niman

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

September 14, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are five new travel-related cases today including two in Broward, one in Miami-Dade, one in Hillsborough and one in Polk. Please visit our website to see the full list of travel-related cases. There is one new non-travel related case today associated with the Miami Beach investigation. DOH continues door-to-door outreach and targeted testing in Pinellas, Palm Beach and Miami-Dade counties and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the small identified areas in Wynwood and Miami Beach in Miami-Dade County, see maps below. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 639 Non-Travel Related Infections of Zika 71 Infections Involving Pregnant Women 86 Out of State Cases (not Florida Residents) 9 Total 805 The department is currently conducting 16 active investigations. The department has closed seven investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 7,000 people statewide. Florida currently has the capacity to test 5,176 people for active Zika virus and 8,612 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. Florida’s small case cluster is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted area in Miami-Dade County (see map below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 86. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 6,086 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. State of Florida Miami-Dade County About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.

September 14, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are five new travel-related cases today including two in Broward, one in Miami-Dade, one in Hillsborough and one in Polk. Please visit our website to see the full list of travel-related cases. There is one new non-travel related case today associated with the Miami Beach investigation. DOH continues door-to-door outreach and targeted testing in Pinellas, Palm Beach and Miami-Dade counties and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the small identified areas in Wynwood and Miami Beach in Miami-Dade County, see maps below. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 639 Non-Travel Related Infections of Zika 71 Infections Involving Pregnant Women 86 Out of State Cases (not Florida Residents) 9 Total 805 The department is currently conducting 16 active investigations. The department has closed seven investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 7,000 people statewide. Florida currently has the capacity to test 5,176 people for active Zika virus and 8,612 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. Florida’s small case cluster is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted area in Miami-Dade County (see map below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 86. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 6,086 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. State of Florida Miami-Dade County About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.

Infection Type Infection Count Travel-Related Infections of Zika 639 Non-Travel Related Infections of Zika 71 Infections Involving Pregnant Women 86 Out of State Cases (not Florida Residents) 9 Total 805

Infection Type Infection Count Travel-Related Infections of Zika 639 Non-Travel Related Infections of Zika 71 Infections Involving Pregnant Women 86 Out of State Cases (not Florida Residents) 9 Total 805

Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX813683.1| Zika virus isolate ZKA-16-097 polyprotein gene, complete cds 2727 2727 100% 0.0 100% KX813683.1 Select seq gb|KX447521.1| Zika virus isolate 1_0080_PF polyprotein gene, partial cds 2686 2686 100% 0.0 99% KX447521.1 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 2686 2686 100% 0.0 99% KX447509.1 Select seq gb|KX216635.1| Zika virus isolate TS17-2016 envelope protein gene, partial cds 2682 2682 100% 0.0 99% KX216635.1 Select seq gb|KX216634.1| Zika virus isolate TS14-2016 envelope protein gene, partial cds 2682 2682 100% 0.0 99% KX216634.1 Select seq gb|KX806557.1| Zika virus isolate TS17-2016, complete genome 2682 2682 100% 0.0 99% KX806557.1 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 2682 2682 100% 0.0 99% KJ776791.2 Select seq gb|KX447520.1| Zika virus isolate 1_0016_PF polyprotein gene, partial cds 2682 2682 100% 0.0 99% KX447520.1 Select seq gb|KX447519.1| Zika virus isolate 1_0199_PF polyprotein gene, partial cds 2682 2682 100% 0.0 99% KX447519.1 Select seq gb|KX447518.1| Zika virus isolate 1_0117_PF polyprotein gene, partial cds 2682 2682 100% 0.0 99% KX447518.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 2682 2682 100% 0.0 99% KX447516.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 2682 2682 100% 0.0 99% KX447515.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 2682 2682 100% 0.0 99% KX447513.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 2682 2682 100% 0.0 99% KX447512.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 2682 2682 100% 0.0 99% KX447510.1 Select seq gb|KX576684.1| Zika virus vector pZIKV-ICD, complete sequence 2682 2682 100% 0.0 99% KX576684.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 2682 2682 100% 0.0 99% KX369547.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 2682 2682 100% 0.0 99% KX446950.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 2682 2682 100% 0.0 99% KX280026.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 2682 2682 100% 0.0 99% KX262887.1 Select seq gb|KX380262.1| Zika virus isolate MS10-2016 envelope protein gene, partial cds 2677 2677 100% 0.0 99% KX380262.1 Select seq gb|KX216638.1| Zika virus isolate ESS23-2015 envelope protein gene, partial cds 2677 2677 100% 0.0 99% KX216638.1 Select seq gb|KX216637.1| Zika virus isolate GS29-2016 envelope protein gene, partial cds 2677 2677 100% 0.0 99% KX216637.1 Select seq gb|KX216632.1| Zika virus isolate SIS58-2015 envelope protein gene, partial cds 2677 2677 100% 0.0 99% KX216632.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 2677 2677 100% 0.0 99% KX694534.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 2677 2677 100% 0.0 99% KX447514.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 2677 2677 100% 0.0 99% KX447511.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 2677 2677 100% 0.0 99% KX446951.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 2677 2677 100% 0.0 99% KX247632.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 2677 2677 100% 0.0 99% KX051563.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 2677 2677 100% 0.0 99% KU509998.3 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 2677 2677 100% 0.0 99% KU991811.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 2677 2677 100% 0.0 99% KU926309.1 Select seq gb|KU646828.1| Zika virus isolate Si322 polyprotein gene, partial cds 2677 2677 100% 0.0 99% KU646828.1 Select seq gb|KX380263.1| Zika virus isolate FS92-2016 envelope protein gene, partial cds 2673 2673 100% 0.0 99% KX380263.1 Select seq gb|KX216640.1| Zika virus isolate CKS63-2014 envelope protein gene, partial cds 2673 2673 100% 0.0 99% KX216640.1 Select seq gb|KX216636.1| Zika virus isolate SS27-2016 envelope protein gene, partial cds 2673 2673 100% 0.0 99% KX216636.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 2673 2673 100% 0.0 99% KX197205.1 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 2673 2673 100% 0.0 99% KX266255.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 2673 2673 100% 0.0 99% KU866423.2 Select seq gb|KU758871.1| Zika virus isolate 17170 polyprotein gene, partial cds 2673 2673 100% 0.0 99% KU758871.1 Select seq gb|KU758870.1| Zika virus isolate 17160 polyprotein gene, partial cds 2673 2673 100% 0.0 99% KU758870.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 2673 2673 100% 0.0 99% KX253996.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 2673 2673 100% 0.0 99% KX247646.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 2673 2673 100% 0.0 99% KX198135.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 2673 2673 100% 0.0 99% KX197192.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 2673 2673 100% 0.0 99% KX185891.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 2673 2673 100% 0.0 99% KX156776.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 2673 2673 100% 0.0 99% KX156775.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 2673 2673 100% 0.0 99% KX156774.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 2673 2673 100% 0.0 99% KX117076.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 2673 2673 100% 0.0 99% KU963796.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 2673 2673 100% 0.0 99% KU955589.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 2673 2673 100% 0.0 99% KU870645.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 2673 2673 100% 0.0 99% KU922960.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 2673 2673 100% 0.0 99% KU922923.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 2673 2673 100% 0.0 99% KU820899.2 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 2673 2673 100% 0.0 99% KU729218.1 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 2673 2673 100% 0.0 99% KU527068.1 Select seq gb|KU646827.1| Zika virus isolate Si323 polyprotein gene, partial cds 2673 2673 100% 0.0 99% KU646827.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 2673 2673 100% 0.0 99% KU647676.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 2673 2673 100% 0.0 99% KU321639.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 2670 2670 100% 0.0 99% KX766028.1 Select seq gb|KX216633.1| Zika virus isolate VS51-2016 envelope protein gene, partial cds 2668 2668 100% 0.0 99% KX216633.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 2668 2668 100% 0.0 99% KU820897.5 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 2668 2668 100% 0.0 99% KX766029.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 2668 2668 100% 0.0 99% KX447517.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 2668 2668 100% 0.0 99% KX520666.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 2668 2668 100% 0.0 99% KU758877.1 Select seq gb|KU758873.1| Zika virus isolate 18246 polyprotein gene, partial cds 2668 2668 100% 0.0 99% KU758873.1 Select seq gb|KU758869.1| Zika virus isolate 05211 polyprotein gene, partial cds 2668 2668 100% 0.0 99% KU758869.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 2668 2668 100% 0.0 99% KU937936.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 2668 2668 100% 0.0 99% KX087102.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 2668 2668 100% 0.0 99% KU940228.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 2668 2668 100% 0.0 99% KU497555.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 2668 2668 100% 0.0 99% KU501217.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 2668 2668 100% 0.0 99% KU501216.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 2668 2668 100% 0.0 99% KU365778.1 Select seq gb|KU312315.1| Zika virus isolate Z1106027 polyprotein gene, partial cds 2668 2668 100% 0.0 99% KU312315.1 Select seq gb|KU312314.1| Zika virus isolate Z1106031 polyprotein gene, partial cds 2668 2668 100% 0.0 99% KU312314.1 Select seq gb|KJ634273.1| Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds 2668 2668 100% 0.0 99% KJ634273.1 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 2664 2664 100% 0.0 99% KX702400.1 Select seq dbj|LC171327.1| Zika virus gene for polyprotein, partial cds, strain: ZIKV/Hu/Chiba/S36/2016 2664 2664 100% 0.0 99% LC171327.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 2664 2664 100% 0.0 99% KX548902.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 2664 2664 100% 0.0 99% KX377337.1 Select seq gb|KU758874.1| Zika virus isolate 20114 polyprotein gene, partial cds 2664 2664 100% 0.0 99% KU758874.1 Select seq gb|KU758868.1| Zika virus isolate 27229 polyprotein gene, partial cds 2664 2664 100% 0.0 99% KU758868.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 2664 2664 100% 0.0 99% KU926310.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 2664 2664 100% 0.0 99% KU820898.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 2664 2664 100% 0.0 99% KU740184.2 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 2664 2664 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 2664 2664 100% 0.0 99% KU853012.1 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 2664 2664 100% 0.0 99% KU761564.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 2664 2664 100% 0.0 99% KU707826.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 2664 2664 100% 0.0 99% KU501215.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 2664 2664 100% 0.0 99% KU365780.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 2664 2664 100% 0.0 99% KU365779.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 2664 2664 100% 0.0 99% KU365777.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 2659 2659 100% 0.0 99% KX673530.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 2659 2659 100% 0.0 99% KX601168.1

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

County Cases Angelina 1 Bell 6 Bexar 11 Brazos 3 Burnet 1 Collin 5 Dallas 35 Denton 6 El Paso 3 Ellis 1 Fort Bend 7 Frio 1 Galveston 6 Gray 1 Grayson 1 Gregg 1 Hamilton 1 Harris 56 Jefferson 2 Lee 1 Lubbock 1 Matagorda 1 Medina 1 Midland 1 Montgomery 1 Palo Pinto 1 Randall 1 Tarrant 21 Travis 5 Upshur 1 Val Verde 1 Walker 1 Williamson 5 Wise 1 Total 191 Dallas Pregnant Registry 18 Texas Preg Reg excl Dallas 28 Total 237

Zika Virus – September 14, 2016. Texas has had 191 reported cases of Zika virus disease. All the cases were associated with travel to an area where Zika is being spread. This count includes 11 pregnant women, two infants infected before birth, and two people who had sexual contact with travelers. Texas Zika Cases by County: County Cases Angelina 1 Bell 6 Bexar 11 Brazos 3 Burnet 1 Collin 5 Dallas 35 Denton 6 El Paso 3 Ellis 1 Fort Bend 7 Frio 1 Gray 1 Galveston 6 Grayson 1 Gregg 1 Hamilton 1 Harris 56 Jefferson 2 Lee 1 Lubbock 1 Matagorda 1 Medina 1 Midland 1 Montgomery 1 Palo Pinto 1 Randall 1 Tarrant 21 Travis 5 Upshur 1 Val Verde 1 Walker 1 Williamson 5 Wise 1 Total 191

Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX813683.1| Zika virus isolate ZKA-16-097 polyprotein gene, complete cds 18886 18886 100% 0.0 100% KX813683.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 18515 18515 100% 0.0 99% KX447512.1 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 18510 18510 100% 0.0 99% KX447509.1 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 18504 18504 100% 0.0 99% KJ776791.2 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 18504 18504 100% 0.0 99% KX369547.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 18499 18499 100% 0.0 99% KX447515.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 18493 18493 100% 0.0 99% KX447514.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 18493 18493 100% 0.0 99% KX447513.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 18487 18487 100% 0.0 99% KX447516.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 18487 18487 100% 0.0 99% KX447511.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 18487 18487 100% 0.0 99% KX447510.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 18460 18460 100% 0.0 99% KX447517.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 18449 18449 100% 0.0 99% KU509998.3 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 18443 18443 100% 0.0 99% KU991811.1 Select seq gb|KX806557.1| Zika virus isolate TS17-2016, complete genome 18438 18438 100% 0.0 99% KX806557.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 18438 18438 100% 0.0 99% KX280026.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 18426 18426 100% 0.0 99% KX051563.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 18421 18421 100% 0.0 99% KX197205.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 18421 18421 100% 0.0 99% KU321639.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 18415 18415 100% 0.0 99% KX198135.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 18415 18415 100% 0.0 99% KU729218.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 18410 18410 100% 0.0 99% KU707826.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 18410 18410 100% 0.0 99% KU365779.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 18404 18404 100% 0.0 99% KX262887.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 18404 18404 100% 0.0 99% KX247646.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 18404 18404 100% 0.0 99% KX197192.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 18404 18404 100% 0.0 99% KU926309.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 18399 18399 100% 0.0 99% KX185891.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 18399 18399 100% 0.0 99% KX117076.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 18399 18399 100% 0.0 99% KU963796.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 18399 18399 100% 0.0 99% KU647676.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 18393 18393 100% 0.0 99% KU820897.5 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 18393 18393 100% 0.0 99% KX694534.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 18393 18393 100% 0.0 99% KU758877.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 18393 18393 100% 0.0 99% KX253996.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 18393 18393 100% 0.0 99% KX156776.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 18393 18393 100% 0.0 99% KX087102.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 18393 18393 100% 0.0 99% KU955589.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 18393 18393 100% 0.0 99% KU820899.2 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 18393 18393 100% 0.0 99% KU501217.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 18393 18393 100% 0.0 99% KU365780.1 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 18390 18390 100% 0.0 99% KX266255.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 18390 18390 99% 0.0 99% KU497555.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 18388 18388 100% 0.0 99% KU866423.2 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 18388 18388 100% 0.0 99% KX156774.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 18388 18388 100% 0.0 99% KU940228.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 18388 18388 100% 0.0 99% KU501216.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 18388 18388 100% 0.0 99% KU365777.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 18382 18382 100% 0.0 99% KX156775.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 18382 18382 100% 0.0 99% KU926310.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 18382 18382 100% 0.0 99% KU365778.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 18377 18377 100% 0.0 99% KU922960.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 18377 18377 100% 0.0 99% KU729217.2 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 18377 18377 100% 0.0 99% KU527068.1 Select seq gb|KU940224.1| Zika virus isolate Bahia09, partial genome 18373 18373 99% 0.0 99% KU940224.1 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 18371 18371 100% 0.0 99% KX702400.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 18371 18371 100% 0.0 99% KX548902.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 18371 18371 100% 0.0 99% KX247632.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 18371 18371 100% 0.0 99% KU922923.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 18371 18371 100% 0.0 99% KU501215.1 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 18371 18371 100% 0.0 99% KU312312.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 18366 18366 100% 0.0 99% KX601168.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 18366 18366 100% 0.0 99% KX520666.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 18366 18366 100% 0.0 99% KX446950.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 18366 18366 100% 0.0 99% KX087101.2 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 18360 18360 100% 0.0 99% KX446951.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 18360 18360 100% 0.0 99% KX377337.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 18360 18360 100% 0.0 99% KU937936.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 18354 18354 100% 0.0 99% KU870645.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 18351 18351 100% 0.0 99% KX766028.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 18349 18349 100% 0.0 99% KU820898.1 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 18349 18349 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 18347 18347 100% 0.0 99% KU853012.1 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 18343 18343 100% 0.0 99% KX056898.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 18343 18343 100% 0.0 99% KU955590.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 18338 18338 100% 0.0 99% KU740184.2 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 18338 18338 100% 0.0 99% KU761564.1 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 18327 18327 100% 0.0 99% KX766029.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 18321 18321 100% 0.0 99% KX673530.1 Select seq gb|KU681081.3| Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome 18310 18310 100% 0.0 99% KU681081.3 Select seq gb|KX694532.1| Zika virus strain ZIKV/Homo sapiens/THA/PLCal_ZV/2013, complete genome 18161 18161 100% 0.0 99% KX694532.1 Select seq gb|KU744693.1| Zika virus isolate VE_Ganxian, complete genome 18161 18161 100% 0.0 99% KU744693.1 Select seq gb|KF993678.1| Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds 18007 18007 99% 0.0 99% KF993678.1 Select seq gb|JN860885.1| Zika virus isolate FSS13025 polyprotein gene, partial cds 17969 17969 99% 0.0 98% JN860885.1 Select seq gb|KU955593.1| Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome 17967 17967 100% 0.0 98% KU955593.1 Select seq gb|EU545988.1| Zika virus polyprotein gene, complete cds 17810 17810 100% 0.0 98% EU545988.1 Select seq gb|KU681082.3| Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome 17573 17573 100% 0.0 98% KU681082.3 Select seq gb|KX601167.1| Zika virus strain ZIKV/Aedes sp./MYS/P6-740/1966, complete genome 16360 16360 99% 0.0 96% KX601167.1 Select seq gb|HQ234499.1| Zika virus isolate P6-740 polyprotein gene, partial cds 16355 16355 99% 0.0 96% HQ234499.1 Select seq gb|KX694533.1| Zika virus strain ZIKV/Aedes aegypti/MYS/P6-740/1966, complete genome 16349 16349 99% 0.0 96% KX694533.1 Select seq gb|KX377336.1| Zika virus strain P6-740, complete genome 16343 16343 99% 0.0 96% KX377336.1 Select seq gb|KX447518.1| Zika virus isolate 1_0117_PF polyprotein gene, partial cds 16303 16303 88% 0.0 99% KX447518.1

LOCUS KX813683 10484 bp ss-RNA linear VRL 11-SEP-2016 DEFINITION Zika virus isolate ZKA-16-097 polyprotein gene, complete cds. ACCESSION KX813683 VERSION KX813683.1 GI:1062047413 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10484) AUTHORS Ng,Y., Mak,T., Phuah,S., Cui,L., Maurer-Stroh,S. and Lin,R.T.P. TITLE Genome sequences of local transmitted Zika viruses in Singapore in 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10484) AUTHORS Ng,Y., Mak,T., Phuah,S., Cui,L., Maurer-Stroh,S. and Lin,R.T.P. TITLE Direct Submission JOURNAL Submitted (03-SEP-2016) National Public Health Laboratory, Communicable Disease Division, Ministry of Health, 11 Jln Tan Tock Seng, Singapore 308433, Singapore COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10484 /organism="Zika virus" /mol_type="genomic RNA" /isolate="ZKA-16-097" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="Singapore" /collection_date="27-Aug-2016" CDS 30..10301 /codon_start=1 /product="polyprotein" /protein_id="AOL02459.1" /db_xref="GI:1062047414" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAAHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRYGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPMLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKRKKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 tttggatttg gaaacgagag tttctggtca tgaaaaaccc aaaaaagaaa tccggaggat 61 tccggattgt caatatgcta aaacgcggag tagcccgtgt gagccccttt gggggcttga 121 agaggctgcc agccggactt ctgctgggtc atgggcccat caggatggtc ttggcgattc 181 tagccttttt gaggttcacg gcaatcaagc catcactggg tctcatcaat agatggggtt 241 cagtggggaa aaaagaggct atggaaataa taaagaagtt caagaaagat ctggctgcca 301 tgctgagaat aatcaatgct aggaaggaga agaagagacg aggcgcagat actagtgtcg 361 gaattgttgg cctcctgctg accacagcta tggcagcgga ggtcactaga cgtgggagtg 421 catactatat gtacttggac agaagcgatg ctggggaggc catatctttt ccaaccacac 481 tggggatgaa taagtgttat atacagatca tggatcttgg acacatgtgt gatgccacca 541 tgagctatga atgccctatg ctggatgagg gggtagaacc agatgacgtc gattgttggt 601 gcaacacgac gtcaacttgg gttgtgtacg gaacctgcca tcacaaaaaa ggtgaagcac 661 ggagatctag aagagctgtg acgctcccct cccattccac taggaagctg caaacgcggt 721 cgcagacctg gttggagtca agagaataca caaagcactt gattagagtc gaaaattgga 781 tattcaggaa ccctggcttc gcgttagcag cagctgccat cgcttggctt ttgggaagct 841 caacgagcca aaaagtcata tacttggtca tgatactgct gattgccccg gcatacagca 901 tcaggtgcat aggagtcagc aatagggact ttgtggaagg tatgtcaggt gggacttggg 961 ttgatgttgt cttggaacat ggaggttgtg tcaccgtaat ggcacaggac aaaccgactg 1021 tcgacataga gctggttaca acaacagtca gcaacatggc ggaggtaaga tcctactgct 1081 atgaggcatc aatatcggac atggcttcgg acagccgctg cccaacacaa ggtgaagcct 1141 accttgacaa gcaatcagat acccaatatg tctgcaaaag aacgttagtg gacagaggct 1201 ggggaaatgg atgtggactt tttggaaaag ggagcctggt gacatgcgct aagtttgcat 1261 gctccaagaa aatgaccggg aagagcatcc agccagagaa tctggagtac cggataatgc 1321 tgtcagtcca tggctcccag cacagtggga tgatcgttaa tgacacagga catgaaactg 1381 atgagaatag agcgaaggtt gagataacgc ccaattcacc aagagccgaa gccaccctgg 1441 ggggttttgg aagcctagga cttgattgtg aaccgaggac aggccttgac ttttcagatt 1501 tgtattactt gactatgaat aacaagcact ggttggttca caaggagtgg ttccacgaca 1561 ttccattacc ttggcacgct ggggcagaca ccggaactcc acactggaac aacaaagaag 1621 cactggtaga gttcaaggac gcacatgcca aaaggcaaac tgtcgtggtt ctagggagtc 1681 aagaaggagc agttcacacg gcccttgctg gagctctgga ggctgagatg gatggtgcaa 1741 agggaaggct gtcctctggc cacttgaaat gtcgcctgaa aatggacaaa cttagattga 1801 agggcgtgtc atactccttg tgtaccgcag cgttcacatt caccaagatc ccggctgaaa 1861 cactgcacgg gacagtcaca gtggaggtac agtacgcagg gacagatgga ccctgcaagg 1921 ttccagctca gatggcggtg gacatgcaaa ctctgacccc agttgggagg ttgataaccg 1981 ctaaccccgt aatcactgaa agcactgaga actctaagat gatgctggaa cttgatccac 2041 catttgggga ctcttacatt gtcataggag tcggggagaa gaagatcacc caccactggc 2101 acaggagtgg cagtaccatt ggaaaagcat ttgaagccac tgtgagaggt gccaagagaa 2161 tggcagtctt gggagacaca gcttgggact ttggatcagt tggaggcgct ctcaactcat 2221 tgggcaaggg catccatcaa atttttggag cagctttcaa atcattgttt ggaggaatgt 2281 cctggttctc acaaattctc attggaacgt tgctgatgtg gttgggcctg aacacaaaga 2341 atggatctat ttcccttatg tgcttggcct tagggggagt gttgatcttc ttatccacag 2401 ccgtctctgc tgatgtgggg tgctcggtgg acttctcaaa gaaggaaacg agatgcggta 2461 caggggtgtt cgtctataac gacgttgaag cctggaggga caggtacaag taccatcctg 2521 actccccccg tagattggca gcagcagtca agcaagcctg ggaagatggt atctgtggga 2581 tctcctctgt ttcaagaatg gaaaacatca tgtggagatc agtagaaggg gagctcaacg 2641 caatcctgga agaaaatgga gttcaactga cggtcgttgt gggatctgta aaaaacccca 2701 tgtggagagg tccacagaga ctgcccgtgc ctgtgaacga gctgccccac ggctggaagg 2761 cttgggggaa atcgtacttc gtcagagcag caaagacaaa taacagcttt gtcgtggatg 2821 gtgacacact gaaggaatgc ccactcaaac atagagcatg gaacagcttt cttgtggagg 2881 atcatgggtt cggggtattt cacactagtg tctggctcaa ggttagagaa gattattcat 2941 tagagtgtga tcctgccgtt attggaacag ctgttaaggg aaaggaggct gcacacagtg 3001 atctaggcta ctggattgag agtgagaaga atgacacatg gaggctgaag agggcccacc 3061 tgatcgagat gaaaacatgt gaatggccaa agtcccacac attgtggaca gatggaatag 3121 aagagagtga tctgatcata cccaagtctt tagctgggcc actcagccat cacaacacca 3181 gagagggcta caggacccaa atgaaagggc catggcacag tgaagagctt gaaattcggt 3241 ttgaggaatg cccaggcact aaggtccacg tggaggaaac atgtggaaca agaggaccgt 3301 ctctgagatc aaccactgca agcggaaggg tgatcgagga atggtgctgc agggagtgca 3361 caatgccccc actgtcgttc cgggctaaag atggctgttg gtatggaatg gagataaggc 3421 ccaggaaaga accagaaagt aacttagtaa ggtcaatggt gactgcagga tcaactgatc 3481 acatggatca cttctccctt ggagtgcttg tgattctgct catggtgcag gaagggctga 3541 agaagagaat gaccacaaag atcatcataa gcacatcaat ggcagtgctg gtagctatga 3601 tcctgggagg attttcaatg agtgacctgg ctaagcttgc aattttgatg ggtgccacct 3661 tcgcggaaat gaacactgga ggagatgtag ctcatctggc gctgatagcg gcattcaaag 3721 tcagaccagc gttgctggta tctttcatct tcagagctaa ttggacaccc cgtgaaagca 3781 tgctgctggc cttggcctcg tgtcttttgc aaactgcgat ttccgccttg gaaggcgacc 3841 tgatggttct catcaatggt tttgctctgg cctggttggc aatacgagcg atggttgttc 3901 cacgcactga caacatcacc ttggcaatcc tggctgctct gacaccactg gcccggggca 3961 cactgcttgt ggcgtggaga gcaggccttg ctacttgcgg ggggttcatg ctcctctctc 4021 tgaagggaaa aggcagtgtg aagaagaact taccatttgt catggccctg ggactaaccg 4081 ctgtgaggct agtcgacccc atcaacgtgg tgggactgct gttgctcaca aggagtggga 4141 agcggagctg gccccctagc gaagtactca cagctgttgg cctgatatgc gcattggctg 4201 gagggttcgc caaggcagat atagagatgg ctgggcccat ggccgcggtt ggtctgctaa 4261 ttgtcagtta cgtggtctca ggaaagagtg tggacatgta cattgaaaga gcaggtgaca 4321 tcacatggga aaaagatgcg gaagtcactg gaaacagtcc ccggctcgat gtggcactag 4381 atgagagtgg tgatttctcc ctggtggagg atgacggtcc ccccatgaga gagatcatac 4441 ttaaagtggt cctgatgacc atctgtggca tgaacccaat agccataccc tttgcagctg 4501 gagcgtggta cgtatacgtg aagactggaa aaaggagtgg tgctctatgg gatgtgcctg 4561 ctcccaagga agtaaaaaag ggggagacca cagatggagt gtacagagta atgactcgta 4621 gactgctagg ttcaacacaa gttggagtgg gagtcatgca agagggggtc tttcacacta 4681 tgtggcacgt cacaaaagga tccgcgctga gaagcggtga agggagactt gatccatact 4741 ggggagatgt caagcaggat ctggtgtcat actgtggtcc atggaagcta gatgccgcct 4801 gggacgggca cagcgaggtg cagctcttgg ccgtgccccc cggagagaga gcgaggaaca 4861 tccagactct gcccggaata tttaagacaa aggatgggga cattggagcg gttgcgctgg 4921 actacccagc aggaacttca ggatctccaa tcctagacaa gtgtgggaga gtgataggac 4981 tctatggcaa tggggtcgtg atcaaaaatg ggagttatgt tagtgccatc acccaaggga 5041 ggagggagga agagactcct gttgagtgct tcgagccttc gatgctgaag aagaagcagc 5101 taactgtctt agacttgcat cctggagctg ggaaaaccag gagagttctt cctgaaatag 5161 tccgtgaagc cataaaaaca agactccgta ctgtgatctt agctccaact agggttgtcg 5221 ctgctgaaat ggaggaagcc cttagagggc ttccagtgcg ttatatgaca acagcagtca 5281 atgtcaccca ctctgggaca gaaatcgttg acttaatgtg ccatgccacc ttcacttcac 5341 gtctactaca gccaatcaga gtccccaact ataatctgta tattatggat gaggcccact 5401 tcacagatcc ctcaagtata gcagcaagag gatacatttc aacaagggtt gagatgggcg 5461 aggcggctgc catcttcatg accgccacgc caccaggaac ccgtgacgca tttccggact 5521 ccaactcacc aattatggac accgaagtgg aagtcccgga gagagcctgg agctcaggct 5581 ttgattgggt gacggaccat tctggaaaga cagtttggtt tgttccaagc gtgaggaatg 5641 gcaatgagat cgcagcttgt ctgacgaagg ctggaaaacg ggtcatacag ctcagcagaa 5701 agacttttga gacagagttc cagaaaacaa aacatcaaga gtgggacttt gtcgtgacaa 5761 ctgacatttc agagatgggc gccaacttta aagctgaccg tgtcatagat tccaggagat 5821 gcctaaagcc ggtcatactt gatggcgaga gagtcattct ggctggaccc atgcctgtca 5881 cacatgccag cgctgcccag aggagggggc gcataggcag gaatcccaac aaacctggag 5941 atgagtatct gtatggaggt gggtgcgcag agactgatga agaccatgca cactggcttg 6001 aagcaagaat gctccttgac aatatctacc tccaagatgg cctcatagcc tcgctctatc 6061 gacctgaggc cgacaaagta gcagccattg agggagagtt caagcttagg acggagcaaa 6121 ggaagacctt tgtggaactc atgaaaagag gagatcttcc tgtttggctg gcctatcagg 6181 ttgcatctgc cggaataacc tacacagata gaagatggtg ctttgatggc acgaccaaca 6241 acaccataat ggaagacagt gtgccggcag aggtgtggac cagatacgga gagaaaagag 6301 tgctcaaacc gaggtggatg gacgccagag tctgttcaga tcatgcggcc ctgaagtcat 6361 tcaaggagtt tgccgctggg aaaagaggag cggcttttgg agtgatggaa gccctgggaa 6421 cactgccggg acacatgaca gagagattcc aggaagccat tgacaacctc gctgtgctca 6481 tgcgggcaga gactggaagc agaccttaca aagccgcggc ggcccaattg ccggagaccc 6541 tagagaccat tatgcttttg gggttgctgg gaacagtctc gctgggaatc tttttcgtct 6601 tgatgcggaa caagggcata gggaagatgg gctttggaat ggtgactctt ggggccagcg 6661 catggctcat gtggctctcg gaaattgagc cagccagaat tgcatgtgtc ctcattgttg 6721 tgttcctatt gctggtggtg ctcatacctg agccagaaaa gcaaagatct ccccaggaca 6781 accaaatggc aatcatcatc atggtagcag taggtcttct gggcttgatt accgccaatg 6841 aactcggatg gttggagaga acaaagagtg acctaagcca tctaatggga aggagagagg 6901 agggggcaac cataggattc tcaatggaca ttgacctgcg gccagcctca gcttgggcca 6961 tctatgctgc cctgacaact ttcattaccc cagccgtcca acatgcagtg accacttcat 7021 acaacaacta ctccttaatg gcgatggcca cgcaagctgg agtgttgttt ggtatgggca 7081 aagggatgcc attctacgca tgggactttg gagtcccgct gctaatgata ggttgctact 7141 cacaattaac acccctgacc ctaatagtgg ccatcatttt gctcgtggcg cactacatgt 7201 acttgatccc agggctgcag gcagcagctg cgcgtgctgc ccagaagaga acggcagctg 7261 gcatcatgaa gaaccctgtt gtggatggaa tagtggtgac tgacattgac acaatgacaa 7321 ttgaccccca agtggagaaa aagatgggac aggtgctact catagcagta gccgtctcca 7381 gcgccatact gtcgcggacc gcctgggggt ggggggaggc tggggccctg atcacagctg 7441 caacttccac tttgtgggaa ggctctccga acaagtactg gaactcctct acagccactt 7501 cactgtgtaa catttttagg ggaagttact tggctggagc ttctctaatc tacacagtaa 7561 caagaaacgc tggtttggtc aagagacgtg ggggtggaac aggagagacc ctgggagaga 7621 aatggaaggc ccgcttgaac cagatgtcgg ccctggagtt ctactcctac aaaaagtcag 7681 gcatcaccga ggtgtgcaga gaagaggccc gccgcgccct caaggacggt gtggcaacgg 7741 gaggccatgc tgtgtcccga ggaagtgcaa agctgagatg gttggtggag cggggatacc 7801 tgcagcccta tggaaaggtc attgatcttg gatgtggcag agggggctgg agttactacg 7861 ccgccaccat ccgcaaagtt caagaagtga aaggatacac aaaaggaggc cctggtcatg 7921 aagaacccat gttggtgcaa agctatgggt ggaacatagt ccgtcttaag agtggggtgg 7981 acgtctttca tatggcggct gagccgtgtg acacgttgct gtgtgacata ggtgagtcat 8041 catctagtcc tgaagtggaa gaagcacgga cgctcagagt cctctccatg gtgggggatt 8101 ggcttgaaaa aagaccagga gccttttgta taaaagtgtt gtgcccatac accagcacta 8161 tgatggaaac cctggagcga ctgcagcgta ggtatggggg aggactggtc agagtgccac 8221 tctcccgcaa ctcaacacat gagatgtact gggtctctgg agcgaaaagc aacaccataa 8281 aaagtgtgtc caccacgagc cagctcctct tggggcgcat ggacgggccc aggaggccag 8341 tgaaatatga ggaggatgtg aatctcggct ctggcacgcg ggctgtggta agctgcgctg 8401 aagctcccaa catgaagatc attggtaacc gcattgaaag gatccgcagt gagcacgcgg 8461 aaacgtggtt ctttgacgag aaccacccat ataggacatg ggcttaccat ggaagctatg 8521 aggcccccac acaagggtca gcgtcctctc taataaacgg ggttgtcagg ctcctgtcaa 8581 aaccctggga tgtggtgact ggagtcacag gaatagccat gaccgacacc acaccgtatg 8641 gtcagcaaag agttttcaag gaaaaagtgg acactagggt gccagacccc caagaaggca 8701 ctcgtcaggt tatgagcatg gtctcttcct ggttgtggaa agagctaggc aaacacaaac 8761 ggccacgagt ctgtaccaaa gaagagttca tcaacaaggt tcgtagcaat gcagcattag 8821 gggcaatatt tgaagaggaa aaagagtgga agactgcagt ggaagctgtg aacgatccaa 8881 ggttctgggc tctagtggac aaggaaagag agcaccacct gagaggagag tgccagagct 8941 gtgtgtacaa catgatggga aaaagaaaaa agaaacaggg ggaatttgga aaggccaagg 9001 gcagccgcgc catctggtat atgtggctag gggctagatt tctagagttc gaagcccttg 9061 gattcttgaa cgaggatcac tggatgggga gagagaactc aggaggtggt gttgaagggc 9121 tgggattaca aagactcgga tatgtcctag aagagatgag tcgcatacca ggaggaagga 9181 tgtatgcaga tgacactgct ggctgggaca cccgcatcag caggtttgat ctggagaatg 9241 aagctctaat caccaaccaa atggagaaag ggcacagggc cttggcattg gccataatca 9301 agtacacata ccaaaacaaa gtggtaaagg tccttagacc agctgaaaaa gggaagacag 9361 tgatggacat tatttcaaga caagaccaaa gggggagcgg acaagttgtc acttacgctc 9421 tcaacacatt taccaaccta gtggtgcaac tcattcggaa tatggaggct gaggaagttc 9481 tagagatgca agacttgtgg ctgctgcgga ggtcagagaa agtgaccaac tggttgcaga 9541 gcaacggatg ggataggctc aaacgaatgg cagtcagtgg agatgattgc gttgtgaagc 9601 caattgatga taggtttgca catgccctca ggttcttgaa tgatatgggg aaagttagga 9661 aggacacaca agaatggaaa ccctcaactg gatgggacaa ctgggaagaa gttccgtttt 9721 gctcccacca tttcaacaag ctccatctca aggacgggag gtccattgtg gttccctgcc 9781 gccaccaaga tgaactgatt ggccgggccc gcgtctctcc aggggcggga tggagcatcc 9841 gggagactgc ttgcctagca aaatcatatg cgcagatgtg gcagctcctt tatttccaca 9901 gaagggacct ccgactgatg gccaatgcca tttgttcatc tgtgccagtt gactgggttc 9961 caactgggag aactacctgg tcaatccatg gaaagggaga atggatgacc actgaagaca 10021 tgcttgtggt gtggaacaga gtgtggattg aggagaacga ccacatggaa gacaagaccc 10081 cagttacgaa atggacagac attccctatt tgggaaaaag ggaagactta tggtgtggat 10141 ctctcatagg gcacagaccg cgcaccacct gggctgagaa cattaaaaac acagtcaaca 10201 tggtgcgcag aatcataggt gatgaagaaa agtacatgga ctacctatcc acccaagttc 10261 gctacttggg tgaagaaggg tctacacctg gagtgctgta agcaccaatc ttagtgttgt 10321 caggcctgct agtcagccac agcttgggga aaactgtgca gcctgtgacc cccccaggag 10381 aagctgggaa accaagccca tagtcaggcc gagaacgcca tggcacggaa gaagccatgc 10441 tgcctgtgag cccctcagag gacactgagt caaaaaaccc cacg

Singapore National Public Health Laboratory has released a full 2016 Zika sequence, ZKA-16-097, from current outbreak. As expected, the sequence is similar to recent South Pacific sequences.

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

September 13, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are 13 new travel-related cases today including eight in Miami-Dade, one in Escambia, one in Hillsborough, one in Manatee, one in Monroe and one in Seminole. Please visit our website to see the full list of travel-related cases. There are six new non-travel related cases today: Four individuals are associated with ongoing active transmission in Miami Beach. One individual was identified within the Wynwood area and experienced symptoms of Zika in early August. This case is being announced today following confirmatory lab results. One individual is a Miami-Dade resident and the department is investigating to determine where exposure occurred. DOH continues door-to-door outreach and targeted testing in Pinellas, Palm Beach and Miami-Dade counties and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the small identified areas in Wynwood and Miami Beach in Miami-Dade County, see maps below. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 634 Non-Travel Related Infections of Zika 70 Infections Involving Pregnant Women 86 Out of State Cases (not Florida Residents) 9 Total 799 The department is currently conducting 17 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 6,895 people statewide. Florida currently has the capacity to test 5,251 people for active Zika virus and 8,737 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. Florida’s small case cluster is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted area in Miami-Dade County (see map below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 86. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 6,020 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. State of Florida Miami-Dade County About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.

Infection Type Infection Count Travel-Related Infections of Zika 634 Non-Travel Related Infections of Zika 70 Infections Involving Pregnant Women 86 Out of State Cases (not Florida Residents) 9 Total 799 http://www.floridahealth.gov/newsroom/2016/09/091316-zika-update.html

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Zika Cases in New Jersey Last Updated: September 13, 2016 http://www.nj.gov/health/cd/zika/case_count.shtml

Zika Cases in New Jersey Last Updated: September 13, 2016

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Confirmed Zika Cases Oregon, 2016 Travel-associated cases: 29 Oregon mosquito-acquired cases: 0 Total: 29 Updated Sept. 13, 2016 https://public.health.oregon.gov/DiseasesConditions/DiseasesAZ/Zika/Pages/index.aspx

Confirmed Zika Cases Oregon, 2016 Travel-associated cases: 29 Oregon mosquito-acquired cases: 0 Total: 29 Updated Sept. 13, 2016

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Zika Confirmed Cases County Cases* Chelan 1 Clallam 2 Clark 1 Cowlitz 1 Franklin 1 Grant 1 King 13 Kitsap 1 Mason 1 Pierce 4 Skagit 2 Snohomish 6 Yakima 1 Washington State Total 35 * Confirmed travel-associated cases in WA as of 9/13/16 http://www.doh.wa.gov/YouandYourFamily/IllnessandDisease/ZikaVirus