niman Posted March 25, 2016 Report Share Posted March 25, 2016 University of Helsinki has release a full Zika sequence from fetal brain collected at George Washington University Hospital ex-Guatemala, FB-GWUH-2016, on Feb 2, 2016http://www.ncbi.nlm.nih.gov/nuccore/KU870645 Link to comment Share on other sites More sharing options...
niman Posted March 25, 2016 Author Report Share Posted March 25, 2016 LOCUS KU870645 10798 bp RNA linear VRL 22-MAR-2016 DEFINITION Zika virus isolate FB-GWUH-2016, complete genome. ACCESSION KU870645 VERSION KU870645.1 GI:1006593136 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10798) AUTHORS Driggers,R.W., Ho,C.-Y., Korhonen,E.M., Kuivanen,S., Jaaskelainen,A.J., Smura,T., Rosenberg,A., Hill,A., DeBiasi,R., Vezina,G., Timofeev,J., Rodriguez,F.J., Levanov,L., Razak,J., Iyengar,P., Hennenfent,A., Kennedy,R., Lanciotti,R., du Plessis,A. and Vapalahti,O. TITLE Zika virus infection with prolonged maternal viremia and fetal brain abnormalities JOURNAL Unpublished REFERENCE 2 (bases 1 to 10798) AUTHORS Smura,T., Korhonen,E., Kuivanen,S. and Vapalahti,O. TITLE Direct Submission JOURNAL Submitted (05-MAR-2016) Department of Virology, University of Helsinki, Haartmaninkatu 3, Helsinki 00280, Finland FEATURES Location/Qualifiers source 1..10798 /organism="Zika virus" /mol_type="genomic RNA" /isolate="FB-GWUH-2016" /isolation_source="fetal brain" /host="Homo sapiens" /db_xref="taxon:64320" /country="USA" /collection_date="02-Feb-2016" /note="putative country of infection: Guatemala; passage details: SK-N-SH" CDS 100..10371 /note="contains structural and non-structural proteins" /codon_start=1 /product="polyprotein" /protein_id="AMQ48986.1" /db_xref="GI:1006593137" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWILRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGIG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRAPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPQSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPVAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGATNNTIL EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEETRTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSCIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 ctgtgtgtga atcagactgc gacagttcga gtttgaagcg aaagctagca acagtatcaa 61 caggttttat tttggatttg gaaacgagag tttctggtca tgaaaaaccc aaaaaagaaa 121 tccggaggat tccggattgt caatatgcta aaacgcggag tagcccgtgt gagccccttt 181 gggggcttga agaggctgcc agccggactt ctgctgggtc atgggcccat caggatggtc 241 ttggcgattc tagccttttt gagattcacg gcaatcaagc catcactggg tctcatcaat 301 agatggggtt cagtggggaa aaaagaggct atggaaataa taaagaagtt caagaaagat 361 ctggctgcca tgttgagaat aatcaatgct aggaaggaga agaagagacg aggcgcagat 421 actagtgtcg gaattgttgg cctcctgctg accacagcta tggcagcgga ggtcactaga 481 cgtgggagtg catactatat gtacttggac agaaacgatg ctggggaggc catatctttt 541 ccaaccacat tggggatgaa taagtgttat atacagatca tggatcttgg acacatgtgt 601 gatgccacca tgagctatga gtgccctatg ctggatgagg gggtggaacc agatgacgtc 661 gattgttggt gcaacacgac gtcaacttgg gttgtgtacg gaacctgcca tcacaaaaaa 721 ggtgaagcac ggagatctag aagagctgtg acgctcccct cccattccac taggaagctg 781 caaacgcggt cgcaaacctg gttggaatca agagaataca caaagcactt gattagagtc 841 gaaaattgga tactcaggaa ccctggcttc gcgttagcag cagctgccat cgcttggctt 901 ttgggaagct caacgagcca aaaagtcata tatttggtca tgatactgct gattgccccg 961 gcatacagca tcaggtgcat aggagtcagc aatagggact ttgtggaagg tatgtcaggt 1021 gggacttggg ttgatgttgt cttggaacat ggaggttgtg tcaccgtaat ggcacaggac 1081 aaaccgactg tcgacataga gctggttaca acaacagtca gcaacatggc ggaggtaaga 1141 tcctactgct atgaggcatc aatatcagac atggcttcgg acagccgctg cccaacacaa 1201 ggtgaagcct accttgacaa gcaatcagac actcaatatg tctgcaaaag aacgttagtg 1261 gacagaggct ggggaaatgg atgtggactt tttggcaaag ggagcctggt gacatgcgct 1321 aagtttgcat gctccaagaa aatgaccggg aagagcatcc agccagagaa tctggagtac 1381 cggataatgc tgtcagttca tggctcccag cacagtggga tgatcgttaa tgacacagga 1441 catgaaactg atgagaatag agcgaaggtt gagataacgc ccaattcacc aagagccgaa 1501 gccaccctgg ggggttttgg aagcctagga cttgattgtg aaccgaggac aggccttgac 1561 ttttcagatt tgtattactt gactatgaat aacaagcact ggttggttca caaggagtgg 1621 ttccacgaca ttccattacc ttggcacgct ggggcagaca ccggaactcc acactggaac 1681 aacaaagaag cactggtaga gttcaaggac gcacatgcca aaaggcaaac tgtcgtggtt 1741 ctagggagtc aagaaggagc agttcacacg gcccttgctg gagctctgga ggctgagatg 1801 gatggtgcaa agggaaggct gtcctctggc cacttgaaat gtcgcctgaa aatggataaa 1861 ctcagattga agggcgtgtc atactccttg tgtaccgcag cgttcacatt caccaagatc 1921 ccggctgaaa cactgcacgg gacagtcaca gtggaggtac agtacgcagg gacagatgga 1981 ccttgcaagg ttccagctca gatggcggtg gacatgcaaa ctctgacccc agttgggagg 2041 ttgataaccg ctaaccccgt aatcactgaa agcactgaga actctaagat gatgctggaa 2101 cttgatccac catttgggga ctcttacatt gtcataggaa tcggggagaa gaagatcacc 2161 caccactggc acaggagtgg cagcaccatt ggaaaagcat ttgaagccac tgtgagaggt 2221 gccaagagaa tggcagtctt gggagacaca gcctgggact ttggatcagt tggaggcgct 2281 ctcaactcat tgggcaaggg catccatcaa atttttggag cagctttcaa atcattgttt 2341 ggaggaatgt cctggttctc acaaattctc attggaacgt tgctgatgtg gttgggtctg 2401 aacacaaaga atggatctat ttcccttatg tgcttggcct tagggggagt gttgatcttc 2461 ttatccacag ccgtctctgc tgatgtgggg tgctcggtgg acttctcaaa gaaggagacg 2521 agatgcggta caggggtgtt cgtctataac gacgttgaag cctggaggga caggtacaag 2581 taccatcctg actccccccg tagattggca gcagcagtca agcaagcctg ggaagatggt 2641 atctgcggga tctcctctgt ttcaagaatg gaaaacatca tgtggagatc agtagaaggg 2701 gagctcaacg caatcctgga agagaatgga gttcaactga cggtcgttgt gggatctgta 2761 aaaaacccca tgtggagagc tccacagaga ttgcccgtgc ctgtgaacga gctgccccac 2821 ggctggaagg cttgggggaa atcgtacttc gtcagagcag caaagacaaa taacagcttt 2881 gtcgtggatg gtgacacact gaaggaatgc ccactcaaac atagagcatg gaacagcttt 2941 cttgtggagg atcatgggtt cggggtattt cacactagtg tctggctcaa ggttagagaa 3001 gattattcat tagagtgtga tccagccgtt attggaacag ctgttaaggg aaaggaggct 3061 gtacacagtg atctaggcta ctggattgag agtgagaaga atgacacatg gaggctgaag 3121 agggcccatc tgatcgagat gaaaacatgt gaatggccac agtcccacac attgtggaca 3181 gatggaatag aagagagtga tctgatcata cccaagtctt tagctgggcc actcagccat 3241 cacaatacca gagagggcta caggacccaa atgaaagggc catggcacag tgaagagctt 3301 gaaattcggt ttgaggaatg cccaggcact aaggtccacg tggaggaaac atgtggaaca 3361 agaggaccat ctctgagatc aaccactgca agcggaaggg tgatcgagga atggtgctgc 3421 agggagtgca caatgccccc actgtcgttc cgggctaaag atggctgttg gtatggaatg 3481 gagataaggc ccaggaaaga accagaaagc aacttagtaa ggtcaatggt gactgcagga 3541 tcaactgatc acatggatca cttctccctt ggagtgcttg tgattctgct catggtgcag 3601 gaagggctaa agaagagaat gaccacaaag atcatcataa gcacatcaat ggcagtgctg 3661 gtagctatga tcctgggagg attttcaatg agtgacctgg ctaagcttgc aattttgatg 3721 ggtgccacct tcgcggaaat gaacactgga ggagatgtag ctcatctggc gctgatagcg 3781 gcattcaaag tcagaccagc gttgctggta tctttcatct tcagagctaa ttggacaccc 3841 cgtgaaagca tgctactggc cttggcctcg tgtcttttgc aaactgcgat ctccgccttg 3901 gaaggcgacc tgatggttct catcaatggt tttgctttgg cctggttggc aatacgagcg 3961 atggttgttc cacgcactga taacatcacc ttggcaatcc tggctgctct gacaccactg 4021 gcccggggca cactgcttgt ggcgtggaga gcaggccttg ctacttgcgg ggggtttatg 4081 ctcctctctc tgaagggaaa aggcagtgtg aagaagaact taccatttgt catggccctg 4141 ggactaaccg ctgtgaggct ggtcgacccc atcaacgtgg tgggactgct gttgctcaca 4201 aggagtggga agcggagctg gccccctagc gaagtactca cagctgttgg cctgatatgc 4261 gcattggctg gagggttcgc caaggcagat atagagatgg ctgggcccgt ggccgcggtc 4321 ggtctgctaa ttgtcagtta cgtggtctca ggaaagagtg tggacatgta cattgaaaga 4381 gcaggtgaca tcacatggga aaaagatgcg gaagtcactg gaaacagtcc ccggctcgat 4441 gtggcgctag atgagagtgg tgatttctcc ctggtggagg atgacggtcc ccccatgaga 4501 gagatcatac tcaaggtggt cctgatgacc atctgtggca tgaacccaat agccataccc 4561 tttgcagctg gagcgtggta cgtatacgtg aagactggaa aaaggagtgg tgctctatgg 4621 gatgtgcctg ctcccaagga agtaaaaaag ggggagacca cagatggagt gtacagagta 4681 atgactcgta gactgctagg ttcaacacaa gttggagtgg gagttatgca agagggggtc 4741 tttcacacta tgtggcacgt cacaaaagga tccgcactga gaagcggtga agggagactt 4801 gatccatact ggggagatgt caagcaggat ctggtgtcat actgtggtcc atggaagcta 4861 gatgccgcct gggacgggca cagcgaggtg cagctcttgg ccgtgccccc cggagagaga 4921 gcgaggaaca tccagactct gcccggaata tttaagacaa aggatgggga cattggagcg 4981 gttgcgctgg attacccagc aggaacttca ggatctccaa tcctagacaa gtgtgggaga 5041 gtgataggac tttatggcaa tggggtcgtg atcaaaaatg ggagttatgt tagtgccatc 5101 acccaaggga ggagggagga agagactcct gttgagtgct tcgagccttc gatgctgaag 5161 aagaagcagc taactgtctt agacttacat cctggagctg ggaaaaccag gagagttctt 5221 cctgaaatag tccgtgaagc cataaaaaca agactccgta ctgtgatctt agctccaacc 5281 agggttgtcg ctgctgaaat ggaggaggcc cttagagggc ttccagtgcg ttatatgaca 5341 acagcagtca atgtcaccca ctctggaaca gaaatcgtcg acttaatgtg ccatgccacc 5401 ttcacttcac gtctactaca gccaatcaga gtccccaact ataatctgta tattatggat 5461 gaggcccact tcacagatcc ctcaagtata gcagcaagag gatacatttc aacaagggtt 5521 gagatgggcg aggcggctgc catcttcatg accgccacgc caccaggaac ccgtgacgca 5581 tttccggact ccaactcacc aattatggac accgaagtgg aagtcccaga gagagcctgg 5641 agctcaggct ttgattgggt gacggatcat tctggaaaaa cagtttggtt tgttccaagc 5701 gtgaggaacg gcaatgagat cgcagcttgt ctgacaaagg ctggaaaacg ggtcatacag 5761 ctcagcagaa agacttttga gacagagttc cagaaaacaa aacatcaaga gtgggacttt 5821 gtcgtgacaa ctgacatttc agagatgggc gccaacttta aagctgaccg tgtcatagat 5881 tccaggagat gcctaaagcc ggtcatactt gatggcgaga gagtcattct ggctggaccc 5941 atgcctgtca cacatgccag cgctgctcag aggagggggc gcataggcag gaatcccaac 6001 aaacctggag atgagtatct gtatggaggt gggtgcgcag agactgacga agaccatgca 6061 cactggcttg aagcaagaat gctccttgac aatatttacc tccaagatgg cctcatagcc 6121 tcgctctatc gacctgaggc cgacaaagta gcagccattg agggagagtt caagcttagg 6181 acggagcaaa ggaagacctt tgtggaactc atgaaaagag gagatcttcc tgtttggctg 6241 gcctatcagg ttgcatctgc cggaataacc tacacagata gaagatggtg ctttgatggc 6301 gcgaccaaca acaccatact ggaagacagt gtgccggcag aggtgtggac cagacacgga 6361 gagaaaagag tgctcaaacc gaggtggatg gacgccagag tttgttcaga tcatgcggcc 6421 ctgaagtcat tcaaggagtt tgccgctggg aagagaggag cggcttttgg agtgatggaa 6481 gccctgggaa cactgccagg acacatgaca gagagattcc aggaagccat tgacaacctc 6541 gctgtgctca tgcgggcaga gactggaagc aggccttaca aagccgcggc ggcccaattg 6601 ccggagaccc tagagaccat tatgcttttg gggttgctgg gaacagtctc gctgggaatc 6661 tttttcgtct tgatgaggaa caagggcata gggaagatgg gctttggaat ggtgaccctt 6721 ggggccagtg catggctcat gtggctctcg gaaattgagc cagccagaat tgcatgtgtc 6781 ctcattgttg tgttcctatt gctggtggtg ctcatacctg agccagaaaa gcaaagatct 6841 ccccaggaca accaaatggc aatcatcatc atggtagcag taggtcttct gggcttgatt 6901 accgccaatg aactcggatg gttggagaga acaaagagtg acctaagcca tctaatggga 6961 aggagagagg agggggcaac cataggattc tcaatggaca ttgacctgcg gccagcctca 7021 gcttgggcca tctatgctgc cttgacaact ttcattaccc cagccgtcca acatgcagtg 7081 accacttcat acaacaacta ctccttaatg gcgatggcca cgcaagctgg agtgttgttt 7141 ggtatgggca aagggatgcc attctacgca tgggactttg gagtcccgct gctaatgata 7201 ggttgctact cacaattaac acccctgacc ctaatagtgg ccatcatttt gctcgtggcg 7261 cactacatgt acttgatccc agggctgcag gcagcagctg cgcgtgctgc ccagaagaga 7321 acggcagctg gcatcatgaa gaaccctgtt gtggatggaa tagtggtgac tgacattgac 7381 acaatgacaa ttgaccccca agtggagaaa aagatgggac aggtgctact catagcagta 7441 gccgtctcca gcgccatact gtcgcggacc gcctgggggt ggggggaggc tggggccctg 7501 atcacagccg caacttccac tttgtgggaa ggctctccga acaagtactg gaactcctct 7561 acagccactt cactgtgtaa catttttagg ggaagttact tggctggagc ttctctaatc 7621 tacacagtaa caagaaacgc tggcttggtc aagagacgtg ggggtggaac aggagagacc 7681 ctgggagaga aatggaaggc ccgcttgaac cagatgtcgg ccctggagtt ctactcctac 7741 aaaaagtcag gcatcaccga ggtgtgcaga gaagaggctc gccgcgccct caaggacggt 7801 gtggcaacgg gaggccatgc tgtgtcccga ggaagtgcaa agctgagatg gttggtggag 7861 cggggatacc tgcagcccta tggaaaggtc attgatcttg gatgtggcag agggggctgg 7921 agttactacg ccgccaccat ccgcaaagtt caagaagtga aaggatacac aaaaggaggc 7981 cctggtcatg aagaacccgt gttggtgcaa agctatgggt ggaacatagt ccgtcttaag 8041 agtggggtgg acgtctttca tatggcggct gagccgtgtg acacgttgct gtgtgacata 8101 ggtgagtcat catctagtcc tgaagtggaa gaaacacgga cgctcagagt cctctccatg 8161 gtgggggatt ggcttgaaaa aagaccagga gccttttgta taaaagtgtt gtgcccatac 8221 accagcacta tgatggaaac cctggagcga ctgcagcgta ggtatggggg aggactggtc 8281 agagtgccac tctcccgcaa ctctacacat gagatgtact gggtctctgg agcgaaaagc 8341 aacaccataa aaagtgtgtc caccacgagc cagctcctct tggggcgcat ggacgggcct 8401 aggaggccag tgaaatatga ggaggatgtg aatctcggct ctggcacgcg ggctgtggta 8461 agctgcgctg aagctcccaa catgaagatc attggtaacc gcattgaaag gatccgcagt 8521 gagcacgcgg aaacgtggtt ctttgacgag aaccacccat ataggacatg ggcttaccat 8581 ggaagctatg aggcccccac acaagggtca gcgtcctctc taataaacgg ggttgtcagg 8641 ctcctgtcaa aaccctggga tgtggtgact ggagtcacag gaatagctat gaccgacacc 8701 acaccgtatg gtcagcaaag agttttcaag gaaaaagtgg acactagggt gccagacccc 8761 caagaaggca ctcgtcaggt tatgagcatg gtctcttcct ggttgtggaa agagctaggc 8821 aaacacaaac ggccacgagt ctgtaccaaa gaagagttca tcaacaaggt tcgtagcaat 8881 gcagcattag gggcaatatt tgaagaggaa aaagagtgga agactgcagt ggaagctgtg 8941 aacgatccaa ggttctgggc tctagtggac aaggaaagag agcaccacct gagaggagag 9001 tgccagagtt gtgtgtacaa catgatggga aaaagagaaa agaaacaagg ggaatttgga 9061 aaggccaagg gcagccgcgc catctggtat atgtggctag gggctagatt tctagagttc 9121 gaagcccttg gattcttgaa cgaggatcac tggatgggga gagagaactc aggaggtggt 9181 gttgaagggc tgggattaca aagactcgga tatgtcctag aagagatgag ttgcatacca 9241 ggaggaagga tgtatgcaga tgacactgct ggctgggaca cccgcatcag caggtttgat 9301 ctggagaatg aagctctaat caccaaccaa atggagaaag ggcacagggc cttggcattg 9361 gccataatca agtacacata ccaaaacaaa gtggtaaagg tccttagacc agctgaaaaa 9421 gggaaaacag ttatggacat tatttcgaga caagaccaaa gggggagcgg acaagttgtc 9481 acttacgctc ttaacacatt taccaaccta gtggtgcaac tcattcggaa tatggaggct 9541 gaggaagttc tagagatgca agacttgtgg ctgctgcgga ggtcagagaa agtgaccaac 9601 tggttgcaga gcaacggatg ggataggctc aaacgaatgg cagtcagtgg agatgattgc 9661 gttgtgaagc caattgatga taggtttgca catgccctca ggttcttgaa tgatatggga 9721 aaagttagga aggacacaca agagtggaaa ccctcaactg gatgggacaa ctgggaagaa 9781 gttccgtttt gctcccacca cttcaacaag ctccatctca aggacgggag gtccattgtg 9841 gttccctgcc gccaccaaga tgaactgatt ggccgggccc gcgtctctcc aggggcggga 9901 tggagcatcc gggagactgc ttgcctagca aaatcatatg cgcaaatgtg gcagctcctt 9961 tatttccaca gaagggacct ccgactgatg gccaatgcca tttgttcatc tgtgccagtt 10021 gactgggttc caactgggag aactacctgg tcaatccatg gaaagggaga atggatgacc 10081 actgaagaca tgcttgtggt gtggaacaga gtgtggattg aggagaacga ccacatggaa 10141 gacaagaccc cagttacgaa atggacagac attccctatt tgggaaaaag ggaagacttg 10201 tggtgtggat ctctcatagg gcacagaccg cgcaccacct gggctgagaa cattaaaaac 10261 acagtcaaca tggtgcgcag gatcataggt gatgaagaaa agtacatgga ctacctatcc 10321 acccaagttc gctacttggg tgaagaaggg tctacacctg gagtgctgta agcaccaatc 10381 ttaatgttgt caggcctgct agtcagccac agcttgggga aagctgtgca gcctgtgacc 10441 cccccaggag aagctgggaa accaagccta tagtcaggcc gagaacgcca tggcacggaa 10501 gaagccatgc tgcctgtgag cccctcagag gacactgagt caaaaaaccc cacgcgcttg 10561 gaggcgcagg atgggaaaag aaggtggcga ccttccccac ccttcaatct ggggcctgaa 10621 ctggagatca gctgtggatc tccagaagag ggactagtgg ttagaggaga ccccccggaa 10681 aacgcaaaac agcatattga cgctgggaaa gaccagagac tccatgagtt tccaccacgc 10741 tggccgccag gcacagatcg ccgaatagcg gcggccggtg tggggaaatc catgcagc Link to comment Share on other sites More sharing options...
niman Posted March 25, 2016 Author Report Share Posted March 25, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1842018420100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1841718417100%0.099%KU501216.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1837518375100%0.099%KU509998.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1837218372100%0.099%KJ776791.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1836318363100%0.099%KU707826.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1836318363100%0.099%KU365779.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1836318363100%0.099%KU321639.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome1835718357100%0.099%KU926309.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1835418354100%0.099%KU729218.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1834818348100%0.099%KU365780.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1834518345100%0.099%KU365777.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1833618336100%0.099%KU647676.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1833018330100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1833018330100%0.099%KU312312.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1832718327100%0.099%KU729217.2Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome183271832799%0.099%KU497555.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1832718327100%0.099%KU527068.1Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds1832118321100%0.099%KU820897.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1832118321100%0.099%KU501215.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome1831818318100%0.099%KU922960.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome1831218312100%0.099%KU926310.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome1831218312100%0.099%KU922923.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds1830318303100%0.099%KU820898.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome1830318303100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome1830318303100%0.099%KU853012.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds1829418294100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1829418294100%0.099%KU761564.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1826718267100%0.099%KU820899.2Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds1815918159100%0.099%KU866423.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1813718137100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1802918029100%0.099%KU681081.3Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177301773099%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds176761767698%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1756717567100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1742917429100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds163971639799%0.095%HQ234499.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1328613286100%0.089%KU720415.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds132811328199%0.089%HQ234498.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1327513275100%0.089%KF383115.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1327013270100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1327013270100%0.089%KF268948.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1326313263100%0.089%LC002520.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1326313263100%0.089%KF268950.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1325913259100%0.089%KF383119.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1324313243100%0.089%DQ859059.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1323013230100%0.089%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132141321499%0.089%HQ234501.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1320513205100%0.089%AY632535.2Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1316013160100%0.088%KF383117.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131441314499%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1294513013100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128551285597%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108771087797%0.084%KF383120.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4967496727%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4940494027%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4655465525%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4646464625%0.099%KU646827.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3440344018%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3214321417%0.099%KU740199.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds2879420695%0.071%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2695269514%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2042204211%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2021202111%0.099%KU179098.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds175217529%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds174817489%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds174617469%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds174517459%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds174517459%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds174517459%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds174317439%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds160216028%0.099%KJ873160.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds142014207%0.099%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds138813887%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds135213527%0.098%KM851038.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds134613467%0.099%KU556802.1Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds1306130610%0.088%AF013415.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds124012406%0.099%KU232300.1Select seq gb|KT200609.1|Zika virus isolate BR/949/15 NS5 gene, partial cds124012406%0.099%KT200609.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds123112316%0.099%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds122912296%0.099%KU232297.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds122012206%0.099%KU232294.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds121812186%0.099%KU232292.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds121412146%0.099%KU232298.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds121112116%0.099%KU232296.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds121112116%0.099%KU232293.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds120512056%0.099%KU232295.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds119511956%0.099%KU232288.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds119111916%0.099%KU232289.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds118711876%0.099%KU232299.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds118611866%0.099%KU232291.1Select seq gb|KU758878.1|Zika virus polyprotein gene, partial cds113011306%0.098%KU758878.1Select seq gb|KF270886.1|Zika virus strain CCB-870 envelope glycoprotein gene, partial cds106810688%0.088%KF270886.1Select seq gb|KU867812.1|Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds101810185%0.0100%KU867812.1 Link to comment Share on other sites More sharing options...
niman Posted March 25, 2016 Author Report Share Posted March 25, 2016 Sequence map updatehttps://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en Link to comment Share on other sites More sharing options...
niman Posted March 25, 2016 Author Report Share Posted March 25, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome1852518525100%0.0100%KU870645.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1842018420100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1841718417100%0.099%KU501216.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1837518375100%0.099%KU509998.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1837218372100%0.099%KJ776791.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1836318363100%0.099%KU707826.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1836318363100%0.099%KU365779.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1836318363100%0.099%KU321639.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome1835718357100%0.099%KU926309.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1835418354100%0.099%KU729218.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1834818348100%0.099%KU365780.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1834518345100%0.099%KU365777.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1833618336100%0.099%KU647676.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1833018330100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1833018330100%0.099%KU312312.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1832718327100%0.099%KU729217.2Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome183271832799%0.099%KU497555.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1832718327100%0.099%KU527068.1Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds1832118321100%0.099%KU820897.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1832118321100%0.099%KU501215.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome1831818318100%0.099%KU922960.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome1831218312100%0.099%KU926310.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome1831218312100%0.099%KU922923.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds1830318303100%0.099%KU820898.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome1830318303100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome1830318303100%0.099%KU853012.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds1830018300100%0.099%KU955590.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds1829418294100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1829418294100%0.099%KU761564.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds1826718267100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1826718267100%0.099%KU820899.2Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds1815918159100%0.099%KU866423.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1813718137100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1802918029100%0.099%KU681081.3Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome1773217732100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177301773099%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds176761767698%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1756717567100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1742917429100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds163971639799%0.095%HQ234499.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1328613286100%0.089%KU720415.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds132811328199%0.089%HQ234498.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1327513275100%0.089%KF383115.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome1327213272100%0.089%KU955595.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1327013270100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1327013270100%0.089%KF268948.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome1326313263100%0.089%KU955592.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1326313263100%0.089%LC002520.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1326313263100%0.089%KF268950.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1325913259100%0.089%KF383119.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome1324713247100%0.089%KU955594.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome1324513245100%0.089%KU955591.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1324313243100%0.089%DQ859059.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1323013230100%0.089%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132141321499%0.089%HQ234501.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1320513205100%0.089%AY632535.2Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1316013160100%0.088%KF383117.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131441314499%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1294513013100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128551285597%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108771087797%0.084%KF383120.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4967496727%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4940494027%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4655465525%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4646464625%0.099%KU646827.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3440344018%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3214321417%0.099%KU740199.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds2879420695%0.071%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2695269514%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2042204211%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2021202111%0.099%KU179098.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds175217529%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds174817489%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds174617469%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds174517459%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds174517459%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds174517459%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds174317439%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds160216028%0.099%KJ873160.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds142014207%0.099%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds138813887%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds135213527%0.098%KM851038.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds134613467%0.099%KU556802.1Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds1306130610%0.088%AF013415.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds124012406%0.099%KU232300.1Select seq gb|KT200609.1|Zika virus isolate BR/949/15 NS5 gene, partial cds124012406%0.099%KT200609.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds123112316%0.099%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds122912296%0.099%KU232297.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds122012206%0.099%KU232294.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds121812186%0.099%KU232292.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds121412146%0.099%KU232298.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds121112116%0.099%KU232296.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds121112116%0.099%KU232293.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds120512056%0.099%KU232295.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds119511956%0.099%KU232288.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds119111916%0.099%KU232289.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds118711876%0.099%KU232299.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds118611866%0.099%KU232291.1 Link to comment Share on other sites More sharing options...
niman Posted March 30, 2016 Author Report Share Posted March 30, 2016 (edited) Zika Virus Infection with Prolonged Maternal Viremia and Fetal Brain AbnormalitiesRita W. Driggers, M.D., Cheng-Ying Ho, M.D., Ph.D., Essi M. Korhonen, M.Sc., Suvi Kuivanen, M.Sc., Anne J. Jääskeläinen, Ph.D., Teemu Smura, Ph.D., Avi Rosenberg, M.D., Ph.D., D. Ashley Hill, M.D., Roberta L. DeBiasi, M.D., Gilbert Vezina, M.D., Julia Timofeev, M.D., Fausto J. Rodriguez, M.D., Lev Levanov, Ph.D., Jennifer Razak, M.G.C., C.G.C, Preetha Iyengar, M.D., Andrew Hennenfent, D.V.M., M.P.H., Richard Kennedy, M.D., Robert Lanciotti, Ph.D., Adre du Plessis, M.B., Ch.B., M.P.H., and Olli Vapalahti, M.D., Ph.D.March 30, 2016DOI: 10.1056/NEJMoa1601824 SOURCE INFORMATIONFrom the Department of Gynecology and Obstetrics, Division of Maternal Fetal Medicine (R.W.D., J.T.), and the Department of Pathology (F.J.R.), Johns Hopkins University School of Medicine, Baltimore; the Division of Maternal Fetal Medicine, Sibley Memorial Hospital (R.W.D., J.T., J.R.), the Division of Pathology and Center for Genetic Medicine Research (C.-Y.H., A.R., D.A.H.), Division of Pediatric Infectious Diseases (R.L.D.), Department of Diagnostic Radiology and Imaging (G.V.), and the Fetal Medicine Institute, Division of Fetal and Transitional Medicine (A.P.), Children’s National Health System, the Departments of Integrative Systems Biology (C.-Y.H., D.A.H.), Pediatrics and Microbiology, Immunology and Tropical Medicine (R.L.D.B.), and Radiology and Pediatrics (G.V.), George Washington University School of Medicine and Health Sciences, the Center for Policy, Planning and Evaluation (P.I.) and Centers for Disease Control and Prevention (CDC)–Council of State and Territorial Epidemiologists (CSTE) Applied Epidemiology Fellowship (A.H.), District of Columbia Department of Health, and One Medical Group (R.K.) — all in Washington, DC; the Departments of Virology (E.M.K., S.K., T.S., L.L., O.V.) and Veterinary Biosciences (E.M.K., O.V.), University of Helsinki, and the Department of Virology and Immunology, University of Helsinki and Helsinki University Hospital (A.J.J., O.V.), Helsinki; and the Arboviral Diseases Branch, Division of Vector-Borne Diseases, National Center for Emerging Zoonotic Infectious Diseases, CDC, Atlanta (R.L.).Address reprint requests to Dr. Driggers at [email protected], to Dr. du Plessis at [email protected], or to Dr. Vapalahti at [email protected].http://www.nejm.org/doi/full/10.1056/NEJMoa1601824#t=article Edited March 30, 2016 by niman Link to comment Share on other sites More sharing options...
niman Posted March 31, 2016 Author Report Share Posted March 31, 2016 CASE REPORTA 33-year-old Finnish woman who was in the 11th week of gestation was on holiday in Mexico, Guatemala, and Belize with her husband in late November 2015. (Details are provided in Section 1.0 of the Supplementary Appendix, available with the full text of this article at NEJM.org.) During their travels, she and her husband recalled being bitten by mosquitoes, particularly in Guatemala. One day after her arrival at her current residence in Washington, D.C., she became ill with ocular pain, myalgia, and mild fever (maximum, 37.5°C), which lasted for 5 days. On the second day of fever, a rash developed (Figure 1FIGURE 1Timeline of Symptoms and Radiographic and Laboratory Studies., and Fig. S5 in the Supplementary Appendix). Her husband was concomitantly reporting similar symptoms. Serologic analysis that was performed 4 weeks after the onset of illness while she was on a trip to her native Finland was positive for IgG antibodies and negative for IgM antibodies against dengue virus. Subsequent serologic analysis was positive for both IgG and IgM antibodies against ZIKV, findings that were compatible with acute or recent ZIKV infection. Serologic analysis for the presence of chikungunya virus was negative. The patient had been vaccinated against tick-borne encephalitis and yellow fever more than 10 years earlier.Fetal ultrasonography that was performed at 13, 16, and 17 weeks of gestation (1, 4, and 5 weeks after the resolution of symptoms) showed no evidence of microcephaly or intracranial calcifications. However, there was a decrease in the fetal head circumference from the 47th percentile at 16 weeks to the 24th percentile at 20 weeks.At 16 weeks of gestation, the presence of flavivirus in serum was detected on nested reverse-transcriptase–polymerase-chain-reaction (RT-PCR) assay, and sequencing showed identity to Central American epidemic strains of ZIKV. The finding was confirmed with a specific ZIKV quantitative RT-PCR assay (Table S2 in the Supplementary Appendix). The Division of Vector-Borne Diseases Arbovirus Diagnostic Laboratory at the CDC reported serologic evidence of infection at 17 weeks of gestation, with serum positivity for ZIKV IgM and a titer of more than 1:2560 on a plaque-reduction neutralization test. On the basis of these results, the patient sought more thorough assessment of the fetus.Fetal ultrasonography at 19 weeks of gestation showed abnormal intracranial anatomy (Figure 2FIGURE 2Fetal Ultrasonography at 19 Weeks of Gestation., and Fig. S1 in the Supplementary Appendix). The cerebral mantle appeared to be thin with increased extra-axial spaces. Both frontal horns were enlarged with heterogeneous, predominantly echogenic material present in the frontal horn and body of the left lateral ventricle, a finding that raised concern about intraventricular hemorrhage. Dilation and upward displacement of the third ventricle, dilation of the frontal horns of the lateral ventricles, concave medial borders of the lateral ventricles, and the absence of the cavum septum pellucidum suggested agenesis of the corpus callosum. No parenchymal calcifications were seen. The head circumference measured in the 24th percentile for gestational age. The remainder of the fetal anatomy was normal.Fetal MRI at 20 weeks of gestation showed diffuse atrophy of the cerebral mantle, which was most severe in the frontal and parietal lobes, with the anterior temporal lobes least affected (Figure 3FIGURE 3Magnetic Resonance Imaging of the Fetal Brain at 19 Weeks of Gestation.). The normal lamination pattern of the cerebral mantle was absent, and the subplate zone was largely undetectable. The corpus callosum was significantly shorter than expected for gestational age, with an anterior–posterior length of 14 mm (expected range, 18 to 22).18,19 The cavum septum pellucidum was very small. The lateral ventricles were mildly enlarged, as was the third ventricle, with a transverse diameter measuring 2.5 mm (average measurement at gestational age, 1.75 mm [range, 1.1 to 2.3]).18 The fourth ventricle was normal. The volume of the choroid plexus was unusually prominent, without evidence of hemorrhage. No focal destructive lesions were identified within the cerebral cortex or white matter. The cerebellum was normal in appearance and size. Given the grave prognosis, the patient elected to terminate the pregnancy at 21 weeks of gestation. Link to comment Share on other sites More sharing options...
niman Posted April 1, 2016 Author Report Share Posted April 1, 2016 Ultrasounds missed her Zika infection–until one showed serious harm to her fetus Resize Text Print Article Comments 35 Book mark article Read later list Saved to Reading List By Lena H. Sun March 30 What a new case reveals about pregnant women and the Zika virus Play Video1:15 The case of a Washington, D.C., woman who terminated her pregnancy after contracting Zika provides new information on detecting fetal brain abnormalities. (Gillian Brockell,Claritza Jimenez/The Washington Post)Zika successfully hid through nearly half of a District woman’s pregnancy, its damage to her fetus not showing despite a series of early ultrasounds. But suddenly at 19 weeks, another scan revealed significant abnormalities, and a more sophisticated test one week later identified even greater damage in her baby’s brain. In early February, the woman terminated the pregnancy.The report, published Wednesday in the New England Journal of Medicine, provides troubling new information about the capacity of the virus to infect a fetus and cause serious harm. The case also indicates that Zika may remain in the blood for a long time: The 33-year-old woman still tested positive for Zika 10 weeks after she likely was infected during a trip to Guatemala – far beyond what scientists have thought is the case."This helps put more pieces together in the puzzle because we know so little about how this virus acts and when and how long it stays in your blood after you have symptoms," said Laura Riley, vice chair of obstetrics and gynecology at Massachusetts General Hospital in Boston, who was not part of the study. Even though the study only involves one patient, "it's very important because she was followed so closely and there is so much detailed information. " Get Zika news by emailWe will update you when news breaks about the virus.Sign up [Doctors struggle to counsel pregnant women with Zika]While the case offers important details to researchers and obstetricians-gynecologists counseling pregnant women who may have been exposed to the virus, "we're going to need to study this with a large number of patients to provide guidance for women," said Catherine Spong, acting director for the National Institute of Child Health and Human Development.The woman and her husband traveled on vacation to Mexico, Guatemala and Belize in late November when she was 11 weeks pregnant. The couple told researchers they had been bitten by mosquitoes during their trip, particularly in Guatemala. After returning home, the woman developed eye and muscle pain, fever and a rash. A series of ultrasounds that began one week after her symptoms subsided -- at 13, 16 and 17 weeks of pregnancy -- showed none of the characteristic problems linked to Zika. The most prominent in utero are an abnormally small head and brain calcifications, bright, white spots that indicate something is amiss. Both are key to a diagnosis of a rare condition called microcephaly. Yet on the ultrasound at 19 weeks, significant brain abnormalities appeared: The baby's brain was small and contained an unusual amount of fluid. The cerebral cortex, its outer layer, was very thin. By the 20th week, a fetal MRI showed severe atrophy, especially in the front and top brain areas that are involved in decision-making, learning, vision, hearing, touch and taste. The fetus did not meet the threshold to be diagnosed with microcephaly. CONTENT FROM AUDIBeyond chads: Voting technology catches upThe U.S. has come a long way from hand-counted paper ballots and lever machines.In the initial ultrasounds, "they only looked at the size of the head and looked for brain calcifications to make sure she didn't have microcephaly and reassured her that everything looks okay," said Rita Driggers, one of the study's lead authors and medical director of Sibley Memorial Hospital’s maternal-fetal medicine division. Driggers, an assistant professor of gynecology and obstetrics at Johns Hopkins University School of Medicine, was involved in the patient's care.The takeaway for clinicians, she and others said, is to make sure during ultrasounds to look for other brain changes beyond microcephaly and intracranial calcifications.[Here are CDC's guidelines for couples worried about Zika while trying to get pregnant]Adre du Plessis, director of Children's National Health System's Fetal Medicine Institute and another study author, said Wednesday that the lack of those markers in the earlier ultrasounds may have led to "false reassurances" for the mother. What's more, he said, such delayed diagnosis of brain infection in the fetus may put women who'd opt to terminate a pregnancy "outside the legal limits" of an abortion. Forty-three states prohibit abortions after a specified point in pregnancy -- most often the point of fetal viability -- except when necessary to protect the woman’s life or health.Researchers said they are not recommending that all pregnant women infected with Zika uniformly seek out fetal MRIs, which are expensive and not readily available in many of the countries in Central and South America that have been hardest hit by the Zika epidemic. In the United States, the technology is available at most major medical centers.It's possible that researchers might be able to develop other markers to predict whether babies will become infected and develop abnormalities, du Plessis said.The study also provides new information about how long the virus persists in the blood of an infected person. The common thinking has been that the virus is only present for seven days to about two weeks at the outer limits. But this patient had virus in her blood from the time she became infected, when she was about 11 weeks pregnant, up until the time of her abortion, at 21 weeks."That's a very novel finding and important for future study," said Roberta DeBiasi, Children's chief of infectious disease division and another study author.Have you had an experience with Zika? We'd like to hear from you.It's possible that the woman's persistent infection was the result of the virus replicating in the fetus or placenta, the researchers said.Researchers also found "significant" cell death of neurons in the part of the brain that plays a role in sight, hearing and language, researchers said.https://www.washingtonpost.com/news/to-your-health/wp/2016/03/30/why-ultrasounds-may-give-mothers-with-zika-a-false-sense-of-security/ Link to comment Share on other sites More sharing options...
What a new case reveals about pregnant women and the Zika virus Play Video1:15 The case of a Washington, D.C., woman who terminated her pregnancy after contracting Zika provides new information on detecting fetal brain abnormalities. (Gillian Brockell,Claritza Jimenez/The Washington Post)Zika successfully hid through nearly half of a District woman’s pregnancy, its damage to her fetus not showing despite a series of early ultrasounds. But suddenly at 19 weeks, another scan revealed significant abnormalities, and a more sophisticated test one week later identified even greater damage in her baby’s brain. In early February, the woman terminated the pregnancy.The report, published Wednesday in the New England Journal of Medicine, provides troubling new information about the capacity of the virus to infect a fetus and cause serious harm. The case also indicates that Zika may remain in the blood for a long time: The 33-year-old woman still tested positive for Zika 10 weeks after she likely was infected during a trip to Guatemala – far beyond what scientists have thought is the case."This helps put more pieces together in the puzzle because we know so little about how this virus acts and when and how long it stays in your blood after you have symptoms," said Laura Riley, vice chair of obstetrics and gynecology at Massachusetts General Hospital in Boston, who was not part of the study. Even though the study only involves one patient, "it's very important because she was followed so closely and there is so much detailed information. " Get Zika news by emailWe will update you when news breaks about the virus.Sign up [Doctors struggle to counsel pregnant women with Zika]While the case offers important details to researchers and obstetricians-gynecologists counseling pregnant women who may have been exposed to the virus, "we're going to need to study this with a large number of patients to provide guidance for women," said Catherine Spong, acting director for the National Institute of Child Health and Human Development.The woman and her husband traveled on vacation to Mexico, Guatemala and Belize in late November when she was 11 weeks pregnant. The couple told researchers they had been bitten by mosquitoes during their trip, particularly in Guatemala. After returning home, the woman developed eye and muscle pain, fever and a rash. A series of ultrasounds that began one week after her symptoms subsided -- at 13, 16 and 17 weeks of pregnancy -- showed none of the characteristic problems linked to Zika. The most prominent in utero are an abnormally small head and brain calcifications, bright, white spots that indicate something is amiss. Both are key to a diagnosis of a rare condition called microcephaly. Yet on the ultrasound at 19 weeks, significant brain abnormalities appeared: The baby's brain was small and contained an unusual amount of fluid. The cerebral cortex, its outer layer, was very thin. By the 20th week, a fetal MRI showed severe atrophy, especially in the front and top brain areas that are involved in decision-making, learning, vision, hearing, touch and taste. The fetus did not meet the threshold to be diagnosed with microcephaly. CONTENT FROM AUDIBeyond chads: Voting technology catches upThe U.S. has come a long way from hand-counted paper ballots and lever machines.In the initial ultrasounds, "they only looked at the size of the head and looked for brain calcifications to make sure she didn't have microcephaly and reassured her that everything looks okay," said Rita Driggers, one of the study's lead authors and medical director of Sibley Memorial Hospital’s maternal-fetal medicine division. Driggers, an assistant professor of gynecology and obstetrics at Johns Hopkins University School of Medicine, was involved in the patient's care.The takeaway for clinicians, she and others said, is to make sure during ultrasounds to look for other brain changes beyond microcephaly and intracranial calcifications.[Here are CDC's guidelines for couples worried about Zika while trying to get pregnant]Adre du Plessis, director of Children's National Health System's Fetal Medicine Institute and another study author, said Wednesday that the lack of those markers in the earlier ultrasounds may have led to "false reassurances" for the mother. What's more, he said, such delayed diagnosis of brain infection in the fetus may put women who'd opt to terminate a pregnancy "outside the legal limits" of an abortion. Forty-three states prohibit abortions after a specified point in pregnancy -- most often the point of fetal viability -- except when necessary to protect the woman’s life or health.Researchers said they are not recommending that all pregnant women infected with Zika uniformly seek out fetal MRIs, which are expensive and not readily available in many of the countries in Central and South America that have been hardest hit by the Zika epidemic. In the United States, the technology is available at most major medical centers.It's possible that researchers might be able to develop other markers to predict whether babies will become infected and develop abnormalities, du Plessis said.The study also provides new information about how long the virus persists in the blood of an infected person. The common thinking has been that the virus is only present for seven days to about two weeks at the outer limits. But this patient had virus in her blood from the time she became infected, when she was about 11 weeks pregnant, up until the time of her abortion, at 21 weeks."That's a very novel finding and important for future study," said Roberta DeBiasi, Children's chief of infectious disease division and another study author.Have you had an experience with Zika? We'd like to hear from you.It's possible that the woman's persistent infection was the result of the virus replicating in the fetus or placenta, the researchers said.Researchers also found "significant" cell death of neurons in the part of the brain that plays a role in sight, hearing and language, researchers said.https://www.washingtonpost.com/news/to-your-health/wp/2016/03/30/why-ultrasounds-may-give-mothers-with-zika-a-false-sense-of-security/
niman Posted April 6, 2016 Author Report Share Posted April 6, 2016 Zika: established the first association with microcephaly The virus was isolated from the tissues of a fetus and identified in the mother's blood, weeks after the disappearance of symptomsPublished on April 4, 2016 by Eleanor Degano in RESEARCH , HEALTH // 1 CommentThe infection of the Zika virus during pregnancy appears to be associated with a risk of microcephaly in the child. Image credits: tipstimes.com/pregnancy, FlickrHEALTH - Researchers at the University of Helsinki have managed to isolate the Zika virusfrom the brain tissue of a fetus developing, after spotting it in the mother's blood samples. The study, conducted on a single pregnant woman, was recently published on The New England Journal of Medicine . Although this is for now only a single case, it would be the first to confirm the association between infection and Zika microcephaly , pathology that affects fetuses and causes significant reduction in brain volume and head circumference.In one year the cases of microcephaly registered in Brazil were more than 4000, but during the health emergency in recent months scientists around the world have remained cautious in confirming an association with the virus, known for some time and suddenly jumped in the spotlight. Earlier this month, another research has clarified what are the outlets cells targetedby the infection, but the authors had reiterated that it was still early to speak of a causal effect. Brazil is not the only one to be hit hard: in 2013 in French Polynesia cases of Zika virus infection were 28 000, 11% of the population, and the virus has continued to maintain a presence in the following years. In the same period, health officials reported an increase in cases of brain malformations and polimalformative syndromes that could be associated just to Zika.Now things could change: Olli Vapalahti and Finnish university colleagues have shown that small traces of genetic material Zika can be detected in the blood of a pregnant woman even weeks after the end of the symptoms (rashes, fever ...). In these early stages of fetal development, the techniques of neuroimaging have allowed us to observe the growth of the brain and identify abnormalities, already present.The emergency surrounding Zika caught us unprepared in part, even if the virus is known from the forties of last century, when it was discovered in Uganda. Precisely why many laboratories around the world have immediately put to work to think of a vaccine and effective antiviral treatment. One of these, at Purdue University , was the first to determine the structure of the virus and identify the characteristics that could be targeted in fight infection. "The structure of the virus gives us a hypothetical map with the regions to be hit with a therapeutic treatment, to be used to develop a vaccine or to improve our ability to diagnose and distinguish infection Zika from that of other similar viruses," comments in a statement Richard Kuhn, the scientist who led the study just came out of Science .In addition to describing structure, Kuhn and colleagues also identified the differences that distinguish it from other Zika Flavivirus (transmitted by the same host species mosquitoes,Aedes aegypti and Aedes albopictus ) as dengue, West Nile fever, yellow fever and Japanese encephalitis. All these features help us to know him better, both from the point of view of the transmission is the onset of symptoms. With regard to the diagnosis, the methods recommended by the experts are the detection of viral RNA and the presence of antibodies in the blood. Pregnant women are recommended to undergo ultrasound, as well as to examine the amniotic fluid to determine the possible presence of Zika.To date, transmission of the virus has been confirmed in 33 countries, 12 of which have also reported an increased incidence of Guillain-Barre syndrome , a disease that affects the nervous system of adults and children, causing muscle weakness and progressive loss of sensitivity. Here, too, we will need new data to establish the causal link with scientific basis.@Eleonoraseeinghttp://oggiscienza.it/2016/04/04/zika-causa-microcefalia-vaccino-virus/ Link to comment Share on other sites More sharing options...
niman Posted April 21, 2016 Author Report Share Posted April 21, 2016 Microcephaly and other fetal malformations potentially associated with Zika virus infection or suggestive of congenital infection have been reported in six countries (Brazil, Cabo Verde, Colombia, French Polynesia, Martinique and Panama). Two cases, each linked to a stay in Brazil, were detected in Slovenia and the United States of America. A further case, linked to a brief stay in Mexico, Guatemala and Belize, was detected in a pregnant woman in the United States of America.http://www.who.int/emergencies/zika-virus/situation-report/21-april-2016/en/ Link to comment Share on other sites More sharing options...
Recommended Posts
Please sign in to comment
You will be able to leave a comment after signing in
Sign In Now