Everything posted by niman
-
Local Zika Cases In Florida Increase To 93
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
-
Likely Local Zika Transmission In June In Miami Beach Florida
- Likely Local Zika Transmission In June In Miami Beach Florida
ZM3: LOCUS KX838906 10610 bp RNA linear VRL 14-SEP-2016 DEFINITION Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/ZM3-7729 polyprotein gene, complete cds. ACCESSION KX838906 VERSION KX838906.1 GI:1063797025 DBLINK BioProject: PRJNA342539 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10610) AUTHORS Grubaugh,N., Paul,L., Gangavarupu,K., Oliveira,G., Robles-Sikisaka,R., Michael,S., Isern,S. and Andersen,K. TITLE Zika virus sequences from Florida, USA, 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10610) AUTHORS Grubaugh,N., Paul,L., Gangavarupu,K., Oliveira,G., Robles-Sikisaka,R., Michael,S., Isern,S. and Andersen,K. TITLE Direct Submission JOURNAL Submitted (12-SEP-2016) Department of Immunology and Microbial Science, The Scripps Research Institute, 10550 North Torrey Pines Road, IMM-210, La Jolla, CA 92037, USA COMMENT ##Assembly-Data-START## Assembly Method :: NovoAlign v. V3.04 Coverage :: 160,000 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10610 /organism="Zika virus" /mol_type="genomic RNA" /isolate="ZIKV/Aedes_aegypti/USA/2016/ZM3-7729" /isolation_source="pool of 15 adult mosquitoes" /host="Aedes aegypti" /db_xref="taxon:64320" /country="USA: Miami, Florida" /collection_date="23-Aug-2016"- Likely Local Zika Transmission In June In Miami Beach Florida
ZF10: LOCUS KX842449 10388 bp RNA linear VRL 14-SEP-2016 DEFINITION Zika virus isolate ZIKV/Human/USA/2016/ZF10.UR-010 polyprotein gene, complete cds. ACCESSION KX842449 VERSION KX842449.1 GI:1063906997 DBLINK BioProject: PRJNA342539 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10388) AUTHORS Grubaugh,N., Tan,A., Gangavarupu,K., Oliveira,G., Robles-Sikisaka,R., Cone,M., Kopp,E., Hogan,K., Cannons,A., Michael,S., Isern,S. and Andersen,K. TITLE Zika virus sequences from Florida, USA, 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10388) AUTHORS Grubaugh,N., Tan,A., Gangavarupu,K., Oliveira,G., Robles-Sikisaka,R., Cone,M., Kopp,E., Hogan,K., Cannons,A., Michael,S., Isern,S. and Andersen,K. TITLE Direct Submission JOURNAL Submitted (13-SEP-2016) Department of Immunology and Microbial Science, The Scripps Research Institute, 10550 North Torrey Pines Road, IMM-210, La Jolla, CA 92037, USA COMMENT ##Assembly-Data-START## Assembly Method :: NovoAlign v. V3.04 Coverage :: 80,000 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10388 /organism="Zika virus" /mol_type="genomic RNA" /isolate="ZIKV/Human/USA/2016/ZF10.UR-010" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="USA: Miami, Florida" /collection_date="22-Jun-2016" /note="direct clinical sequencing; person returned from Cuba 21 days prior to sample collection, but infection may have occurred in Miami"- Likely Local Zika Transmission In June In Miami Beach Florida
Hu15: LOCUS KX832731 10467 bp RNA linear VRL 14-SEP-2016 DEFINITION Zika virus isolate ZIKV/Human/USA/2016/ZL2.SA-Hu0015 polyprotein gene, complete cds. ACCESSION KX832731 VERSION KX832731.1 GI:1063797019 DBLINK BioProject: PRJNA342539 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10467) AUTHORS Grubaugh,N., Gangavarupu,K., Oliveira,G., Robles-Sikisaka,R., Watkins,D., Lichtenberger,P., Ricciardi,M., Bailey,V., Magnani,D. and Andersen,K. TITLE Zika virus sequences from Florida, USA, 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10467) AUTHORS Grubaugh,N., Gangavarupu,K., Oliveira,G., Robles-Sikisaka,R., Watkins,D., Lichtenberger,P., Ricciardi,M., Bailey,V., Magnani,D. and Andersen,K. TITLE Direct Submission JOURNAL Submitted (11-SEP-2016) Department of Immunology and Microbial Science, The Scripps Research Institute, 10550 North Torrey Pines Road, IMM-210, La Jolla, CA 92037, USA COMMENT ##Assembly-Data-START## Assembly Method :: NovoAlign v. V2 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10467 /organism="Zika virus" /mol_type="genomic RNA" /isolate="ZIKV/Human/USA/2016/ZL2.SA-Hu0015" /isolation_source="saliva" /host="Homo sapiens" /db_xref="taxon:64320" /country="USA: Miami, Florida" /collection_date="24-Aug-2016"- Likely Local Zika Transmission In June In Miami Beach Florida
ZM2: LOCUS KX838905 10475 bp RNA linear VRL 14-SEP-2016 DEFINITION Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/ZM2-7719 polyprotein gene, complete cds. ACCESSION KX838905 VERSION KX838905.1 GI:1063797023 DBLINK BioProject: PRJNA342539 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10475) AUTHORS Grubaugh,N., Paul,L., Gangavarupu,K., Oliveira,G., Robles-Sikisaka,R., Michael,S., Isern,S. and Andersen,K. TITLE Zika virus sequences from Florida, USA, 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10475) AUTHORS Grubaugh,N., Paul,L., Gangavarupu,K., Oliveira,G., Robles-Sikisaka,R., Michael,S., Isern,S. and Andersen,K. TITLE Direct Submission JOURNAL Submitted (12-SEP-2016) Department of Immunology and Microbial Science, The Scripps Research Institute, 10550 North Torrey Pines Road, IMM-210, La Jolla, CA 92037, USA COMMENT ##Assembly-Data-START## Assembly Method :: NovoAlign v. V3.04 Coverage :: 160,000 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10475 /organism="Zika virus" /mol_type="genomic RNA" /isolate="ZIKV/Aedes_aegypti/USA/2016/ZM2-7719" /isolation_source="pool of 25 adult mosquitoes" /host="Aedes aegypti" /db_xref="taxon:64320" /country="USA: Miami, Florida" /collection_date="23-Aug-2016"- Likely Local Zika Transmission In June In Miami Beach Florida
ZM1: LOCUS KX838904 10524 bp RNA linear VRL 14-SEP-2016 DEFINITION Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/ZM1-7501 polyprotein gene, complete cds. ACCESSION KX838904 VERSION KX838904.1 GI:1063797021 DBLINK BioProject: PRJNA342539 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10524) AUTHORS Grubaugh,N., Paul,L., Gangavarupu,K., Oliveira,G., Robles-Sikisaka,R., Michael,S., Isern,S. and Andersen,K. TITLE Zika virus sequences from Florida, USA, 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10524) AUTHORS Grubaugh,N., Paul,L., Gangavarupu,K., Oliveira,G., Robles-Sikisaka,R., Michael,S., Isern,S. and Andersen,K. TITLE Direct Submission JOURNAL Submitted (12-SEP-2016) Department of Immunology and Microbial Science, The Scripps Research Institute, 10550 North Torrey Pines Road, IMM-210, La Jolla, CA 92037, USA COMMENT ##Assembly-Data-START## Assembly Method :: NovoAlign v. V3.04 Coverage :: 160,000 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10524 /organism="Zika virus" /mol_type="genomic RNA" /isolate="ZIKV/Aedes_aegypti/USA/2016/ZM1-7501" /isolation_source="pool of 39 adult mosquitoes" /host="Aedes aegypti" /db_xref="taxon:64320" /country="USA: Miami, Florida" /collection_date="22-Aug-2016"- Likely Local Zika Transmission In June In Miami Beach Florida
The two closely related Aedes aegypti mosquito batches, ZM1 (containing 39 mosquitoes collected August 22) and ZM2 (containing 25 mosquitoes collected August 23) are closely related to the human cases, Hu15 (local case collected August 24) and ZF10 (traveler from Cuba collected June 22). The distinct mosquito sequence was ZM3 (containing 15 mosquitoes collected August 15).- Likely Local Zika Transmission In June In Miami Beach Florida
Scripps Clinic has recently released 5 Zika sequences from Miami Beach. Three were from the first 3 batches of mosquitoes from Miami Beach and the characterization sheets give collection dates and number of mosquitoes in each batch. The other two sequences were from cases, one local case and the other a travel case from Cuba. The two human sequences and two of the mosquito sequences are closely related, indicating the travel case was infected in Miami Beach and not Cuba (which is also supported by the 21 day gap between onset of symptoms and return from Cuba). The collection date for the sample for this case was June 22. In addition, the sequence from the earlier mosquito batch suggests it was from an independent introduction.- 2016 Full Singapore Zika Sequence
Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX827309.1| Zika virus isolate ZKA-16-291 polyprotein gene, complete cds 18525 18525 100% 0.0 100% KX827309.1 Select seq gb|KX813683.1| Zika virus isolate ZKA-16-097 polyprotein gene, complete cds 18493 18493 100% 0.0 99% KX813683.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 18236 18236 100% 0.0 99% KX447512.1 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 18231 18231 100% 0.0 99% KX447509.1 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 18227 18227 100% 0.0 99% KJ776791.2 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 18227 18227 100% 0.0 99% KX369547.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 18222 18222 100% 0.0 99% KX447515.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 18218 18218 100% 0.0 99% KX447514.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 18218 18218 100% 0.0 99% KX447513.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 18213 18213 100% 0.0 99% KX447516.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 18213 18213 100% 0.0 99% KX447511.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 18209 18209 100% 0.0 99% KX447510.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 18191 18191 100% 0.0 99% KX447517.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 18182 18182 100% 0.0 99% KU509998.3 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 18177 18177 100% 0.0 99% KU991811.1 Select seq gb|KX806557.1| Zika virus isolate TS17-2016, complete genome 18173 18173 100% 0.0 99% KX806557.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 18173 18173 100% 0.0 99% KX280026.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 18173 18173 100% 0.0 99% KX051563.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 18159 18159 100% 0.0 99% KX197205.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 18159 18159 100% 0.0 99% KU321639.1 Select seq gb|KX811222.1| Zika virus isolate Brazil_2015_MG, complete genome 18155 18155 100% 0.0 99% KX811222.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 18155 18155 100% 0.0 99% KX198135.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 18155 18155 100% 0.0 99% KU729218.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 18150 18150 100% 0.0 99% KU707826.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 18150 18150 100% 0.0 99% KU365779.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 18146 18146 100% 0.0 99% KX262887.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 18146 18146 100% 0.0 99% KX247646.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 18146 18146 100% 0.0 99% KX197192.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 18146 18146 100% 0.0 99% KU926309.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 18141 18141 100% 0.0 99% KX185891.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 18141 18141 100% 0.0 99% KX117076.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 18141 18141 100% 0.0 99% KU963796.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 18141 18141 100% 0.0 99% KU647676.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 18137 18137 100% 0.0 99% KU820897.5 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 18137 18137 100% 0.0 99% KX694534.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 18137 18137 100% 0.0 99% KU758877.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 18137 18137 100% 0.0 99% KX253996.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 18137 18137 100% 0.0 99% KX156776.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 18137 18137 100% 0.0 99% KX087102.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 18137 18137 100% 0.0 99% KU955589.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 18137 18137 100% 0.0 99% KU820899.2 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 18137 18137 100% 0.0 99% KU501217.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 18137 18137 100% 0.0 99% KU365780.1 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 18134 18134 100% 0.0 99% KX266255.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 18134 18134 99% 0.0 99% KU497555.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 18132 18132 100% 0.0 99% KU866423.2 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 18132 18132 100% 0.0 99% KX156774.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 18132 18132 100% 0.0 99% KU940228.1 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 18132 18132 100% 0.0 99% KU527068.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 18132 18132 100% 0.0 99% KU501216.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 18132 18132 100% 0.0 99% KU365777.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 18128 18128 100% 0.0 99% KX156775.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 18128 18128 100% 0.0 99% KU926310.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 18128 18128 100% 0.0 99% KU365778.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 18123 18123 100% 0.0 99% KU922960.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 18123 18123 100% 0.0 99% KU729217.2 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 18119 18119 100% 0.0 99% KX702400.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 18119 18119 100% 0.0 99% KX548902.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 18119 18119 100% 0.0 99% KX247632.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 18119 18119 100% 0.0 99% KU922923.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 18119 18119 100% 0.0 99% KU501215.1 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 18119 18119 100% 0.0 99% KU312312.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 18114 18114 100% 0.0 99% KX601168.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 18114 18114 100% 0.0 99% KX520666.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 18114 18114 100% 0.0 99% KX446950.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 18114 18114 100% 0.0 99% KX087101.2 Select seq gb|KX856011.1| Zika virus strain ZIKV/Aedes sp./MEX_I-44/2016, complete genome 18110 18110 100% 0.0 99% KX856011.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 18110 18110 100% 0.0 99% KX446951.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 18110 18110 100% 0.0 99% KX377337.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 18110 18110 100% 0.0 99% KU937936.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 18105 18105 100% 0.0 99% KU870645.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 18103 18103 100% 0.0 99% KX766028.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 18101 18101 100% 0.0 99% KU820898.1 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 18101 18101 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 18099 18099 100% 0.0 99% KU853012.1 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 18096 18096 100% 0.0 99% KX056898.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 18096 18096 100% 0.0 99% KU955590.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 18092 18092 100% 0.0 99% KU740184.2 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 18092 18092 100% 0.0 99% KU761564.1 Select seq gb|KX842449.1| Zika virus isolate ZIKV/Human/USA/2016/ZF10.UR-010 polyprotein gene, complete cds 18083 18083 100% 0.0 99% KX842449.1 Select seq gb|KX838904.1| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/ZM1-7501 polyprotein gene, complete cds 18083 18083 100% 0.0 99% KX838904.1 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 18083 18083 100% 0.0 99% KX766029.1 Select seq gb|KX838905.1| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/ZM2-7719 polyprotein gene, complete cds 18078 18078 100% 0.0 99% KX838905.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 18078 18078 100% 0.0 99% KX673530.1 Select seq gb|KX832731.1| Zika virus isolate ZIKV/Human/USA/2016/ZL2.SA-Hu0015 polyprotein gene, complete cds 18074 18074 100% 0.0 99% KX832731.1 Select seq gb|KU681081.3| Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome 18069 18069 100% 0.0 99% KU681081.3 Select seq gb|KX838906.1| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/ZM3-7729 polyprotein gene, complete cds 18060 18060 100% 0.0 99% KX838906.1 Select seq gb|KU940224.1| Zika virus isolate Bahia09, partial genome 18038 18038 99% 0.0 99% KU940224.1 Select seq gb|KX694532.1| Zika virus strain ZIKV/Homo sapiens/THA/PLCal_ZV/2013, complete genome 17948 17948 100% 0.0 99% KX694532.1 Select seq gb|KU744693.1| Zika virus isolate VE_Ganxian, complete genome 17948 17948 100% 0.0 99% KU744693.1 Select seq gb|KU955593.1| Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome 17777 17777 100% 0.0 98% KU955593.1 Select seq gb|JN860885.1| Zika virus isolate FSS13025 polyprotein gene, partial cds 17775 17775 99% 0.0 98% JN860885.1 Select seq gb|KF993678.1| Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds 17715 17715 98% 0.0 99% KF993678.1 Select seq gb|EU545988.1| Zika virus polyprotein gene, complete cds 17643 17643 100% 0.0 98% EU545988.1 Select seq gb|KU681082.3| Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome 17470 17470 100% 0.0 98% KU681082.3 Select seq gb|KX601167.1| Zika virus strain ZIKV/Aedes sp./MYS/P6-740/1966, complete genome 16487 16487 100% 0.0 96% KX601167.1 Select seq gb|KX694533.1| Zika virus strain ZIKV/Aedes aegypti/MYS/P6-740/1966, complete genome 16478 16478 100% 0.0 96% KX694533.1 Select seq gb|HQ234499.1| Zika virus isolate P6-740 polyprotein gene, partial cds 16478 16478 99% 0.0 96% HQ234499.1 Select seq gb|KX377336.1| Zika virus strain P6-740, complete genome 16473 16473 100% 0.0 96% KX377336.1 Select seq gb|KX447518.1| Zika virus isolate 1_0117_PF polyprotein gene, partial cds 16072 16072 88% 0.0 99% KX447518.1- 2016 Full Singapore Zika Sequence
LOCUS KX827309 10526 bp RNA linear VRL 14-SEP-2016 DEFINITION Zika virus isolate ZKA-16-291 polyprotein gene, complete cds. ACCESSION KX827309 VERSION KX827309.1 GI:1063302141 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10526) AUTHORS Ng,Y.K., Mak,T.M., Phuah,S.P., Cui,L., Maurer-Stroh,S. and Lin,R.T.P. TITLE Genome sequences of local transmitted Zika viruses in Singapore in 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10526) AUTHORS Ng,Y.K., Mak,T.M., Phuah,S.P., Cui,L., Maurer-Stroh,S. and Lin,R.T.P. TITLE Direct Submission JOURNAL Submitted (07-SEP-2016) National Public Health Laboratory, Communicable Disease Division, Ministry of Health Singapore, 11 Jln Tan Tock Seng, Singapore 308433, Singapore COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10526 /organism="Zika virus" /mol_type="genomic RNA" /isolate="ZKA-16-291" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="Singapore" /collection_date="28-Aug-2016" CDS 32..10303 /codon_start=1 /product="polyprotein" /protein_id="AOO19565.1" /db_xref="GI:1063302142" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAAHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKARLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRYGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPMLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 attttggatt tggaaacgag agtttctggt catgaaaaac ccaaaaaaga aatccggagg 61 attccggatt gtcaatatgc taaaacgcgg agtagcccgt gtgagcccct ttgggggctt 121 gaagaggctg ccagccggac ttctgctggg tcatgggccc atcaggatgg tcttggcgat 181 tctagccttt ttgaggttca cggcaatcaa gccatcactg ggtctcatca atagatgggg 241 ttcagtgggg aaaaaagagg ctatggaaat aataaagaag ttcaagaaag atctggctgc 301 catgctgaga ataatcaatg ctaggaagga gaagaagaga cgaggcgcag atactagtgt 361 cggaattgtt ggcctcctgc tgaccacagc tatggcagcg gaggtcacta gacgtgggag 421 tgcatactat atgtacttgg acagaagcga tgctggggag gccatatctt ttccaaccac 481 actggggatg aataagtgtt atatacagat catggatctt ggacacatgt gtgatgccac 541 catgagctat gaatgcccta tgctggatga gggggtagaa ccagatgacg tcgattgttg 601 gtgcaacacg acgtcaactt gggttgtgta cggaacctgc catcacaaaa aaggtgaagc 661 acggagatct agaagagctg tgacgctccc ctcccattcc actaggaagc tgcaaacgcg 721 gtcgcagacc tggttggagt caagagaata cacaaagcac ttgattagag tcgaaaattg 781 gatattcagg aaccctggct tcgcgttagc agcagctgcc atcgcttggc ttttgggaag 841 ctcaacgagc caaaaagtca tatacttggt catgatactg ctgattgccc cggcatacag 901 catcaggtgc ataggagtca gcaataggga ctttgtggaa ggtatgtcag gtgggacttg 961 ggttgatgtt gtcttggaac atggaggttg tgtcaccgta atggcacagg acaaaccgac 1021 tgtcgacata gagctggtta caacaacagt cagcaacatg gcggaggtaa gatcctactg 1081 ctatgaggca tcaatatcgg acatggcttc ggacagccgc tgcccaacac aaggtgaagc 1141 ctaccttgac aagcaatcag atacccaata tgtctgcaaa agaacgttag tggacagagg 1201 ctggggaaat ggatgtggac tttttggaaa agggagcctg gtgacatgcg ctaagtttgc 1261 atgctccaag aaaatgaccg ggaagagcat ccagccagag aatctggagt accggataat 1321 gctgtcagtc catggctccc agcacagtgg gatgatcgtt aatgacacag gacatgaaac 1381 tgatgagaat agagcgaagg ttgagataac gcccaattca ccaagagccg aagccaccct 1441 ggggggtttt ggaagcctag gacttgattg tgaaccgagg acaggccttg acttttcaga 1501 tttgtattac ttgactatga ataacaagca ctggttggtc cacaaggagt ggttccacga 1561 cattccatta ccttggcacg ctggggcaga caccggaact ccacactgga acaacaaaga 1621 agcactggta gagttcaagg acgcacatgc caaaaggcaa actgtcgtgg ttctagggag 1681 tcaagaagga gcagttcaca cggcccttgc tggagctctg gaggctgaga tggatggtgc 1741 aaagggaagg ctgtcctctg gccacttgaa atgtcgcctg aaaatggaca aacttagatt 1801 gaagggcgtg tcatactcct tgtgtaccgc agcgttcaca ttcaccaaga tcccggctga 1861 aacactgcac gggacagtca cagtggaggt acagtacgca gggacagatg gaccctgcaa 1921 ggttccagct cagatggcgg tggacatgca aactctgacc ccagttggga ggttgataac 1981 cgctaacccc gtaatcactg aaagcactga gaactctaag atgatgctgg aacttgatcc 2041 accatttggg gactcttaca ttgtcatagg agtcggggag aagaagatca cccaccactg 2101 gcacaggagt ggcagtacca ttggaaaagc atttgaagcc actgtgagag gtgccaagag 2161 aatggcagtc ttgggagaca cagcctggga ctttggatca gttggaggcg ctctcaactc 2221 attgggcaag ggcatccatc aaatttttgg agcagctttc aaatcattgt ttggaggaat 2281 gtcctggttc tcacaaattc tcattggaac gttgctgatg tggttgggcc tgaacacaaa 2341 gaatggatct atttccctta tgtgcttggc cttaggggga gtgttgatct tcttatccac 2401 agccgtctct gctgatgtgg ggtgctcggt ggacttctca aagaaggaaa cgagatgcgg 2461 tacaggggtg ttcgtctata acgacgttga agcctggagg gacaggtaca agtaccatcc 2521 tgactccccc cgtagattgg cagcagcagt caagcaagcc tgggaagatg gtatctgtgg 2581 gatctcctct gtttcaagaa tggaaaacat catgtggaga tcagtagaag gggagctcaa 2641 cgcaatcctg gaagaaaatg gagttcaact gacggtcgtt gtgggatctg taaaaaaccc 2701 catgtggaga ggtccacaga gactgcccgt gcctgtgaac gagctgcccc acggctggaa 2761 ggcttggggg aaatcgtact tcgtcagagc agcaaagaca aataacagct ttgtcgtgga 2821 tggtgacaca ctgaaggaat gcccactcaa acatagagca tggaacagct ttcttgtgga 2881 ggatcatggg ttcggggtat ttcacactag tgtctggctc aaggttagag aagattattc 2941 attagagtgt gatcctgccg ttattggaac agctgttaag ggaaaggagg ctgcacacag 3001 tgatctaggc tactggattg agagtgagaa gaatgacaca tggaggctga agagggccca 3061 cctgatcgag atgaaaacat gtgaatggcc aaagtcccac acattgtgga cagatggaat 3121 agaagagagt gatctgatca tacccaagtc tttagctggg ccactcagcc atcacaacac 3181 cagagagggc tacaggaccc aaatgaaagg gccatggcac agtgaagagc ttgaaattcg 3241 gtttgaggaa tgcccaggca ctaaggtcca cgtggaggaa acatgtggaa caagaggacc 3301 gtctctgaga tcaaccactg caagcggaag ggtgatcgag gaatggtgct gcagggagtg 3361 cacaatgccc ccactgtcgt tccgggctaa agatggctgt tggtatggaa tggagataag 3421 gcccaggaaa gaaccagaaa gtaacttagt aaggtcaatg gtgactgcag gatcaactga 3481 tcacatggat cacttctccc ttggagtgct tgtgattctg ctcatggtgc aggaagggct 3541 gaagaagaga atgaccacaa agatcatcat aagcacatca atggcagtgc tggtagctat 3601 gatcctggga ggattttcaa tgagtgacct ggctaagctt gcaattttga tgggtgccac 3661 cttcgcggaa atgaacactg gaggagatgt agctcatctg gcgctgatag cggcattcaa 3721 agtcagacca gcgttgctgg tatctttcat cttcagagct aattggacac cccgtgaaag 3781 catgctgctg gccttggcct cgtgtctttt gcaaactgcg atttccgcct tggaaggcga 3841 cctgatggtt ctcatcaatg gttttgctct ggcctggttg gcaatacgag cgatggttgt 3901 tccacgcact gacaacatca ccttggcaat cctggctgct ctgacaccac tggcccgggg 3961 cacactgctt gtggcgtgga gagcaggcct tgctacttgc ggggggttca tgctcctctc 4021 tctgaaggga aaaggcagtg tgaagaagaa cttaccattt gtcatggccc tgggactaac 4081 cgctgtgagg ctagtcgacc ccatcaacgt ggtgggactg ctgttgctca caaggagtgg 4141 gaagcggagc tggcccccta gcgaagtact cacagctgtt ggcctgatat gcgcattggc 4201 tggagggttc gccaaggcag atatagagat ggctgggccc atggccgcgg ttggtctgct 4261 aattgtcagt tacgtggtct caggaaagag tgtggacatg tacattgaaa gagcaggtga 4321 catcacatgg gaaaaagatg cggaagtcac tggaaacagt ccccggctcg atgtggcact 4381 agatgagagt ggtgatttct ccctggtgga ggatgacggt ccccccatga gagagatcat 4441 acttaaagtg gtcctgatga ccatctgtgg catgaaccca atagccatac cctttgcagc 4501 tggagcgtgg tacgtatacg tgaagactgg aaaaaggagt ggtgctctat gggatgtgcc 4561 tgctcccaag gaagtaaaaa agggggagac cacagatgga gtgtacagag taatgactcg 4621 tagactgcta ggttcaacac aagttggagt gggagtcatg caagaggggg tctttcacac 4681 tatgtggcac gtcacaaaag gatccgcgct gagaagcggt gaagggagac ttgatccata 4741 ctggggagat gtcaagcagg atctggtgtc atactgtggt ccatggaagc tagatgccgc 4801 ctgggacggg cacagcgagg tgcagctctt ggccgtgccc cccggagaga gagcgaggaa 4861 catccagact ctgcccggaa tatttaagac aaaggatggg gacattggag cggttgcgct 4921 ggactaccca gcaggaactt caggatctcc aatcctagac aagtgtggga gagtgatagg 4981 actctatggc aatggggtcg tgatcaaaaa tgggagttat gttagtgcca tcacccaagg 5041 gaggagggag gaagagactc ctgttgagtg cttcgagcct tcgatgctga agaagaagca 5101 gctaactgtc ttagacttgc atcctggagc tgggaaaacc aggagagttc ttcctgaaat 5161 agtccgtgaa gccataaaag caagactccg tactgtgatc ttagctccaa ctagggttgt 5221 cgctgctgaa atggaggaag cccttagagg gcttccagtg cgttatatga caacagcagt 5281 caatgtcacc cactctggga cagaaatcgt tgacttaatg tgccatgcca ccttcacttc 5341 acgtctacta cagccaatca gagtccccaa ctataatctg tatattatgg atgaggccca 5401 cttcacagat ccctcaagta tagcagcaag aggatacatt tcaacaaggg ttgagatggg 5461 cgaggcggct gccatcttca tgaccgccac gccaccagga acccgtgacg catttccgga 5521 ctccaactca ccaattatgg acaccgaagt ggaagtcccg gagagagcct ggagctcagg 5581 ctttgattgg gtgacggacc attctggaaa aacagtttgg tttgttccaa gcgtgaggaa 5641 cggcaatgag atcgcagctt gtctgacgaa ggctggaaaa cgggtcatac agctcagcag 5701 aaagactttt gagacagagt tccagaaaac aaaacatcaa gagtgggact ttgtcgtgac 5761 aactgacatt tcagagatgg gcgccaactt taaagctgac cgtgtcatag attccaggag 5821 atgcctaaag ccggtcatac ttgatggcga gagagtcatt ctggctggac ccatgcctgt 5881 cacacatgcc agcgctgccc agaggagggg gcgcataggc aggaatccca acaaacctgg 5941 agatgagtat ctgtatggag gtgggtgcgc agagactgat gaagaccatg cacactggct 6001 tgaagcaaga atgctccttg acaatatcta cctccaagat ggcctcatag cctcgctcta 6061 tcgacctgag gccgacaaag tagcagccat tgagggagag ttcaagctta ggacggagca 6121 aaggaagacc tttgtggaac tcatgaaaag aggagatctt cctgtttggc tggcctatca 6181 ggttgcatct gccggaataa cctacacaga tagaagatgg tgctttgatg gcacgaccaa 6241 caacaccata atggaagaca gtgtgccggc agaggtgtgg accagatacg gagagaaaag 6301 agtgctcaaa ccgaggtgga tggacgccag agtctgttca gatcatgcgg ccctgaagtc 6361 attcaaggag tttgccgctg ggaaaagagg agcggctttt ggagtgatgg aagccctggg 6421 aacactgccg ggacacatga cagagagatt ccaggaagcc attgacaacc tcgctgtgct 6481 catgcgggca gagactggaa gcagacctta caaagccgcg gcggcccaat tgccggagac 6541 cctagagacc attatgcttt tggggttgct gggaacagtc tcgctgggaa tctttttcgt 6601 cttgatgcgg aacaagggca tagggaagat gggctttgga atggtgactc ttggggccag 6661 cgcatggctc atgtggctct cggaaattga gccagccaga attgcatgtg tcctcattgt 6721 tgtgttccta ttgctggtgg tgctcatacc tgagccagaa aagcaaagat ctccccagga 6781 caaccaaatg gcaatcatca tcatggtagc agtaggtctt ctgggcttga ttaccgccaa 6841 tgaactcgga tggttggaga gaacaaagag tgacctaagc catctaatgg gaaggagaga 6901 ggagggggca accataggat tctcaatgga cattgacctg cggccagcct cagcttgggc 6961 catctatgct gccctgacaa ctttcattac cccagccgtc caacatgcag tgaccacttc 7021 atacaacaac tactccttaa tggcgatggc cacgcaagct ggagtgttgt ttggtatggg 7081 caaagggatg ccattctacg catgggactt tggagtcccg ctgctaatga taggttgcta 7141 ctcacaatta acacccctga ccctaatagt ggccatcatt ttgctcgtgg cgcactacat 7201 gtacttgatc ccagggctgc aggcagcagc tgcgcgtgct gcccagaaga gaacggcagc 7261 tggcatcatg aagaaccctg ttgtggatgg aatagtggtg actgacattg acacaatgac 7321 aattgacccc caagtggaga aaaagatggg acaggtgcta ctcatagcag tagccgtctc 7381 cagcgccata ctgtcgcgga ccgcctgggg gtggggggag gctggggccc tgatcacagc 7441 tgcaacttcc actttgtggg aaggctctcc gaacaagtac tggaactcct ctacagccac 7501 ttcactgtgt aacattttta ggggaagtta cttggctgga gcttctctaa tctacacagt 7561 aacaagaaac gctggtttgg tcaagagacg tgggggtgga acaggagaga ccctgggaga 7621 gaaatggaag gcccgcttga accagatgtc ggccctggag ttctactcct acaaaaagtc 7681 aggcatcacc gaggtgtgca gagaagaggc ccgccgcgcc ctcaaggacg gtgtggcaac 7741 gggaggccat gctgtgtccc gaggaagtgc aaagctgaga tggttggtgg agcggggata 7801 cctgcagccc tatggaaagg tcattgatct tggatgtggc agagggggct ggagttacta 7861 cgccgccacc atccgcaaag ttcaagaagt gaaaggatac acaaaaggag gccctggtca 7921 tgaagaaccc atgttggtgc aaagctatgg gtggaacata gtccgtctta agagtggggt 7981 ggacgtcttt catatggcgg ctgagccgtg tgacacgttg ctgtgtgaca taggtgagtc 8041 atcatctagt cctgaagtgg aagaagcacg gacgctcaga gtcctctcca tggtggggga 8101 ttggcttgaa aaaagaccag gagccttttg tataaaagtg ttgtgcccat acaccagcac 8161 tatgatggaa accctggagc gactgcagcg taggtatggg ggaggactgg tcagagtgcc 8221 actctcccgc aactcaacac atgagatgta ctgggtctct ggagcgaaaa gcaacaccat 8281 aaaaagtgtg tccaccacga gccagctcct cttggggcgc atggacgggc ccaggaggcc 8341 agtgaaatat gaggaggatg tgaatctcgg ctctggcacg cgggctgtgg taagctgcgc 8401 tgaagctccc aacatgaaga tcattggtaa ccgcattgaa aggatccgca gtgagcacgc 8461 ggaaacgtgg ttctttgacg agaaccaccc atataggaca tgggcttacc atggaagcta 8521 tgaggccccc acacaagggt cagcgtcctc tctaataaac ggggttgtca ggctcctgtc 8581 aaaaccctgg gatgtggtga ctggagtcac aggaatagcc atgaccgaca ccacaccgta 8641 tggtcagcaa agagttttca aggaaaaagt ggacactagg gtgccagacc cccaagaagg 8701 cactcgtcag gttatgagca tggtctcttc ctggttgtgg aaagagctag gcaaacacaa 8761 acggccacga gtctgtacca aagaagagtt catcaacaag gttcgtagca atgcagcatt 8821 aggggcaata tttgaagagg aaaaagagtg gaagactgca gtggaagctg tgaacgatcc 8881 aaggttctgg gctctagtgg acaaggaaag agagcaccac ctgagaggag agtgccagag 8941 ctgtgtgtac aacatgatgg gaaaaagaga aaagaaacaa ggggaatttg gaaaggccaa 9001 gggcagccgc gccatctggt atatgtggct aggggctaga tttctagagt tcgaagccct 9061 tggattcttg aacgaggatc actggatggg gagagagaac tcaggaggtg gtgttgaagg 9121 gctgggatta caaagactcg gatatgtcct agaagagatg agtcgcatac caggaggaag 9181 gatgtatgca gatgacactg ctggctggga cacccgcatc agcaggtttg atctggagaa 9241 tgaagctcta atcaccaacc aaatggagaa agggcacagg gccttggcat tggccataat 9301 caagtacaca taccaaaaca aagtggtaaa ggtccttaga ccagctgaaa aagggaagac 9361 agtgatggac attatttcaa gacaagacca aagggggagc ggacaagttg tcacttacgc 9421 tctcaacaca tttaccaacc tagtggtgca actcattcgg aatatggagg ctgaggaagt 9481 tctagagatg caagacttgt ggctgctgcg gaggtcagag aaagtgacca actggttgca 9541 gagcaacgga tgggataggc tcaaacgaat ggcagtcagt ggagatgatt gcgttgtgaa 9601 gccaattgat gataggtttg cacatgccct caggttcttg aatgatatgg ggaaagttag 9661 gaaggacaca caagaatgga aaccctcaac tggatgggac aactgggaag aagttccgtt 9721 ttgctcccac catttcaaca agctccatct caaggacggg aggtccattg tggttccctg 9781 ccgccaccaa gatgaactga ttggccgggc ccgcgtctct ccaggggcgg gatggagcat 9841 ccgggagact gcttgcctag caaaatcata tgcgcagatg tggcagctcc tttatttcca 9901 cagaagggac ctccgactga tggccaatgc catttgttca tctgtgccag ttgactgggt 9961 tccaactggg agaactacct ggtcaatcca tggaaaggga gaatggatga ccactgaaga 10021 catgcttgtg gtgtggaaca gagtgtggat tgaggagaac gaccacatgg aagacaagac 10081 cccagttacg aaatggacag acattcccta tttgggaaaa agggaagact tatggtgtgg 10141 atctctcata gggcacagac cgcgcaccac ctgggctgag aacattaaaa acacagtcaa 10201 catggtgcgc agaatcatag gtgatgaaga aaagtacatg gactacctat ccacccaagt 10261 tcgctacttg ggtgaagaag ggtctacacc tggagtgctg taagcaccaa tcttagtgtt 10321 gtcaggcctg ctagtcagcc acagcttggg gaaagctgtg cagcctgtga cccccccagg 10381 agaagctggg aaaccaagcc catagtcagg ccgagaacgc catggcacgg aagaagccat 10441 gctgcctgtg agcccctcag aggacactga gtcaaaaaac cccacgcgct tggaggcgca 10501 ggatgggaaa agaaggtggc gacctt- New York City Zika Tally Page
Reported Cases of Zika in New York City as of 9/9/2016 [Español (PDF)] Positive NYC Residents Case Type Number of Cases Locally acquired mosquito-borne reported† 0 Travel-associated* 520 Sexually transmitted: 5 Guillain-Barre syndrome: 3 Infants with birth defects: 1 Laboratory acquired 0 Pending Verification of Travel 48 Total 568 Gender Number of Cases Female 401 Pregnant: 64 Male 167 Age Average Age (Range) 38 (1-78) Positive NYC Resident by Borough Number of Cases Bronx 200 Brooklyn 138 Manhattan 116 Queens 110 Staten Island 4 Unknown 0 Most Common Countries Visited Number of Cases Dominican Republic 280 Puerto Rico 50 Jamaica 49 Guyana 19 Trinidad and Tobago 18 Grenada 14 Saint Lucia 11 Colombia 10 Saint Vincent and the Grenadines 10 Barbados 8 Mexico 7 Honduras 6 Nicaragua 6 US Virgin Islands 6 †Presumed local mosquito-borne transmission *Travelers returning from affected areas, their sexual contacts, or infants infected in utero- Zika Miami Middle Beach Outbreak Merges With South Beach Florida
The zone of active transmission of Zika virus in Miami Beach has tripled to now encompass two thirds of the seaside city. Gov. Rick Scott announced the expansion late Friday evening in a news release. The zone now stretches from 8th Street to 63rd Street — a 4.5-square-mile zone covering all of South and Middle Beach. The Florida Department of Health has identified five people who all experienced symptoms within one month of each other — three of them in the newly expanded area, according to Miami-Dade Mayor Carlos Gimenez. Read more here: http://www.miamiherald.com/news/local/community/miami-dade/miami-beach/article102372102.html#storylink=cpy http://www.miamiherald.com/news/local/community/miami-dade/miami-beach/article102372102.html#0- Florida Local Zika Cases Increase To 89
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ- Florida Local Zika Cases Increase To 89
September 16, 2016 Department of Health Daily Zika Update No New Cases Today Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla. — In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are 10 new travel-related cases today including six in Miami-Dade, two in Lee and two in Orange. Please visit our website to see the full list of travel-related cases. There are two new non-travel related cases today associated with the Miami Beach investigation. DOH continues door-to-door outreach and targeted testing in Pinellas, Palm Beach and Miami-Dade counties and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the small identified areas in Wynwood and Miami Beach in Miami-Dade County, see maps below. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 660 Non-Travel Related Infections of Zika 79 Infections Involving Pregnant Women 86 Out of State Cases (not Florida Residents) 10 Total 835 The department is currently conducting 17 active investigations. The department has closed eight investigations. The department has combined two previously reported investigations with an existing investigation. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 7,192 people statewide. Florida currently has the capacity to test 5,022 people for active Zika virus and 8,452 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. Florida’s small case cluster is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted area in Miami-Dade County (see map below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 86. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 6,214 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. State of Florida Miami-Dade County About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health please visit www.FloridaHealth.gov.- Florida Zika Cases Increase To 835
September 16, 2016 Department of Health Daily Zika Update No New Cases Today Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla. — In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are 10 new travel-related cases today including six in Miami-Dade, two in Lee and two in Orange. Please visit our website to see the full list of travel-related cases. There are two new non-travel related cases today associated with the Miami Beach investigation. DOH continues door-to-door outreach and targeted testing in Pinellas, Palm Beach and Miami-Dade counties and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the small identified areas in Wynwood and Miami Beach in Miami-Dade County, see maps below. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 660 Non-Travel Related Infections of Zika 79 Infections Involving Pregnant Women 86 Out of State Cases (not Florida Residents) 10 Total 835 The department is currently conducting 17 active investigations. The department has closed eight investigations. The department has combined two previously reported investigations with an existing investigation. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 7,192 people statewide. Florida currently has the capacity to test 5,022 people for active Zika virus and 8,452 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. Florida’s small case cluster is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted area in Miami-Dade County (see map below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 86. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 6,214 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. State of Florida Miami-Dade County About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health please visit www.FloridaHealth.gov.- Local Zika Cases In Florida Increase To 93
GOV. SCOTT: DOH EXPANDS AREA OF LOCAL TRANSMISSION IN MIAMI BEACH; EXPECTS TO LIFT WYNWOOD ZONE MONDAY On September 16, 2016, in News Releases, by Staff TALLAHASSEE, Fla. – Tonight, Governor Rick Scott announced that the Florida Department of Health (DOH) has confirmed through its on-going investigation that local transmission of Zika is occurring in an expanded area of Miami Beach. DOH is expanding the area of local transmission in Miami Beach from 8th Street to 63rd Street. The total area where DOH believes active transmission of the Zika virus is occurring is around 4.5 square miles (see map below). DOH has identified five people, two males and three females, in the expanded area who all experienced symptoms within one month of each other. One of these cases has already been announced by DOH earlier this week and was under a normal investigation process. The investigations of the other four were completed today. All five individuals are non-travel related cases. Aggressive mosquito control efforts, including larviciding, have already taken place in this area and these efforts will continue by the Miami-Dade Mosquito Control District. The total number of non-travel related cases associated with this expanded impacted area on Miami Beach is 35 and the total number of non-travel related cases in Florida is 93 (this includes people who live outside of Florida and contracted Zika in our state). Governor Rick Scott said, “While we’ve learned that we’re expanding the impacted area in Miami Beach, the good news is that we expect to lift the zone in Wynwood on Monday because of our aggressive mosquito control measures, outreach to the community, education efforts and the vigilant actions of the residents and businesses in Wynwood. The expansion of the Miami Beach area where local transmission is occurring highlights the need for continued aggressive mosquito control measures and for Congress to immediately approve federal funding to combat Zika. I went to Washington this week to meet with Congressional leaders and urge them to immediately provide funding for this national crisis. Every minute that passes that Congress doesn’t approve funding means more time is lost from researching this virus to find a vaccine to help pregnant women and their developing babies. “Due to the inaction by Congress, I authorized an additional $10 million in state funds today to continue fighting Zika. I am also continuing to call on Congress to hold a field hearing in Miami on Zika preparedness and prevention by October 1. I know many members of Florida’s Congressional Delegation are fighting for Zika funding and it is critically important that members come to Miami and hear directly from those who are on the frontlines of batting this virus. “Following today’s news, I am asking the CDC to provide Florida with an additional epidemiologist to support DOH’s efforts to combat and contain Zika and host a call with community leaders and clinicians in Miami Beach to answer questions and provide the latest guidance on Zika. In August, I asked the CDC to send additional lab support to Florida and while they have provided some resources, we need much more. That is why earlier this week I asked the CDC for more lab support. Additionally, I am renewing my call to the Obama Administration to provide 10,000 Zika Prevention Kits to protect pregnant women and a detailed plan on how they would like us to work with FEMA now that Zika is mosquito-borne in our state. We have continued to call on the CDC to quickly respond to these requests, and pregnant women who are most at-risk for the Zika virus deserve to have these requests immediately fulfilled.” “Everything we are doing to combat this virus is to protect pregnant women. As a father and a grandfather, I cannot imagine the challenges a child would have being born with microcephaly. Everyone has to take precautions by dumping standing water and wearing bug spray so we can protect pregnant women and their growing babies. It is up to all of us to urgently work to combat Zika.” Following today’s news, the Governor made the following new requests to the CDC: Provide Florida with an additional epidemiologist to support DOH’s efforts to combat and contain Zika; and Host a call with community leaders and clinicians in Miami Beach to answer questions and provide the latest information and guidance on Zika. The Governor also renewed the following requests, which have yet to be fulfilled by the federal government: Additional lab support staff (Governor Scott requested September 14, 2016). 10,000 Zika Prevention Kits, which are essential to protecting pregnant women (Governor Scott requested August 19, 2016). A detailed plan from the Obama Administration on how they would like Florida to work with FEMA on how federal resources will be allocated to states now that this has become mosquito-borne in Florida. (Initially requested June 1; Requested again August 19, 2016). ###- Local Zika Cases In Florida Increase To 93
Tonight, Governor Rick Scott announced that the Florida Department of Health (DOH) has confirmed through its on-going investigation that local transmission of Zika is occurring in an expanded area of Miami Beach. DOH is expanding the area of local transmission in Miami Beach from 8th Street to 63rd Street. The total area where DOH believes active transmission of the Zika virus is occurring is around 4.5 square miles (see map below). DOH has identified five people, two males and three females, in the expanded area who all experienced symptoms within one month of each other. One of these cases has already been announced by DOH earlier this week and was under a normal investigation process. The investigations of the other four were completed today. All five individuals are non-travel related cases. http://www.flgov.com/2016/09/16/gov-scott-doh-expands-area-of-local-transmission-in-miami-beach-expects-to-lift-wynwood-zone-monday/- Florida Local Zika Cases Increase To 89
Infection Type Infection Count Travel-Related Infections of Zika 660 Non-Travel Related Infections of Zika 79 Infections Involving Pregnant Women 86 Out of State Cases (not Florida Residents) 10 Total 835 http://www.floridahealth.gov/newsroom/2016/09/091616-zika-update.html- Florida Zika Cases Increase To 835
Infection Type Infection Count Travel-Related Infections of Zika 660 Non-Travel Related Infections of Zika 79 Infections Involving Pregnant Women 86 Out of State Cases (not Florida Residents) 10 Total 835 http://www.floridahealth.gov/newsroom/2016/09/091616-zika-update.html- Zika Confirmed In Fifth Batch of Mosquitoes In Miami Beach Florida
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ- Zika Confirmed In Fifth Batch of Mosquitoes In Miami Beach Florida
SEPTEMBER 16, 2016 11:30 AM Fifth pool of Zika-positive mosquitoes found in South Beach Aedes aegypti mosquito BY JOEY FLECHAS [email protected] LINKEDIN GOOGLE+ PINTEREST REDDIT PRINT ORDER REPRINT OF THIS STORY A fifth batch of mosquitoes trapped in South Beach has tested positive for the Zika virus, the Miami Herald has learned. Sources with knowledge of the discovery, which is expected to be announced Friday afternoon by the Florida Department of Agriculture, confirmed that the fifth sample of Zika-positive mosquitoes came from from inside the 1.5-square-mile zone of active transmission in South Beach. The county has been monitoring 19 traps that are spread out through South Beach. Of the positive samples, only one location has been made public — the Miami Beach Botanical Gardens, which had to close for a week to be treated for mosquitoes. Earlier Friday, the Herald filed suit again Miami-Dade County to force the release of records indicating the locations of the other traps. South Beach has been embroiled in controversy since the county began aerial spraying to control the mosquito population.Protesters have filled City Hall twice to oppose the spraying of naled, a neurotoxin considered effective at killing the Aedes aegypti mosquito that can carry Zika. Officials say the low concentration of the insecticide does not pose a threat to people. The county will aerially spray naled on Miami Beach again at 6 a.m. Sunday morning. FACEBOOK TWITTER EMAIL SHARE Zika protest at Miami Beach City Hall against spraying A crowd gathered at Miami Beach City Hall to protest against the aerial spraying of the pesticide naled to combat the spread of the Zika virus on the island, Sept. 14, 2016. C.M. Guerrero Miami Herald Meanwhile, the fight against Zika is getting more expensive. Friday morning, Florida Gov. Rick Scott authorized another $10 million in state funds on Friday to fight the mosquito-borne illness. That brings the state’s total bill to $36.2 million, a news release said. Health officials first announced that mosquitoes were spreading the virus in the Wynwood neighborhood of Miami on July 29. Since then, Wynwood and the Miami Beach area have been labeled zones of active transmission, triggering an unprecedented travel advisory warning pregnant women to avoid going to those neighborhoods. The number of local cases continues to rise, with 87 confirmed as of Thursday — 77 Florida residents and 10 who live out of state but acquired the disease in Miami-Dade. But as Florida worries about Zika’s impact on public health and tourism, Congress has yet approve a funding package to bolster the state’s efforts to contain the virus. “Zika is non-partisan and I have been very clear that something had to get done this week,” Scott said in a news release, after he attended meetings in Washington this week urging lawmakers to act. “While it doesn’t look like that is going to happen, I will not wait on the federal government to protect Floridians and our visitors.” Scott’s office said the additional state money will be spent on mosquito control, increased lab capacity for testing and the purchase of Zika prevention kits from the Centers for Disease Control and Prevention. The virus continues to spread in South Florida. On Thursday, the Florida Department of Health confirmed seven more local cases in the region, with six in Miami-Dade and one in Palm Beach County. Read more here: http://www.miamiherald.com/news/health-care/article102202537.html#storylink=cpy- Zika Confirmed In Fifth Batch of Mosquitoes In Miami Beach Florida
A fifth batch of mosquitoes trapped in South Beach has tested positive for the Zika virus, the Miami Herald has learned. Sources with knowledge of the discovery, which is expected to be announced Friday afternoon by the Florida Department of Agriculture, confirmed that the fifth sample of Zika-positive mosquitoes came from from inside the 1.5-square-mile zone of active transmission in South Beach. Read more here: http://www.miamiherald.com/news/health-care/article102202537.html#storylink=cpy http://www.miamiherald.com/news/health-care/article102202537.html- 2016 Zika Linked Microcephaly In Brazil - Lancet ID
Interpretation Our data suggest that the microcephaly epidemic is a result of congenital Zika virus infection. We await further data from this ongoing study to assess other potential risk factors and to confirm the strength of association in a larger sample size.- 2016 Zika Linked Microcephaly In Brazil - Lancet ID
Findings Between Jan 15, 2016, and May 2, 2016, we prospectively recruited 32 cases and 62 controls. 24 (80%) of 30 mothers of cases had Zika virus infection compared with 39 (64%) of 61 mothers of controls (p=0·12). 13 (41%) of 32 cases and none of 62 controls had laboratory-confirmed Zika virus infection; crude overall OR 55·5 (95% CI 8·6–∞); OR 113·3 (95% CI 14·5–∞) for seven cases with brain abnormalities; and OR 24·7 (95% CI 2·9–∞) for four cases without brain abnormalities. - Likely Local Zika Transmission In June In Miami Beach Florida