Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. More Zika-Tainted Blood In Florida October 20, 2016 6:58 PM By Gary Nelson Filed Under: Gary Nelson, U.S. Food and Drug Administration, Zika Follow CBSMIAMI.COM: Facebook | Twitter MIAMI (CBSMiami) — The FDA has confirmed to CBS4 News that donated units of blood in Florida have tested positive for the Zika virus. The FDA will not say where or when the tainted blood was discovered, but it is the first since one unit of Zika-infected blood was discovered at an undisclosed donation center in August. Dr. Aileen Marty, a world renowned researcher at Florida International University, says there is good news and bad news in the FDA’s revelations. “Finding it before it is used is very good, because that means we’re doing the right thing, we’re trying to verify whether there are any contaminated bloods before they are given,” she said. But Marty, who is working with a variety of health care agencies on the Zika crisis, worries about the accuracy of the experimental tests being used to detect Zika. She’s concerned about their reliability and the possibility of infected blood getting through. “Just because the test is negative doesn’t necessarily mean that the blood is pure until you have double tested it with a different testing method to be sure that it is, in fact, free of Zika,” Marty said. The three tests being used to screen for Zika in donated blood are not licensed by the FDA, but have been allowed into service on an emergency basis. An FDA spokesperson declined to discuss the screening protocols being used by testing labs, and how many are or are not using the double testing procedure, that Dr. Marty says has been recommended by the Centers For Disease Control. http://miami.cbslocal.com/2016/10/20/more-zika-tainted-blood-in-florida/
  2. The FDA has confirmed to CBS4 News that donated units of blood in Florida have tested positive for the Zika virus. http://miami.cbslocal.com/2016/10/20/more-zika-tainted-blood-in-florida/
  3. Update Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq dbj|LC190723.1| Zika virus gnomic RNA, complete genome, strain: ZIKV/Hu/Yokohama/1/2016 18525 18525 100% 0.0 100% LC190723.1 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 18465 18465 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 18465 18465 100% 0.0 99% KU853012.1 Select seq gb|KX842449.2| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL010U polyprotein gene, complete cds 18453 18453 100% 0.0 99% KX842449.2 Select seq gb|KX922707.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL039U polyprotein gene, complete cds 18444 18444 100% 0.0 99% KX922707.1 Select seq gb|KX922703.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL021U polyprotein gene, complete cds 18438 18438 100% 0.0 99% KX922703.1 Select seq gb|KX838905.2| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL02M polyprotein gene, complete cds 18438 18438 100% 0.0 99% KX838905.2 Select seq gb|KX832731.1| Zika virus isolate ZIKV/Homo_sapiens/USA//2016/Hu0015SA polyprotein gene, complete cds 18438 18438 100% 0.0 99% KX832731.1 Select seq gb|KX922706.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL038U polyprotein gene, complete cds 18437 18437 100% 0.0 99% KX922706.1 Select seq gb|KX922704.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL030U polyprotein gene, complete cds 18435 18435 100% 0.0 99% KX922704.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 18435 18435 100% 0.0 99% KX673530.1 Select seq gb|KX838906.2| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL03M polyprotein gene, complete cds 18429 18429 100% 0.0 99% KX838906.2 Select seq gb|KX838904.2| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL01M polyprotein gene, complete cds 18429 18429 100% 0.0 99% KX838904.2 Select seq gb|KX922705.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL032U polyprotein gene, complete cds 18419 18419 100% 0.0 99% KX922705.1 Select seq gb|KX922708.1| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL04M polyprotein gene, complete cds 18411 18411 100% 0.0 99% KX922708.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 18375 18375 100% 0.0 99% KX447510.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 18372 18372 100% 0.0 99% KX280026.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 18366 18366 100% 0.0 99% KX447512.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 18366 18366 100% 0.0 99% KX369547.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 18366 18366 100% 0.0 99% KU509998.3 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 18363 18363 100% 0.0 99% KJ776791.2 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 18363 18363 100% 0.0 99% KX447509.1 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 18363 18363 100% 0.0 99% KU991811.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 18363 18363 100% 0.0 99% KU729217.2 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 18357 18357 100% 0.0 99% KX447513.1 Select seq gb|KX811222.1| Zika virus isolate Brazil_2015_MG, complete genome 18354 18354 100% 0.0 99% KX811222.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 18354 18354 100% 0.0 99% KX197205.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 18354 18354 100% 0.0 99% KX447515.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 18354 18354 100% 0.0 99% KX447511.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 18354 18354 100% 0.0 99% KU321639.1 Select seq gb|KX879604.1| Zika virus isolate SN089, complete genome 18348 18348 100% 0.0 99% KX879604.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 18348 18348 100% 0.0 99% KX447514.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 18348 18348 100% 0.0 99% KX051563.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 18345 18345 100% 0.0 99% KX447516.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 18345 18345 100% 0.0 99% KU729218.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 18345 18345 100% 0.0 99% KU707826.1 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 18345 18345 100% 0.0 99% KU527068.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 18345 18345 100% 0.0 99% KU365779.1 Select seq gb|KX879603.1| Zika virus isolate SN062, complete genome 18339 18339 100% 0.0 99% KX879603.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 18339 18339 100% 0.0 99% KX262887.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 18339 18339 100% 0.0 99% KX197192.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 18339 18339 100% 0.0 99% KU926310.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 18339 18339 100% 0.0 99% KU926309.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 18336 18336 100% 0.0 99% KU940228.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 18330 18330 100% 0.0 99% KX694534.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 18330 18330 100% 0.0 99% KX198135.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 18330 18330 100% 0.0 99% KU501217.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 18330 18330 100% 0.0 99% KU365780.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 18327 18327 100% 0.0 99% KU647676.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 18327 18327 100% 0.0 99% KU501216.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 18327 18327 100% 0.0 99% KU365777.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 18321 18321 100% 0.0 99% KX447517.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 18321 18321 100% 0.0 99% KU758877.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 18321 18321 100% 0.0 99% KX247646.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 18321 18321 100% 0.0 99% KX156776.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 18318 18318 100% 0.0 99% KX520666.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 18318 18318 100% 0.0 99% KX156774.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 18318 18318 99% 0.0 99% KU497555.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 18312 18312 100% 0.0 99% KU820897.5 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 18312 18312 100% 0.0 99% KX247632.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 18312 18312 100% 0.0 99% KX156775.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 18312 18312 100% 0.0 99% KX087102.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 18312 18312 100% 0.0 99% KU365778.1 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 18312 18312 100% 0.0 99% KU312312.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 18309 18309 100% 0.0 99% KU922960.1 Select seq gb|KX806557.2| Zika virus isolate TS17-2016, complete genome 18303 18303 100% 0.0 99% KX806557.2 Select seq gb|KX856011.1| Zika virus strain ZIKV/Aedes sp./MEX_I-44/2016, complete genome 18303 18303 100% 0.0 99% KX856011.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 18303 18303 100% 0.0 99% KX548902.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 18303 18303 100% 0.0 99% KX446951.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 18303 18303 100% 0.0 99% KU937936.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 18303 18303 100% 0.0 99% KU922923.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 18303 18303 100% 0.0 99% KU501215.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 18300 18300 100% 0.0 99% KX601168.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 18300 18300 100% 0.0 99% KX446950.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 18300 18300 100% 0.0 99% KX087101.2 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 18300 18300 100% 0.0 99% KU870645.1 Select seq gb|KX893855.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-2/2016, complete genome 18298 18298 100% 0.0 99% KX893855.1 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 18294 18294 100% 0.0 99% KX702400.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 18294 18294 100% 0.0 99% KX377337.1 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 18285 18285 100% 0.0 99% KX766029.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 18285 18285 100% 0.0 99% KU820898.1 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 18282 18282 100% 0.0 99% KX056898.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 18282 18282 100% 0.0 99% KU955590.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 18278 18278 100% 0.0 99% KX766028.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 18276 18276 100% 0.0 99% KU740184.2 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 18276 18276 100% 0.0 99% KU761564.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 18273 18273 100% 0.0 99% KX117076.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 18264 18264 100% 0.0 99% KX185891.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 18264 18264 100% 0.0 99% KU963796.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 18258 18258 100% 0.0 99% KX253996.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 18258 18258 100% 0.0 99% KU955589.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 18258 18258 100% 0.0 99% KU820899.2 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 18254 18254 100% 0.0 99% KX266255.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 18254 18254 100% 0.0 99% KU866423.2 Select seq gb|KU940224.1| Zika virus isolate Bahia09, partial genome 18240 18240 99% 0.0 99% KU940224.1 Select seq gb|KU744693.1| Zika virus isolate VE_Ganxian, complete genome 18119 18119 100% 0.0 99% KU744693.1 Select seq gb|KX827309.1| Zika virus isolate ZKA-16-291 polyprotein gene, complete cds 18096 18096 100% 0.0 99% KX827309.1 Select seq gb|KX813683.1| Zika virus isolate ZKA-16-097 polyprotein gene, complete cds 18083 18083 100% 0.0 99% KX813683.1 Select seq gb|KU681081.3| Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome 18029 18029 100% 0.0 99% KU681081.3 Select seq gb|KX694532.1| Zika virus strain ZIKV/Homo sapiens/THA/PLCal_ZV/2013, complete genome 17915 17915 100% 0.0 99% KX694532.1
  4. http://rense2.gsradio.net/rense/special/rense_102016_hr1.mp3
  5. Comments from 10/13 http://recombinomics.co/thedrnimanshow/2016/10/101316.mp3
  6. http://www.renseradio.com/listenlive.htm
  7. ACTIVE INVESTIGATIONS Information on Active Investigations When a local case of Zika virus is confirmed through laboratory testing, the department conducts a thorough investigation around the case to determine if additional people are infected. The department interviews and tests close contacts and community members around the case. Knowing if additional people are infected helps the department determine if there is a zone where mosquitoes are transmitting the virus. Not every case results in a designation of active transmission in an area. In some instances, a case of Zika is an isolated incident with no additional people infected. For more information on the department’s testing and investigation process, click here. paragraph break Current Number of Active Investigations: 10 Miami-Dade County: 6 open investigations Palm Beach: 1 open investigations Unknown: 3 open investigations *Note: Exposure occurred in Miami Beach and overseas in an area with widespread transmission of Zika. paragraph break Current Number of Closed Investigations: 33 Miami-Dade County: 26 closed investigations Palm Beach County: 5 closed investigation Broward County: 1 closed investigation Pinellas: 1 closed investigation paragraph break Sampling Activities For Active Investigations Miami Beach in Miami-Dade County (Area of Active Transmission) Total # of Samples Collected Positive Negative Pending Results 1,061 69 992 0 paragraph break One-square mile area within NW 79th St. to the North, NW 63rd St. to the South, NW 10th Ave. to the West and N. Miami Ave. to the East in Miami-Dade County (Area of Active Transmission) Total # of Samples Collected Positive Negative Pending Results 70 4 39 27 paragraph break Palm Beach County – 1 Investigation Total # of Samples Collected Positive Negative Pending Results 0 0 0 0 paragraph break Miami-Dade Investigations Outside of Areas of Active Transmission– 6 Investigations Total # of Samples Collected Positive Negative Pending Results 29 0 29 0 paragraph break Wynwood Area in Miami-Dade County – Note: This investigation is closed, but the department is providing the sampling results below for reference. Total # of Samples Collected Positive Negative Pending Results 525 33 491 0 Data as of Oct. 20, 2016 - 5:00 PM ET
  8. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  9. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  10. October 20, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are three new travel related cases today with two in Miami-Dade County and one involving a pregnant woman. Please visit our website to see the full list of travel-related cases. There is one new non-travel related case today involving a Palm Beach County resident. The case had recent travel to Miami and the department is investigating to determine the location of exposure. DOH continues door-to-door outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the identified areas in Miami-Dade County. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 747 Non-Travel Related Infections of Zika 166 Infections Involving Pregnant Women 111 Out of State Cases (not Florida Residents) 19 Undetermined 5 Total 1,048 The timelines below are as of Oct. 13 and will be updated every Friday. Note: Asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 10 active investigations. The department has closed 33 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 9,283 people statewide. Florida currently has the capacity to test 8,967 people for active Zika virus and 6,720 for Zika antibodies. At Governor Scott’s direction, all county health departments offer free Zika risk assessment and testing to pregnant women. Florida’s small case clusters is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted areas in Miami-Dade County (see maps below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 106. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted more than 6,986 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. click image above to enlarge click image above to enlarge About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  11. October 20, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are three new travel related cases today with two in Miami-Dade County and one involving a pregnant woman. Please visit our website to see the full list of travel-related cases. There is one new non-travel related case today involving a Palm Beach County resident. The case had recent travel to Miami and the department is investigating to determine the location of exposure. DOH continues door-to-door outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the identified areas in Miami-Dade County. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 747 Non-Travel Related Infections of Zika 166 Infections Involving Pregnant Women 111 Out of State Cases (not Florida Residents) 19 Undetermined 5 Total 1,048 The timelines below are as of Oct. 13 and will be updated every Friday. Note: Asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 10 active investigations. The department has closed 33 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 9,283 people statewide. Florida currently has the capacity to test 8,967 people for active Zika virus and 6,720 for Zika antibodies. At Governor Scott’s direction, all county health departments offer free Zika risk assessment and testing to pregnant women. Florida’s small case clusters is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted areas in Miami-Dade County (see maps below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 106. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted more than 6,986 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. click image above to enlarge click image above to enlarge About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  12. There is one new non-travel related case today involving a Palm Beach County resident. The case had recent travel to Miami and the department is investigating to determine the location of exposure.
  13. There are three new travel related cases today with two in Miami-Dade County and one involving a pregnant woman. Please visit our website to see the full list of travel-related cases. There is one new non-travel related case today involving a Palm Beach County resident.
  14. Infection Type Infection Count Travel-Related Infections of Zika 747 Non-Travel Related Infections of Zika 166 Infections Involving Pregnant Women 111 Out of State Cases (not Florida Residents) 19 Undetermined 5 Total 1,048 http://www.floridahealth.gov/newsroom/2016/10/102016-zika-update.html
  15. Infection Type Infection Count Travel-Related Infections of Zika 747 Non-Travel Related Infections of Zika 166 Infections Involving Pregnant Women 111 Out of State Cases (not Florida Residents) 19 Undetermined 5 Total 1,048 http://www.floridahealth.gov/newsroom/2016/10/102016-zika-update.html
  16. Pregnancy Outcomes in the United States and the District of Columbia Liveborn infants with birth defects* 23 Includes aggregated data reported to the US Zika Pregnancy Registry as of October 13, 2016 Pregnancy losses with birth defects** 5 Includes aggregated data reported to the US Zika Pregnancy Registry as of October 13, 2016
  17. Pregnant Women with Any Laboratory Evidence of Possible Zika Virus Infection US States and the District of Columbia* 899 *Includes aggregated data reported to the US Zika Pregnancy Registry as of October 13, 2016 US Territories** 1,927 **Includes aggregated data from the US territories reported to the US Zika Pregnancy Registry and data from Puerto Rico reported to the Zika Active Pregnancy Surveillance System as of October 13, 2016
  18. As of October 19, 2016 (5 am EST) Zika virus disease and Zika virus congenital infection are nationally notifiable conditions. This update from the CDC Arboviral Disease Branch includes provisional data reported to ArboNET for January 01, 2015 – October 19, 2016. US States Locally acquired mosquito-borne cases reported: 137 Travel-associated cases reported: 3,878 Laboratory acquired cases reported: 1 Total: 4,016 Sexually transmitted: 32 Guillain-Barré syndrome: 14 MAPS OF ZIKA IN THE US More US Territories Locally acquired cases reported: 27,314 Travel-associated cases reported: 88 Total: 27,402* Guillain-Barré syndrome: 40 *Sexually transmitted cases are not reported for US territories because with local transmission of Zika virus it is not possible to determine whether infection occurred due to mosquito-borne or sexual transmission. Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of October 19, 2016)§ States Travel-associated cases* No. (% of cases in states) (N=3,879) Locally acquired cases† No. (% of cases in states) (N=137) Alabama 28 (1) 0 (0) Arizona 36 (1) 0 (0) Arkansas 11 (<1) 0 (0) California 296 (8) 0 (0) Colorado 43 (1) 0 (0) Connecticut 58 (2) 0 (0) Delaware 15 (<1) 0 (0) District of Columbia 25 (1) 0 (0) Florida 708 (18) 137 (100) Georgia 90 (2) 0 (0) Hawaii 14 (<1) 0 (0) Idaho 4 (<1) 0 (0) Illinois 76 (2) 0 (0) Indiana 39 (1) 0 (0) Iowa 16 (<1) 0 (0) Kansas 15 (<1) 0 (0) Kentucky 24 (1) 0 (0) Louisiana 34 (1) 0 (0) Maine 12 (<1) 0 (0) Maryland 104 (3) 0 (0) Massachusetts 100 (3) 0 (0) Michigan 62 (2) 0 (0) Minnesota 47 (1) 0 (0) Mississippi 23 (1) 0 (0) Missouri 27 (1) 0 (0) Montana 7 (<1) 0 (0) Nebraska 12 (<1) 0 (0) Nevada 14 (<1) 0 (0) New Hampshire 10 (<1) 0 (0) New Jersey 134 (3) 0 (0) New Mexico 9 (<1) 0 (0) New York 884 (23) 0 (0) North Carolina 72 (2) 0 (0) North Dakota 2 (<1) 0 (0) Ohio 53 (1) 0 (0) Oklahoma 27 (1) 0 (0) Oregon 29 (1) 0 (0) Pennsylvania†† 141 (4) 0 (0) Rhode Island 32 (1) 0 (0) South Carolina 51 (1) 0 (0) South Dakota 2 (<1) 0 (0) Tennessee 53 (1) 0 (0) Texas 231 (6) 0 (0) Utah 14** (<1) 0 (0) Vermont 7 (<1) 0 (0) Virginia 87 (2) 0 (0) Washington 45 (1) 0 (0) West Virginia 11 (<1) 0 (0) Wisconsin 43 (1) 0 (0) Wyoming 2 (<1) 0 (0) Territories Travel-associated cases* No. (% of cases in territories) (N=88) Locally acquired cases† No. (% of cases in territories) (N=27,314) American Samoa 7 (8) 47 (<1) Puerto Rico 79 (90) 26,798*** (98) US Virgin Islands 2 (2) 469 (2) §Only includes cases meeting the probable or confirmed CSTE case definition and does not include asymptomatic infections unless the case is a pregnant woman with a complication of pregnancy *Travelers returning from affected areas, their sexual contacts, or infants infected in utero †Presumed local mosquito-borne transmission ††One additional case acquired through laboratory transmission **Includes one case with unknown route of person-to-person transmission. ***The Puerto Rico Department of Health is retroactively reporting cases, resulting in larger than normal increases in cases in recent weeks. Page last reviewed: October 20, 2016 Page last updated: October 20, 2016
  19. Zika tests for ALL pregnant women who have been to Miami-Dade County since July, officials insist as the virus continues to spread Previously CDC said people had to be tested after visiting outbreak zones Now, with a new outbreak zone, the CDC has expanded its advice All pregnant women need a Zika test if they visited Miami-Dade since Aug 1 By MIA DE GRAAF FOR DAILYMAIL.COM and ASSOCIATED PRESS PUBLISHED: 08:34 EST, 20 October 2016 | UPDATED: 09:41 EST, 20 October 2016 e-mail View comments All pregnant women who have lived in, visited, or traveled through Miami since August 1 need to be tested for Zika, Florida officials warn. The county is the only area in the continental U.S. where mosquitoes have been spreading the virus since the summer. Last week officials announced a new outbreak zone, also in Miami-Dade County. Two of the new infected patients are pregnant women. +1 Last week officials announced a new outbreak zone, also in Miami-Dade County. Two of the new infected patients are pregnant women Now officials are calling for widespread testing for anyone who has been anywhere near the county - not just the outbreak zones - to prevent further spread and potentially devastating consequences for the health of unborn babies. The Centers for Disease Control and Prevention had previously urged testing for pregnant women who had been in one of the county's Zika 'hot zones.' On Wednesday, it extended the advice to the entire county. New cases continue to come in from the Miami area 'and we want to be cautious,' said the CDC's Dr. Denise Jamieson. Zika infected mosquitoes trapped in Miami area Loaded: 0% Progress: 0% 0:00 Previous Play Skip Mute Current Time0:00 / Duration Time1:20 Fullscreen Need Text RELATED ARTICLES Previous 1 Next 'Some mothers want to hide their children. I'm showing mine...Two pregnant women catch Zika in Miami's new outbreak zone... SHARE THIS ARTICLE Share There have been more than 150 Zika cases in the county blamed on local mosquitoes. Zika is mainly spread by mosquitoes, but can be spread through sex. Most infected people don't get sick. It can cause a mild illness, with fever, rash and joint pain. But infection during pregnancy can lead to severe brain-related birth defects. The new testing advice also extends to pregnant women who weren't in Miami-Dade themselves, but had unprotected sex with someone who had been in the county recently. The advice for travel to Miami-Dade has not changed: Pregnant women should postpone travel to the county if possible and stay out of the two remaining 'red zones' - Miami Beach and an area just north of the Little Haiti neighborhood. Until this summer, the only cases of Zika in the continental U.S. were connected to travel to areas with Zika epidemics, mostly the Caribbean and Latin America. Of the more than 3,900 cases to date, nearly 900 were pregnant women. Dr. Neil Silverman, a UCLA professor of obstetrics, said doctors are probably already taking precautions with their patients who traveled to the Florida county. Beginning in July, 'I started treating Miami-Dade County like Brazil,' said Silverman, who's been advising California health officials on Zika issues. 'If a patient had been anywhere in the Miami area, I offered testing.' Read more: http://www.dailymail.co.uk/health/article-3855710/Zika-tests-pregnant-women-Miami-Dade-County-July-officials-insist-virus-continues-spread.html#ixzz4Ne7A6dP3 Follow us: @MailOnline on Twitter | DailyMail on Facebook
  20. Tonight at 10 PM EDT - Focus will be on Zika spread and sequences in Florida Dr. Henry L. Niman, PhDZika And Flu Season
  21. Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 18465 18465 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 18465 18465 100% 0.0 99% KU853012.1 Select seq gb|KX842449.2| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL010U polyprotein gene, complete cds 18453 18453 100% 0.0 99% KX842449.2 Select seq gb|KX922707.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL039U polyprotein gene, complete cds 18444 18444 100% 0.0 99% KX922707.1 Select seq gb|KX922703.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL021U polyprotein gene, complete cds 18438 18438 100% 0.0 99% KX922703.1 Select seq gb|KX838905.2| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL02M polyprotein gene, complete cds 18438 18438 100% 0.0 99% KX838905.2 Select seq gb|KX832731.1| Zika virus isolate ZIKV/Homo_sapiens/USA//2016/Hu0015SA polyprotein gene, complete cds 18438 18438 100% 0.0 99% KX832731.1 Select seq gb|KX922706.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL038U polyprotein gene, complete cds 18437 18437 100% 0.0 99% KX922706.1 Select seq gb|KX922704.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL030U polyprotein gene, complete cds 18435 18435 100% 0.0 99% KX922704.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 18435 18435 100% 0.0 99% KX673530.1 Select seq gb|KX838906.2| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL03M polyprotein gene, complete cds 18429 18429 100% 0.0 99% KX838906.2 Select seq gb|KX838904.2| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL01M polyprotein gene, complete cds 18429 18429 100% 0.0 99% KX838904.2 Select seq gb|KX922705.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL032U polyprotein gene, complete cds 18419 18419 100% 0.0 99% KX922705.1 Select seq gb|KX922708.1| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL04M polyprotein gene, complete cds 18411 18411 100% 0.0 99% KX922708.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 18375 18375 100% 0.0 99% KX447510.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 18372 18372 100% 0.0 99% KX280026.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 18366 18366 100% 0.0 99% KX447512.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 18366 18366 100% 0.0 99% KX369547.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 18366 18366 100% 0.0 99% KU509998.3 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 18363 18363 100% 0.0 99% KJ776791.2 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 18363 18363 100% 0.0 99% KX447509.1 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 18363 18363 100% 0.0 99% KU991811.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 18363 18363 100% 0.0 99% KU729217.2 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 18357 18357 100% 0.0 99% KX447513.1 Select seq gb|KX811222.1| Zika virus isolate Brazil_2015_MG, complete genome 18354 18354 100% 0.0 99% KX811222.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 18354 18354 100% 0.0 99% KX197205.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 18354 18354 100% 0.0 99% KX447515.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 18354 18354 100% 0.0 99% KX447511.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 18354 18354 100% 0.0 99% KU321639.1 Select seq gb|KX879604.1| Zika virus isolate SN089, complete genome 18348 18348 100% 0.0 99% KX879604.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 18348 18348 100% 0.0 99% KX447514.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 18348 18348 100% 0.0 99% KX051563.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 18345 18345 100% 0.0 99% KX447516.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 18345 18345 100% 0.0 99% KU729218.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 18345 18345 100% 0.0 99% KU707826.1 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 18345 18345 100% 0.0 99% KU527068.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 18345 18345 100% 0.0 99% KU365779.1 Select seq gb|KX879603.1| Zika virus isolate SN062, complete genome 18339 18339 100% 0.0 99% KX879603.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 18339 18339 100% 0.0 99% KX262887.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 18339 18339 100% 0.0 99% KX197192.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 18339 18339 100% 0.0 99% KU926310.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 18339 18339 100% 0.0 99% KU926309.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 18336 18336 100% 0.0 99% KU940228.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 18330 18330 100% 0.0 99% KX694534.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 18330 18330 100% 0.0 99% KX198135.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 18330 18330 100% 0.0 99% KU501217.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 18330 18330 100% 0.0 99% KU365780.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 18327 18327 100% 0.0 99% KU647676.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 18327 18327 100% 0.0 99% KU501216.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 18327 18327 100% 0.0 99% KU365777.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 18321 18321 100% 0.0 99% KX447517.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 18321 18321 100% 0.0 99% KU758877.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 18321 18321 100% 0.0 99% KX247646.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 18321 18321 100% 0.0 99% KX156776.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 18318 18318 100% 0.0 99% KX520666.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 18318 18318 100% 0.0 99% KX156774.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 18318 18318 99% 0.0 99% KU497555.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 18312 18312 100% 0.0 99% KU820897.5 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 18312 18312 100% 0.0 99% KX247632.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 18312 18312 100% 0.0 99% KX156775.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 18312 18312 100% 0.0 99% KX087102.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 18312 18312 100% 0.0 99% KU365778.1 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 18312 18312 100% 0.0 99% KU312312.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 18309 18309 100% 0.0 99% KU922960.1 Select seq gb|KX806557.2| Zika virus isolate TS17-2016, complete genome 18303 18303 100% 0.0 99% KX806557.2 Select seq gb|KX856011.1| Zika virus strain ZIKV/Aedes sp./MEX_I-44/2016, complete genome 18303 18303 100% 0.0 99% KX856011.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 18303 18303 100% 0.0 99% KX548902.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 18303 18303 100% 0.0 99% KX446951.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 18303 18303 100% 0.0 99% KU937936.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 18303 18303 100% 0.0 99% KU922923.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 18303 18303 100% 0.0 99% KU501215.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 18300 18300 100% 0.0 99% KX601168.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 18300 18300 100% 0.0 99% KX446950.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 18300 18300 100% 0.0 99% KX087101.2 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 18300 18300 100% 0.0 99% KU870645.1 Select seq gb|KX893855.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-2/2016, complete genome 18298 18298 100% 0.0 99% KX893855.1 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 18294 18294 100% 0.0 99% KX702400.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 18294 18294 100% 0.0 99% KX377337.1 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 18285 18285 100% 0.0 99% KX766029.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 18285 18285 100% 0.0 99% KU820898.1 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 18282 18282 100% 0.0 99% KX056898.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 18282 18282 100% 0.0 99% KU955590.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 18278 18278 100% 0.0 99% KX766028.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 18276 18276 100% 0.0 99% KU740184.2 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 18276 18276 100% 0.0 99% KU761564.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 18273 18273 100% 0.0 99% KX117076.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 18264 18264 100% 0.0 99% KX185891.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 18264 18264 100% 0.0 99% KU963796.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 18258 18258 100% 0.0 99% KX253996.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 18258 18258 100% 0.0 99% KU955589.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 18258 18258 100% 0.0 99% KU820899.2 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 18254 18254 100% 0.0 99% KX266255.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 18254 18254 100% 0.0 99% KU866423.2 Select seq gb|KU940224.1| Zika virus isolate Bahia09, partial genome 18240 18240 99% 0.0 99% KU940224.1 Select seq gb|KU744693.1| Zika virus isolate VE_Ganxian, complete genome 18119 18119 100% 0.0 99% KU744693.1 Select seq gb|KX827309.1| Zika virus isolate ZKA-16-291 polyprotein gene, complete cds 18096 18096 100% 0.0 99% KX827309.1 Select seq gb|KX813683.1| Zika virus isolate ZKA-16-097 polyprotein gene, complete cds 18083 18083 100% 0.0 99% KX813683.1 Select seq gb|KU681081.3| Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome 18029 18029 100% 0.0 99% KU681081.3 Select seq gb|KX694532.1| Zika virus strain ZIKV/Homo sapiens/THA/PLCal_ZV/2013, complete genome 17915 17915 100% 0.0 99% KX694532.1 Select seq gb|JN860885.1| Zika virus isolate FSS13025 polyprotein gene, partial cds 17730 17730 99% 0.0 98% JN860885.1
  22. LOCUS LC190723 10786 bp RNA linear VRL 19-OCT-2016 DEFINITION Zika virus gnomic RNA, complete genome, strain: ZIKV/Hu/Yokohama/1/2016. ACCESSION LC190723 VERSION LC190723.1 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 AUTHORS Ozawa,H., Usuku,S., Nakayama,E., Tajima,S., Kato,K., Yamashita,A., Sekizika,T. and Kuroda,M. TITLE Zika virus isolate ZIKV/Hu/Yokohama/1/2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10786) AUTHORS Ozawa,H., Usuku,S., Nakayama,E., Tajima,S., Kato,K., Yamashita,A., Sekizika,T. and Kuroda,M. TITLE Direct Submission JOURNAL Submitted (07-OCT-2016) Contact:Hiroki Ozawa Yokohama City Institute of Public Helth, Microbiological Department of Reserch and Testing; 2-7-1 Kanazawa-ku Tomiokahigashi, Yokohama, Kanagawa 236-0051, Japan FEATURES Location/Qualifiers source 1..10786 /organism="Zika virus" /mol_type="genomic RNA" /strain="ZIKV/Hu/Yokohama/1/2016" /host="Homo sapiens" /db_xref="taxon:64320" /country="Japan:Kanagawa, Yokohama" /collection_date="2016-05-20" CDS 90..10361 /codon_start=1 /product="polyprotein" /protein_id="BAV82373.1" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSVVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLVNGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGEEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 atcagactgc gacagttcga gtttgaagcg aaagctagca acagtatcaa caggttttat 61 tttggatttg gaaacgagag tttctggtca tgaaaaaccc aaaaaagaaa tccggaggat 121 tccggattgt caatatgcta aaacgcggag tagcccgtgt gagccccttt gggggcttga 181 agaggctgcc agccggactt ctgctgggtc atgggcccat caggatggtc ttggcgattc 241 tagccttttt gagattcacg gcaatcaagc catcactggg tctcatcaat agatggggtt 301 cagtggggaa aaaagaggct atggaaataa taaagaagtt caagaaagat ctggctgcca 361 tgctgagaat aatcaatgct aggaaggaga agaagagacg aggcgcagat actagtgtcg 421 gaattgttgg cctcctgctg accacagcta tggcagcgga ggtcactaga cgtgggagtg 481 catactacat gtacttggac agaaacgatg ctggggaggc catatctttt ccaaccacat 541 tggggatgaa taagtgttat atacagatca tggatcttgg acacatgtgt gatgccacca 601 tgagctatga atgccctatg ctggatgagg gggtggaacc agatgacgtc gattgttggt 661 gcaacacgac gtcaacttgg gttgtgtacg gaacctgcca tcacaaaaaa ggtgaagcac 721 ggagatctag aagagctgtg acgctcccct cccattccac taggaagctg caaacgcggt 781 cgcaaacctg gttggaatca agagaataca caaagcactt gattagagtc gaaaattgga 841 tattcaggaa ccctggcttc gcgttagcag cagctgccat cgcttggctt ttgggaagct 901 caacgagcca aaaagtcata tacttggtca tgatactgct gattgccccg gcatacagca 961 tcaggtgcat aggagtcagc aatagggact ttgtggaagg tatgtcaggt gggacttggg 1021 ttgatgttgt cttggaacat ggaggttgtg tcaccgtaat ggcacaggac aaaccgactg 1081 tcgacataga gctggttaca acaacagtca gcaacatggc ggaggtaaga tcctactgct 1141 atgaggcatc aatatcagac atggcttcgg acagccgctg cccaacacaa ggtgaagcct 1201 accttgacaa gcaatcagac actcaatatg tctgcaaaag aacgttagtg gacagaggct 1261 ggggaaatgg atgtggactt tttggcaaag ggagcctggt gacatgcgct aagtttgcat 1321 gctccaagaa aatgaccggg aagagcatcc agccagagaa tctggagtac cggataatgc 1381 tgtcagttca tggctcccag cacagtggga tgatcgttaa tgacacagga catgaaactg 1441 atgagaatag agcgaaggtt gagataacgc ccaattcacc aagagccgaa gccaccctgg 1501 ggggttttgg aagcctagga cttgattgtg aaccgaggac aggccttgac ttttcagatt 1561 tgtattactt gactatgaat aacaagcact ggttggttca caaggagtgg ttccacgaca 1621 ttccattacc ttggcacgct ggggcagaca ccggaactcc acactggaac aacaaagaag 1681 cactggtaga gttcaaggac gcacatgcca aaaggcaaac tgtcgtggtt ctagggagtc 1741 aagaaggagc agttcacacg gcccttgctg gagctctgga ggctgagatg gatggtgcaa 1801 agggaaggct gtcctctggc cacttgaaat gtcgcctgaa aatggataaa cttagattga 1861 agggcgtgtc atactccttg tgtaccgcag cgttcacatt caccaagatc ccggctgaaa 1921 cactgcacgg gacagtcaca gtggaggtac agtacgcagg gacagatgga ccttgcaagg 1981 ttccagctca gatggcggtg gacatgcaaa ctctgacccc agttgggagg ttgataaccg 2041 ccaaccccgt aatcactgaa agcactgaga actctaagat gatgctggaa cttgatccac 2101 catttgggga ctcttacatt gtcataggag tcggggagaa gaagatcacc caccactggc 2161 acaggagtgg cagcaccatt ggaaaagcat ttgaagccac tgtgagaggt gccaagagaa 2221 tggcagtctt gggagacaca gcctgggact ttggatcagt tggaggcgct ctcaactcat 2281 tgggcaaggg catccatcaa atttttggag cagctttcaa atcattgttt ggaggaatgt 2341 cctggttctc acaaatcctc attggaacgt tgctgatgtg gttgggtctg aacacaaaga 2401 atggatctat ttccctcatg tgcttggcct tagggggagt gttgatcttc ttatccacag 2461 ccgtctctgc tgatgtgggg tgctcggtgg acttctcaaa gaaggagacg agatgcggca 2521 caggggtgtt cgtctataac gacgttgaag cctggaggga caggtacaag taccatcctg 2581 actccccccg tagattggca gcagcagtca agcaagcctg ggaagatggt atctgcggga 2641 tctcctctgt ttcaagaatg gaaaacatca tgtggagatc agtagaaggg gagctcaatg 2701 caatcctgga agagaatgga gttcaactga cggtcgttgt gggatctgta aaaaacccca 2761 tgtggagagg tccacagaga ttgcccgtgc ctgtgaacga gctgccccac ggctggaagg 2821 cttgggggaa atcgtacttc gttagagcag caaagacaaa taacagcttt gtcgtggatg 2881 gtgacacact gaaggaatgc ccactcaaac atagagcatg gaacagcttt cttgtggagg 2941 atcatggatt cggggtattt cacactagtg tctggctcaa ggttagagaa gattattcat 3001 tagagtgtga tccagccgtt attggaacag ctgttaaggg aaaggaggct gtacacagtg 3061 atctaggcta ctggattgag agtgagaaga atgacacatg gaggctgaag agggcccatc 3121 tgatcgagat gaaaacatgt gaatggccaa agtcccacac attgtggaca gatggaatag 3181 aagagagtga tctgatcata cccaagtctt tagctgggcc actcagccat cacaatacca 3241 gagagggcta caggacccaa atgaaagggc catggcatag tgaagagctt gaaattcggt 3301 ttgaggaatg cccaggcact aaggtccacg tggaggaaac atgtggaaca agaggaccat 3361 ctctgagatc aaccactgca agcggaaggg tgatcgagga atggtgctgc agggagtgca 3421 caatgccccc actgtcgttc cgggctaaag atggctgttg gtatggaatg gagataaggc 3481 ccaggaaaga accagaaagc aacttagtaa ggtcagtggt gactgcagga tcaactgatc 3541 acatggatca cttctccctt ggagtgcttg tgattctgct catggtgcag gaagggctga 3601 agaagagaat gaccacaaag atcatcataa gcacatcaat ggcagtgctg gtagctatga 3661 tcctgggagg attttcaatg agtgacctgg ctaagcttgc aattttgatg ggtgccacct 3721 tcgcggaaat gaacactgga ggagatgtag ctcatctggc gctgatagcg gcattcaaag 3781 tcagaccagc gttgctggta tctttcatct tcagagctaa ttggacaccc cgtgaaagca 3841 tgctgctggc cttggcctcg tgtcttttgc aaactgcgat ctccgccttg gaaggcgacc 3901 tgatggttct catcaatggt tttgctttgg cctggttggc gatacgagcg atggttgttc 3961 cacgcactga taacatcacc ttggcaatcc tggctgctct gacaccactg gcccggggca 4021 cactgcttgt ggcgtggaga gcaggccttg ctacttgcgg ggggtttatg ctcctctctc 4081 tgaagggaaa aggcagtgtg aagaagaact taccatttgt catggccctg ggactaaccg 4141 ctgtgaggct ggtcgacccc atcaacgtgg tgggactgct gttgctcaca aggagtggga 4201 agcggagctg gccccctagc gaagtactca cagctgttgg cctgatatgc gcattggctg 4261 gagggttcgc caaggcagat atagagatgg ctgggcccat ggccgcggtc ggtctgctaa 4321 ttgtcagtta cgtggtctca ggaaagagtg tggacatgta cattgaaaga gcaggtgaca 4381 tcacatggga aaaagatgcg gaagtcactg gaaacagtcc ccggctcgat gtggcgctag 4441 atgagagtgg tgatttctcc ctggtggagg atgacggtcc ccccatgaga gagatcatac 4501 tcaaggtggt cctgatgacc atctgtggca tgaacccaat agccataccc tttgcagctg 4561 gagcgtggta cgtatacgtg aagactggaa aaaggagtgg tgctctatgg gatgtgcctg 4621 ctcccaagga agtaaaaaag ggggagacca cagatggagt gtacagagta atgactcgta 4681 gactgctagg ttcaacacaa gttggagtgg gagttatgca agagggggtc tttcacacta 4741 tgtggcacgt cacaaaagga tccgcgctga gaagcggtga agggagactt gatccatact 4801 ggggagatgt caagcaggat ctggtgtcat actgtggtcc atggaagcta gatgccgcct 4861 gggacgggca cagcgaggtg cagctcttgg ccgtgccccc cggagagaga gcgaggaaca 4921 tccagactct gcccggaata tttaagacaa aggatgggga cattggagcg gttgcgctgg 4981 attacccagc aggaacttca ggatctccaa tcctagacaa gtgtgggaga gtgataggac 5041 tttatggcaa tggggtcgtg atcaaaaatg ggagttatgt tagtgccatc acccaaggga 5101 ggagggagga agagactcct gttgagtgct tcgagccttc gatgctgaag aagaagcagc 5161 taactgtctt agacttgcat cctggagctg ggaaaaccag gagagttctt cctgaaatag 5221 tccgtgaagc tataaaaaca agactccgta ctgtgatctt agctccaacc agggttgtcg 5281 ctgctgaaat ggaggaagcc cttagagggc ttccagtgcg ttatatgaca acagcagtca 5341 atgtcaccca ttctggaaca gaaatcgtcg acttaatgtg ccatgccacc ttcacttcac 5401 gtctactaca gccaatcaga gtccccaact ataatctgta tattatggat gaggcccact 5461 tcacagatcc ctcaagtata gcagcaagag gatacatttc aacaagggtt gagatgggcg 5521 aggcggctgc catcttcatg accgccacgc caccaggaac ccgtgacgca tttccggact 5581 ccaactcacc aattatggac accgaagtgg aagtcccaga gagagcctgg agctcaggct 5641 ttgattgggt gacggatcat tctggaaaaa cagtttggtt tgttccaagc gtgaggaacg 5701 gcaatgagat cgcagcttgt ctgacaaagg ctggaaaacg ggtcatacag ctcagcagaa 5761 agacttttga gacagagttc cagaaaacaa aacatcaaga gtgggacttt gtcgtgacaa 5821 ccgacatttc agagatgggc gccaacttta aagctgaccg tgtcatagat tccaggagat 5881 gcctaaagcc ggtcatactt gatggcgaga gagtcattct ggctggaccc atgcctgtca 5941 cacatgccag cgctgcccag aggagggggc gcataggcag gaatcccaac aaacctggag 6001 atgagtatct gtatggaggt gggtgcgcag agactgacga agaccatgca cactggcttg 6061 aagcaagaat gctccttgac aatatttacc tccaagatgg cctcatagcc tcgctctatc 6121 gacctgaggc cgacaaagta gcagccattg agggagagtt caagcttagg acggagcaaa 6181 ggaagacctt tgtggaactc atgaaaagag gagatcttcc tgtttggctg gcctatcagg 6241 ttgcatctgc cggaataact tacacagata gaagatggtg ctttgatggc acgaccaaca 6301 acaccataat ggaagacagt gtgccggcag aggtgtggac cagacacgga gagaaaagag 6361 tgctcaaacc gaggtggatg gacgccagag tttgttcaga tcatgcggcc ctgaagtcat 6421 tcaaggagtt tgccgctggg aaaagaggag cggcttttgg agtgatggaa gccctgggaa 6481 cactaccagg acacatgaca gagagattcc aggaagccat tgacaacctc gctgtgctca 6541 tgcgggcaga gactggaagc aggccttaca aagccgcggc ggcccaattg ccggagaccc 6601 tagagaccat tatgcttttg gggttgctgg gaacagtctc gctgggaatc tttttcgtct 6661 tgatgaggaa caagggcata gggaagatgg gctttggaat ggtgactctt ggggccagcg 6721 catggctcat gtggctctcg gaaattgagc cagccagaat tgcatgtgtc ctcattgttg 6781 tgttcctatt gctggtggtg ctcatacctg agccagaaaa gcaaagatct ccccaggaca 6841 accaaatggc aatcatcatc atggtagcag taggtcttct gggcttgatc accgccaatg 6901 aactcggatg gttggagaga acaaagagtg acctaagcca tctaatggga aggagagagg 6961 agggagcaac cataggattc tcaatggaca ttgacctgcg gccagcctca gcttgggcca 7021 tctatgctgc cttgacaact ttcattaccc cagccgtcca acatgcagtg accacttcat 7081 acaacaacta ctccttaatg gcgatggcca cgcaagctgg agtgttgttt ggtatgggca 7141 aagggatgcc attctacgca tgggactttg gagtcccgct gctaatgata ggttgctact 7201 cacaattaac acccctaacc ctaatagtgg ccatcatttt gctcgtggcg cactacatgt 7261 acttgatccc agggctgcag gcagcagctg cgcgtgctgc ccagaagaga acggcagctg 7321 gcatcatgaa gaaccctgtt gtggatggaa tagtggtgac tgacattgac acaatgacaa 7381 ttgaccccca agtggagaaa aagatgggac aggtgctact catagcagta gccgtctcca 7441 gcgccatact gtcgcggacc gcctgggggt ggggggaggc tggggccctg atcacagccg 7501 caacttccac tttgtgggaa ggctctccga acaagtactg gaactcctct acagccactt 7561 cactgtgtaa catttttagg ggaagttact tggctggagc ttctctaatc tacacagtaa 7621 caagaaacgc tggcttggtc aagagacgtg ggggtggaac aggagagacc ctgggagaga 7681 aatggaaggc ccgcttgaac cagatgtcgg ccctggagtt ctactcctac aaaaagtcag 7741 gcatcaccga ggtgtgcaga gaagaggccc gccgcgccct caaggacggt gtggcaacgg 7801 gaggccatgc tgtgtcccga ggaagtgcaa agctgagatg gttggtggag cggggatacc 7861 tgcagcccta tggaaaggtc attgatcttg gatgtggcag agggggctgg agttactacg 7921 ccgccaccat ccgcaaagtt caagaagtga aaggatacac aaaaggaggc cctggtcatg 7981 aagaacccgt gttggtgcaa agctatgggt ggaacatagt ccgtctcaag agtggggtgg 8041 acgtctttca tatggcggct gagccgtgtg acacgttgct gtgtgacata ggtgagtcat 8101 catctagtcc tgaagtggaa gaagcacgga cgctcagagt cctctccatg gtgggggatt 8161 ggcttgaaaa aagaccagga gccttttgta taaaagtgtt gtgcccatac accagcacta 8221 tgatggaaac cctggagcga ctgcagcgta ggtatggggg aggactggtc agagtgccac 8281 tctcccgcaa ctctacacat gagatgtact gggtctctgg agcgaaaagc aacaccataa 8341 aaagtgtgtc caccacgagc cagctcctct tggggcgcat ggacgggcct aggaggccag 8401 tgaaatatga ggaggatgtg aatctcggct ctggcacgcg ggctgtggtg agctgcgctg 8461 aagctcccaa catgaagatc attggtaacc gcattgaaag gatccgcagt gagcacgcgg 8521 aaacgtggtt ctttgacgag aaccacccat ataggacatg ggcttaccat ggaagctatg 8581 aggcccccac acaagggtca gcatcctctc tagtaaacgg ggttgtcagg ctcctgtcaa 8641 aaccctggga tgtggtgact ggagtcacag gaatagccat gaccgacacc acaccgtatg 8701 gtcagcaaag agttttcaag gaaaaagtgg acactagggt gccagacccc caagaaggca 8761 ctcgtcaggt tatgagcatg gtctcttcct ggttgtggaa agagctaggc aaacacaaac 8821 ggccacgagt ctgtaccaaa gaagagttca tcaacaaggt tcgtagcaat gcagcattag 8881 gggcaatatt tgaagaggaa aaagagtgga agactgcagt ggaagctgtg aacgatccaa 8941 ggttctgggc tctagtggac aaggaaagag agcaccacct gagaggagag tgccagagtt 9001 gtgtgtacaa catgatggga aaaagagaaa agaaacaagg ggaatttgga aaggccaagg 9061 gcagccgcgc catctggtat atgtggctag gggctagatt tctagagttc gaagcccttg 9121 gattcttgaa cgaggatcac tggatgggga gagagaactc aggaggtggt gttgaagggc 9181 tgggattaca aagactcgga tatgtcctag aagagatgag tcgcatacca ggaggaagga 9241 tgtatgcaga tgacactgct ggctgggata cccgcatcag caggtttgat ctagagaatg 9301 aagctctaat caccaaccaa atggagaaag ggcacagggc cttggcattg gccataatca 9361 agtacacata ccaaaacaaa gtggtaaagg tccttagacc agctgaaaaa gggaaaacag 9421 ttatggacat tatttcgaga caagaccaaa gggggagcgg acaagttgtc acttacgctc 9481 ttaacacatt taccaaccta gtggtgcaac tcattcggaa tatggaggct gaggaagttc 9541 tagagatgca agacttgtgg ctgctgcgga ggtcagagaa agtgaccaac tggttgcaga 9601 gcaacggatg ggataggctc aaacgaatgg cagtcagtgg agatgattgc gttgtgaagc 9661 caattgatga taggtttgca catgccctca ggttcttgaa tgatatggga aaagttagga 9721 aggacacaca agagtggaaa ccctcaactg gatgggacaa ctgggaagaa gttccgtttt 9781 gctcccacca cttcaacaag ctccatctca aggacgggag gtccattgtg gttccctgcc 9841 gccaccaaga tgaactgatt ggccgggccc gcgtctctcc aggggcggga tggagcatcc 9901 gggagactgc ttgcctagca aaatcatatg cgcaaatgtg gcagctcctt tatttccaca 9961 gaagggacct ccgactgatg gccaatgcca tttgttcatc tgtgccagtt gactgggttc 10021 caactgggag aactacctgg tcaatccatg gaaagggaga atggatgacc actgaagaca 10081 tgcttgtggt gtggaacaga gtgtggattg aggagaacga ccacatggaa gacaagaccc 10141 cagttacgaa atggacagac attccctatt tgggaaaaag ggaagacttg tggtgtggat 10201 ctctcatagg gcacagaccg cgcaccacct gggctgagaa cattaaaaac acagtcaaca 10261 tggtgcgcag gatcataggt gaggaagaaa agtacatgga ctacctatcc acccaagttc 10321 gctacttggg tgaagaaggg tctacacctg gagtgctgta agcaccaatc ttaatgttgt 10381 caggcctgct agtcagccac agcttgggga aagctgtgca gcctgtgacc cccccaggag 10441 aagctgggaa accaagccta tagtcaggcc gagaacgcca tggcacggaa gaagccatgc 10501 tgcctgtgag cccctcagag gacactgagt caaaaaaccc cacgcgcttg gaggcgcagg 10561 atgggaaaag aaggtggcga ccttccccac ccttcaatct ggggcctgaa ctggagatca 10621 gctgtggatc tccagaagag ggactagtgg ttagaggaga ccccccggaa aacgcaaaac 10681 agcatattga cgctgggaaa gaccagagac tccatgagtt tccaccacgc tggccgccag 10741 gcacagatcg ccgaatagcg gcggccggtg tggggaaatc catggg
  23. Yokohama City Institute of Public Health has released a full Zika sequence, Yokohama/1/2016, from a May 20, 2016 collection. Although the country of origin is not cited, the sequence matches the sub-clade circulating in Florida.
  24. Advice for people living in or traveling to South Florida Language: English Español Português Recommend on FacebookTweet Miami-Dade County, FL. Red shows areas where pregnant women should not travel. Yellow shows areas where pregnant women should consider postponing travel. On August 1, 2016, CDC issued guidance for people living in or traveling to a 1-square-mile area of the Wynwood neighborhood in Miami, FL, identified by the Florida Department of Health as having mosquito-borne spread of Zika. On August 19, CDC also issued guidance for a 1.5-square-mile section of Miami Beach identified to have mosquito-borne spread of Zika; on September 17, this section was expanded to a 4.5-square-mile area. On September 19, CDC updated guidance for the Wynwood-designated area after three mosquito incubation periods passed without any new locally transmitted cases of Zika. On October 13, Florida announced a new area of mosquito-borne spread of Zika in an additional 1-square-mile area in Miami-Dade County, FL. Because local spread of Zika virus continues to be reported in Miami-Dade County, CDC updated its travel and testing guidance on October 19 to apply recommendations to all of Miami-Dade County. Red and Yellow Area Designation CDC designates areas for Zika virus transmission prevention in the continental United States and Hawaii as red or yellow. Zika active transmission area (red area): A geographic area where local, state, and CDC officials have determined that the intensity of Zika virus transmission presents a significant risk to pregnant women. The intensity of Zika virus transmission is determined by several factors including geographic distribution of cases, number of cases identified, known or suspected links between cases and population density. Zika cautionary area (yellow area): A geographic area where local transmission has been identified, but evidence is lacking that the intensity of transmission is comparable to that in a red area. Although the specific level of risk in yellow areas is unknown, there is still a risk to pregnant women. Additionally, areas adjacent or close to red areas may have a greater likelihood of local Zika virus transmission and are considered to pose a risk to pregnant women. Currently, red areas include a 4.5-square-mile area of Miami Beach and a 1-square-mile area of Little River in Miami-Dade County, FL. The rest of Miami-Dade County is a yellow area. Guidance for Zika cautionary areas (Yellow areas) Travel Pregnant women should consider postponing travel to all parts of Miami-Dade County. Testing and Diagnosis Pregnant women who lived in, traveled to, or had sex without a condom with someone who lived in or traveled to Miami-Dade County after August 1, 2016, should be tested for Zika virus. Pregnant women with symptoms of Zika should be tested for Zika virus. Pregnant women without symptoms who live in or frequently travel (daily, weekly) to Miami-Dade County should talk to their healthcare provider about getting tested in the first and second trimesters of pregnancy. Pregnant women who traveled (limited travel) to Miami-Dade County or who had sex without a condom with a partner who lived in or traveled to Miami-Dade County should be tested for Zika virus, regardless of symptoms. Pregnancy Planning Women who traveled (limited travel) to Miami-Dade County or had sex without a condom with a person who lives in or traveled to Miami-Dade County may consider waiting at least 8 weeks after symptoms started or last possible exposure before trying to get pregnant. Although the level of risk in yellow areas is unknown, pregnant women are still at risk. Men who traveled (limited travel) to Miami-Dade County or had sex without a condom with a person who lives in or traveled to Miami-Dade County may consider waiting at least 6 months after symptoms started or last possible exposure before trying to get their partner pregnant. People living in Miami-Dade County who do not have symptoms and are interested in trying to become pregnant should talk to their healthcare provider about pregnancy plans. Women who live in or frequently travel to Miami-Dade County who are diagnosed with Zika should wait at least 8 weeks after symptoms started before trying to get pregnant. Men who live in or frequently travel to Miami-Dade County who are diagnosed with Zika should wait at least 6 months after symptoms started before trying to get their partner pregnant. Given the limited data available about the persistence of Zika in body fluids and the chances of harm to a pregnancy when the woman is infected with Zika around the time of conception, some couples with a partner with possible Zika virus exposure may choose to wait longer or shorter than the recommended period to try to get pregnant. Prevention Pregnant couples and couples trying to get pregnant who live in or travel to Miami-Dade County should be aware of active Zika virus transmission and should strictly follow steps to prevent mosquito bites. Women and men who live in or traveled to Miami-Dade County should be aware of active Zika virus transmission, and those who are pregnant or who have a pregnant sex partner should use condoms during sex or not have sex during the pregnancy. Guidance for Zika active transmission areas (Red areas) Currently, red areas include a 4.5-square-mile area of Miami Beach and a 1-square-mile area of Little River in Miami-Dade County, FL. Travel Pregnant women should not travel to these areas. Women and men who are planning to get pregnant in the near future should consider avoiding nonessential travel to these areas. Testing and Diagnosis Pregnant women with symptoms of Zika should be tested for Zika. Pregnant women who lived in, traveled to, or had sex without a condom with a person who lived in or traveled to the 4.5-square-mile area of Miami Beach after July 14, 2016, should be tested for Zika. Pregnant women who lived in, traveled to, or had sex without a condom with a person who lived in or traveled to the 1-square-mile area of Little River after August 1, 2016, should be tested for Zika. Pregnancy Planning Women who traveled to these areas or had sex without a condom with a person who lives in or traveled to these areas should wait at least 8 weeks after symptoms started or last possible exposure to try to get pregnant. Although the level of risk in yellow areas is unknown, pregnant women are still at risk. Men who traveled (limited travel) to these areas or had sex without a condom with a person who lives in or traveled to these areas should wait at least 6 months after symptoms started or last possible exposure before trying to get their partner pregnant. People living in these areas who do not have symptoms and are interested in trying to become pregnant should talk to their healthcare provider about pregnancy plans. Women who live in or frequently travel to these areas who are diagnosed with Zika should wait at least 8 weeks after symptoms started before trying to get pregnant. Men who live in or frequently travel to these areas who are diagnosed with Zika should wait at least 6 months after symptoms started before trying to get their partner pregnant. Given the limited data available about the persistence of Zika virus in body fluids and the chances of harm to a pregnancy when the woman is infected with Zika around the time of conception some couples with a partner with possible Zika virus exposure may choose to wait longer or shorter than the recommended period. Prevention Pregnant couples and couples attempting pregnancy who live in or travel to these areas should be aware of active Zika virus transmission and should strictly follow steps to prevent mosquito bites. Women and men who live in or traveled to these areas should be aware of active Zika virus transmission, and those who are pregnant or who have a pregnant sex partner should use condoms during sex or not have sex during the pregnancy. Guidance for areas of previous active transmission The guidance for yellow areas applies to the identified area in Wynwood, FL, with previous active Zika transmission. However, women and men living in or who traveled to the area should be aware that the location was considered to have active Zika virus transmission from June 15 to September 18, 2016. Pregnant women should talk to their doctor or other healthcare provider about getting tested for Zika. Partners of pregnant women should use condoms consistently and correctly to prevent passing Zika during sex, or they should not have sex during the pregnancy. Women who traveled to the area from June 15 to September 18, regardless of whether they had symptoms, should wait at least 8 weeks before trying to get pregnant. Men who traveled to the area from June 15 to September 18, regardless of whether they had symptoms, should wait at least 6 months before trying to get their partner pregnant. For questions on mosquito control in Florida Florida health officials can answer specific questions on their mosquito control program. Aerial treatment of areas with products that rapidly reduce both young and adult mosquitoes can help to limit the number of mosquitoes that carry the Zika virus. Repeated aerial applications of insecticide has reduced mosquito populations as a part of an integrated mosquito management program. ZIKA IS IN YOUR AREA: WHAT TO DO Learn how to protect yourself from Zika infection. WHAT CDC IS DOING TO HELP FLORIDA Page last reviewed: October 19, 2016 Page last updated: October 19, 2016 http://www.cdc.gov/zika/intheus/florida-update.html
  25. U.S. | Wed Oct 19, 2016 | 6:41pm EDT U.S. health officials create color-coded Zika zones in Florida A map showing the active Zika zone is on display at the Borinquen Health Care Center in Miami, Florida, U.S. on August 9, 2016. REUTERS/Chris Keane/File Photo By Julie Steenhuysen | CHICAGO U.S. health officials introduced a new color-coding system on Tuesday for Florida's Miami-Dade County to distinguish between areas of active transmission that present a significant risk of transmission and areas where there is a possible risk of being infected. The new system, announced by the U.S. Centers for Disease Control, casts all of Miami-Dade County as a yellow cautionary area with the exception of Miami Beach and a one square mile area of Miami known as the Little River neighborhood, which are high-risk red zones. Miami is a major tourist destination. Previously, the CDC had warned pregnant women to consider avoiding non-essential travel to Miami-Dade County to reduce their risk infection with Zika, a mosquito-borne virus that has been linked with severe birth defects. "Zika continues to pose a threat to pregnant women living in or traveling to Miami-Dade County," said Dr. Lyle Petersen, director of CDC's Division of Vector-Borne Diseases. "Our guidance today strengthens our travel advice and testing recommendations for pregnant women to further prevent the spread of the infection among those most vulnerable.” Based on the new guidelines, the CDC said it recommends pregnant women consider postponing travel to yellow areas of Miami-Dade County, and they should specifically avoid red areas because they pose "a significant risk to pregnant women." A map of the Zika warning areas can be found here ALSO IN U.S. 'Walking while trans' can be a death sentence in the U.S. Jury to begin deliberations in conspiracy trial of Oregon militants The CDC urged pregnant women who have lived in, traveled to, or had unprotected sex with someone who lived in or traveled to Miami-Dade County since August 1, 2016, to be tested for Zika. Some infectious disease experts have criticized the piecemeal approach to warning women about the risk of Zika in Florida, a state with a multibillion dollar tourism industry. (Reporting by Julie Steenhuysen) http://www.reuters.com/article/us-health-zika-florida-idUSKCN12J2R3

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.