 tggttggcaa tacgagcgat ggttgttcca cgcactgaca acatcacctt ggcaatcctg 121 gctgctctga caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct 181 acttgcgggg ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta 241 ccatttgtca tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg 301 ggactgctgt tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca 361 gctgttggcc tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct 421 gggcccatgg ccgcggtcgg tctgctaatt gtcagttac Link to comment Share on other sites More sharing options...
niman Posted March 17, 2016 Author Report Share Posted March 17, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU872850.1|Zika virus isolate Dominican Rep-Rus-2016, NS2 partial cds829829100%0.0100%KU872850.1Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds823823100%0.099%KU820897.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome823823100%0.099%KU497555.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome820820100%0.099%KU820899.2Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds820820100%0.099%KU729218.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome820820100%0.099%KU707826.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome820820100%0.099%KU527068.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds820820100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds820820100%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome820820100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds820820100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds820820100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds820820100%0.099%KU365777.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds820820100%0.099%KU312312.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds820820100%0.099%KJ776791.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome814814100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome814814100%0.099%KU853012.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds814814100%0.099%KU729217.2Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome814814100%0.099%KU744693.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds814814100%0.099%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome814814100%0.099%KU509998.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds814814100%0.099%KU365778.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome814814100%0.099%KU321639.1Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds810810100%0.099%KU761564.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome810810100%0.099%KU681081.3Select seq gb|KU740184.1|Zika virus isolate GD01 polyprotein gene, complete cds810810100%0.099%KU740184.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds810810100%0.099%KU740199.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds796796100%0.098%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds796796100%0.098%JN860885.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome792792100%0.098%KU681082.3Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds756756100%0.097%EU545988.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds726726100%0.095%HQ234499.1 Link to comment Share on other sites More sharing options...
niman Posted March 17, 2016 Author Report Share Posted March 17, 2016 Sequence map updatedhttps://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en Link to comment Share on other sites More sharing options...
Recommended Posts
Please sign in to comment
You will be able to leave a comment after signing in
Sign In Now