Feb 2016 Partial NS2 Zika Sequence Moscow ex-Dominican Republic

[niman]

Partial NS2 sequence, Dominican Rep-Rus-2016, from Moscow ex-Dominican Republic Feb 2016 urine collection

http://www.ncbi.nlm.nih.gov/nuccore/KU872850

 

Edited March 17, 2016 by niman

[niman]

LOCUS       KU872850                 459 bp ss-RNA     linear   VRL 07-MAR-2016
DEFINITION  Zika virus isolate Dominican Rep-Rus-2016, NS2 partial cds.
ACCESSION   KU872850
VERSION     KU872850.1  GI:1003121936
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 459)
  AUTHORS   Karan,L.S., Maleev,V.V., Fedorova,M.V., Grigorieva,Y.E.,
            Kotiv,S.I., Voldokhina,A.V., Shipulin,G.A. and Pokrovsky,V.I.
  TITLE     First case of imported Zika virus disease in Russia from Dominican
            Republic, February 2016
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 459)
  AUTHORS   Karan,L.S., Maleev,V.V., Fedorova,M.V., Grigorieva,Y.E., Kotiv,S.I.
            and Voldokhina,A.V.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-MAR-2016) Central Research Institute of Epidemiology,
            Novogireevskaya Str, 3a, Moscow 111123, Russia
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..459
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="Dominican Rep-Rus-2016"
                     /isolation_source="urine"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Russia"
                     /collection_date="Feb-2016"
                     /note="type: Asian"
     CDS             <1..>459
                     /codon_start=1
                     /product="NS2"
                     /protein_id="AMO25682.1"
                     /db_xref="GI:1003121937"
                     /translation="TAISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALT
                     PLARGTLLVAWRAGLATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGL
                     LLLTRSGKRSWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSY"
ORIGIN      
        1 actgcgatct ccgccttgga gggcgacctg atggttctca tcaatggttt tgctttggcc
       61 tggttggcaa tacgagcgat ggttgttcca cgcactgaca acatcacctt ggcaatcctg
      121 gctgctctga caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct
      181 acttgcgggg ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta
      241 ccatttgtca tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg
      301 ggactgctgt tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca
      361 gctgttggcc tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct
      421 gggcccatgg ccgcggtcgg tctgctaatt gtcagttac

[niman]

Sequences producing significant alignments:

Select:AllNone Selected:0

AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments

Sequences producing significant alignments:

Select for downloading or viewing reports	Description	Max score	Total score	Query cover	E value	Ident	Accession
Select seq gb|KU872850.1|	Zika virus isolate Dominican Rep-Rus-2016, NS2 partial cds	829	829	100%	0.0	100%	KU872850.1
Select seq gb|KU820897.1|	Zika virus isolate FLR polyprotein gene, complete cds	823	823	100%	0.0	99%	KU820897.1
Select seq gb|KU497555.1|	Zika virus isolate Brazil-ZKV2015, complete genome	823	823	100%	0.0	99%	KU497555.1
Select seq gb|KU820899.2|	Zika virus isolate ZJ03, complete genome	820	820	100%	0.0	99%	KU820899.2
Select seq gb|KU729218.1|	Zika virus isolate BeH828305 polyprotein gene, complete cds	820	820	100%	0.0	99%	KU729218.1
Select seq gb|KU707826.1|	Zika virus isolate SSABR1, complete genome	820	820	100%	0.0	99%	KU707826.1
Select seq gb|KU527068.1|	Zika virus strain Natal RGN, complete genome	820	820	100%	0.0	99%	KU527068.1
Select seq gb|KU501217.1|	Zika virus strain 8375 polyprotein gene, complete cds	820	820	100%	0.0	99%	KU501217.1
Select seq gb|KU501216.1|	Zika virus strain 103344 polyprotein gene, complete cds	820	820	100%	0.0	99%	KU501216.1
Select seq gb|KU501215.1|	Zika virus strain PRVABC59, complete genome	820	820	100%	0.0	99%	KU501215.1
Select seq gb|KU365780.1|	Zika virus strain BeH815744 polyprotein gene, complete cds	820	820	100%	0.0	99%	KU365780.1
Select seq gb|KU365779.1|	Zika virus strain BeH819966 polyprotein gene, complete cds	820	820	100%	0.0	99%	KU365779.1
Select seq gb|KU365777.1|	Zika virus strain BeH818995 polyprotein gene, complete cds	820	820	100%	0.0	99%	KU365777.1
Select seq gb|KU312312.1|	Zika virus isolate Z1106033 polyprotein gene, complete cds	820	820	100%	0.0	99%	KU312312.1
Select seq gb|KJ776791.1|	Zika virus strain H/PF/2013 polyprotein gene, complete cds	820	820	100%	0.0	99%	KJ776791.1
Select seq gb|KU853013.1|	Zika virus isolate Dominican Republic/2016/PD2, complete genome	814	814	100%	0.0	99%	KU853013.1
Select seq gb|KU853012.1|	Zika virus isolate Dominican Republic/2016/PD1, complete genome	814	814	100%	0.0	99%	KU853012.1
Select seq gb|KU729217.2|	Zika virus isolate BeH823339 polyprotein gene, complete cds	814	814	100%	0.0	99%	KU729217.2
Select seq gb|KU744693.1|	Zika virus isolate VE_Ganxian, complete genome	814	814	100%	0.0	99%	KU744693.1
Select seq gb|KU647676.1|	Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds	814	814	100%	0.0	99%	KU647676.1
Select seq gb|KU509998.1|	Zika virus strain Haiti/1225/2014, complete genome	814	814	100%	0.0	99%	KU509998.1
Select seq gb|KU365778.1|	Zika virus strain BeH819015 polyprotein gene, complete cds	814	814	100%	0.0	99%	KU365778.1
Select seq gb|KU321639.1|	Zika virus strain ZikaSPH2015, complete genome	814	814	100%	0.0	99%	KU321639.1
Select seq gb|KU761564.1|	Zika virus isolate GDZ16001 polyprotein gene, complete cds	810	810	100%	0.0	99%	KU761564.1
Select seq gb|KU681081.3|	Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome	810	810	100%	0.0	99%	KU681081.3
Select seq gb|KU740184.1|	Zika virus isolate GD01 polyprotein gene, complete cds	810	810	100%	0.0	99%	KU740184.1
Select seq gb|KU740199.1|	Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds	810	810	100%	0.0	99%	KU740199.1
Select seq gb|KF993678.1|	Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds	796	796	100%	0.0	98%	KF993678.1
Select seq gb|JN860885.1|	Zika virus isolate FSS13025 polyprotein gene, partial cds	796	796	100%	0.0	98%	JN860885.1
Select seq gb|KU681082.3|	Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome	792	792	100%	0.0	98%	KU681082.3
Select seq gb|EU545988.1|	Zika virus polyprotein gene, complete cds	756	756	100%	0.0	97%	EU545988.1
Select seq gb|HQ234499.1|	Zika virus isolate P6-740 polyprotein gene, partial cds	726	726	100%	0.0	95%	HQ234499.1

[niman]

Sequence map updated

https://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en