niman

Current Indiana Zika Count Zika Cases 2015 2016 Total Travel-associated 3 32 35 Locally-acquired 0 0 0

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

As of Sept. 12, 2016 80 confirmed travel-related Zika cases in Georgia http://dph.georgia.gov/

As of Sept. 12, 2016 80 confirmed travel-related Zika cases in Georgia See confirmed Zika Cases by County here. Confirmed travel-related Zika cases in Georgia (by county) since January 2016 County Number of Travel-Related Zika Cases Barrow < 5 Bibb < 5 Bulloch < 5 Camden < 5 Carroll < 5 Chatham < 5 Cherokee < 5 Clarke < 5 Clayton < 5 Cobb <5 Columbia < 5 DeKalb 10-14 Douglas < 5 Forsyth < 5 Fulton 10-14 Gwinnett 10-14 Hart < 5 Henry < 5 Liberty < 5 Long < 5 Lowndes < 5 Muscogee < 5 Richmond < 5 Rockdale < 5 Thomas < 5 Toombs < 5 Walker < 5 Walton < 5

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Allegheny County Residents Approved for Zika Testing: 185 CDC Confirmed Cases: 10 Unspecified Flavivirus Infections: 1* (as of September 12, 2016) *- specific virus (dengue/zika) cannot be identified

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Channel NewsAsia - 4 new Zika cases confirmed Monday, bringing total to 333 Slightly more than 80% of the confirmed cases were from the main cluster in Aljunied, Sims Drive and Paya Lebar Way. 13 Sep 2016Listen fumigationFour new cases of locally transmitted Zika were confirmed by authorities on Monday (Sep 12), bringing the total number of confirmed cases to 333.Of these, 269 - slightly more than 80% of the confirmed cases were from the main cluster in Aljunied, Sims Drive and Paya Lebar Way. An update on the National Environment Agency (NEA)'s website gave detailed information on the number of cases in each cluster:1. Aljunied Cresc / Aljunied Rd / Circuit Road / Geylang East Ave 1 Geylang East Ctrl / Lor 21A, 23, 25 Geylang / Paya Lebar Way / Pipit Rd / Sims Dr / Sims Pl (269 cases as of 12 Sep 2016, of which 101 cases with onset in the last 2 weeks) - 2. Bedok Nth Ave 2 / Bedok Nth Ave 3 / Bedok Nth St 3 (5 cases as of 12 Sep 2016, of which 1 case with onset in the last 2 weeks)3. Joo Seng Rd (3 cases as of 12 Sep 2016, of which 2 cases with onset in the last 2 weeks)4. Bishan St 12 (5 cases as of 12 Sep 2016, of which 5 cases with onset in the last 2 weeks)5. Elite Ter / Jln Tua Kong / Elite Ter / Jln Tua Kong / Jln Tua Kong (Park East) / Siglap Road (Flamingo Valley)(7 cases as of 12 Sep 2016, of which 7 cases with onset in the last 2 weeks)6. Ubi Ave 1, Cres(3 cases as of 12 Sep 2016, of which 3 cases with onset in the last 2 weeks)7. Circuit Rd / Jln Raya(2 cases as of 12 Sep 2016, of which 2 cases with onset in the last 2 weeks) - See more at: https://www.gov.sg/news/content/channel-newsasia-4-new-zika-cases-confirmed-monday-bringing-total-to-333#sthash.TOGcjUSS.dpuf

Cases notified on 13 Sep 2016 (as at 3pm) 0 E-week 35 (28 Aug - 3 Sep 2016) E-week 36 (4 Sep - 10 Sep 2016) E-week 37 (11 Sep 2016 - 13 Sep 2016 as at 3pm) 215 103 15 http://www.nea.gov.sg/public-health/vector-control/overview/zika-clusters

Pregnant Women Anxious as Florida’s Zika Test Results Take Weeks By LIZETTE ALVAREZSEPT. 12, 2016 Continue reading the main storyShare This Page Share Tweet Email More MIAMI — So many pregnant women have taken advantage of Florida’s offer of free Zika testing that state laboratories have been unable to keep pace, doctors and patients say, leading to long delays for women anxious to know whether the virus has passed to their fetuses. The delays began with a well-intentioned and much-applauded offer. On Aug. 3, Gov. Rick Scott announced that the state would provide the costly Zika tests to all pregnant women, a move intended to quell fears and allow low-income or uninsured women to be tested. Babies infected with Zika can be born with microcephaly, a devastating brain malformation, or with eye and ear defects. “We’re ramping that up across the entire state,” Mr. Scott said at the time. But hundreds of women in Miami-Dade County, where Zika is spreading, have been waiting weeks for state results on the same kinds of tests that private laboratories are turning around in three to seven days, doctors said. For some women, the delays could complicate already distressing decisions about whether to terminate their pregnancies if they test positive. Florida forbids abortions after 24 weeks. State health officials declined to say how many tests had been done, provide a reason for the delay or explain how they planned to remedy it. But doctors and researchers attributed some of the delay to a lack of resources, with not enough staff members to analyze the test results. Acknowledging the delays, Dr. Lillian Rivera, the Florida Health Department administrator for Miami-Dade County, told a panel of Zika experts from the University of Miami last week that the reasons were complicated. Sometimes, she said, “tests are done and have been delivered, and sometimes there are bureaucratic reasons; they are in someone’s computer or fax machine.” The state has contracts for some of the work with two major private laboratories, LabCorp and Quest Diagnostics, she said. In a small number of Florida cases, the long wait can be traced to a final cumbersome test that must be analyzed by the Centers for Disease Control and Prevention or an approved laboratory to confirm the presence of the virus. For many women, the delays have added to the stress of pregnancy. “It worries me because I just want to know and I want to make sure the baby is healthy and everything is O.K.,” said Aileen Perez, 31, a nurse practitioner who is 20 weeks pregnant and has been waiting nearly five weeks for her results. Ms. Perez, though, said she was confident that her results would come back negative because she had been very careful — wearing long sleeves, applying repellent and staying indoors as much as possible. The Health Department said in a statement that more than 6,649 people had been tested for Zika statewide as of Monday. So far, 86 pregnant women in the state have tested positive. In all, 771 Florida residents have tested positive for the virus; most were infected while traveling abroad. The long waits for pregnant women in Florida come as Congress continues to argue over a bill that would inject $1.1 billion into efforts to prevent Zika, test for the virus and develop a vaccine. Congress left for its August recess after the bill stalled in the House as Republicans and Democrats clashed over a measure that would exclude Planned Parenthood from the list of providers designated to combat the virus. Some doctors worry that the backlog could get worse. Doctors recommend that pregnant women receive a Zika test every trimester, and obstetricians in Miami-Dade County say that many of their patients will soon need to be retested without knowing the initial results. Dr. Christine Curry, an obstetrician at the University of Miami Health System, which is a partner with Miami’s only public hospital, and a director of the university’s Zika response team, said she had 400 pregnant patients who were waiting for results, some for as long as six weeks. Doctors and pathologists are urging that Florida increase the number of tests they are sending to private labs to be processed, which would take some of the pressure off the state. “Anyone waiting four weeks, who is pregnant, that is a really long time,” Dr. Curry said. “It’s really stressful for them. The first ones we tested were in August, and they came back for the next appointment saying, ‘Where is my test result?’” Dr. Curry said the governor’s offer was significant because it gave low-income pregnant women or uninsured women a chance to be tested, but she said the state had not been able to cope with the numbers rushing to be tested. Private tests range from $120 to $750. Mr. Scott’s offer was “awesome,” Dr. Curry said, “but a mandate without resources is hollow.” In her office at Jackson Memorial Hospital, Miami’s largest public hospital, the number of women seeking the test rose from one or two a day to 10 or 20 a day, or more, she said. Dr. Ellen Schwartzbard, an obstetrician at South Miami Hospital, said she had encountered similar problems. While most of her patients choose to go to private labs, 20 of the women who relied on free public testing are waiting for results four weeks later. “There is definitely a level of frustration,” she said. “This lag time of four to five weeks can impact the patients’ decisions to terminate the pregnancy because now they are further along in their pregnancies. Unfortunately, there is no control over the situation.” Pathologists said the backlog had grown tremendously, raising fears that if locally acquired Zika cases spread to other counties in Florida, the wait would grow considerably. Dr. David M. Anderson, the medical director of Pathology Laboratories at Jackson Memorial Hospital, said the hospital was waiting for the results of 800 to 900 specimens tested for Zika. Part of the backlog stems from the cumbersome testing process. Most people must undergo a series of tests to either rule out or confirm they have the virus. There is no one simple diagnostic test that does this, a complaint of doctors and researchers who are pushing for funding to develop a simpler, less costly kind of antibody test. The first blood or urine test, the PCR, is relatively straightforward but is effective only if a person currently has the infection, which stays in the body for about two weeks. A negative result requires a patient to move on to an antibody test called IgM, which can show if someone has had the virus in the last 12 weeks. Both of those tests take only hours to process, and private labs have a turnaround time of a week or less. Quest plans to offer the IgM test, which LabCorp already offers, in the next few weeks. But if someone tests positive on the antibody test — and many do not — a more complicated antibody test typically follows, one that is conducted only by the C.D.C. or a C.D.C.-approved lab. This test pinpoints whether the antibody is related to Zika, and not dengue or Chikungunya. If the test is sent from an outside lab, it can take as long as five weeks to confirm results and deliver them because the test is complicated, said a C.D.C. spokesman, Benjamin Haynes. Mr. Haynes said there was no backlog for this kind of testing at the C.D.C. The C.D.C. has performed the antibody test this year on 3,500 samples, all but a few from the United States mainland. Some are from Puerto Rico. “Faster and better diagnostics is high on the list” of priorities, said Dr. Rivera, the Health Department administrator. A version of this article appears in print on September 13, 2016, on page A1 of the New York edition with the headline: Fretful Pregnancies as Zika Results Lag in Florida. Order Reprints| Today's Paper|Subscribe http://www.nytimes.com/2016/09/13/us/zika-test-delays-florida-pregnant.html?_r=0

September 12, 2016 http://www.floridahealth.gov/newsroom/2016/09/091216-zika-update.html Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are seven new travel-related cases today including two in Miami-Dade, two in Palm Beach, one in Nassau and two involving pregnant women. This is Nassau County’s first travel-related case and the Declaration of Public Health Emergency has been amended to include the county. Please visit our website to see the full list of travel-related cases. There are eight new non-travel related cases today: Two individuals were identified within the Wynwood area and experienced symptoms of Zika in late July. These cases are being announced today following confirmatory antibody testing to rule out other mosquito-borne illness such as Dengue and Chikungunya. Two individuals are associated with ongoing active transmission in Miami Beach. One individual is a Palm Beach resident, however, we are investigating to determine where exposure occurred. The other three individuals are Miami-Dade residents, however, we are investigating to determine where exposure occurred. DOH continues door-to-door outreach and targeted testing in Pinellas, Palm Beach and Miami-Dade counties and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the small identified areas in Wynwood and Miami Beach in Miami-Dade County, see maps below. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 621 Non-Travel Related Infections of Zika 64 Infections Involving Pregnant Women 86 Total 771 The department is currently conducting 17 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 6,649 people statewide. Florida currently has the capacity to test 5,306 people for active Zika virus and 8,801 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. Florida’s small case cluster is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted area in Miami-Dade County (see map below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 86. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 5,941 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. State of Florida Miami-Dade County About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.

September 12, 2016 http://www.floridahealth.gov/newsroom/2016/09/091216-zika-update.html Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are seven new travel-related cases today including two in Miami-Dade, two in Palm Beach, one in Nassau and two involving pregnant women. This is Nassau County’s first travel-related case and the Declaration of Public Health Emergency has been amended to include the county. Please visit our website to see the full list of travel-related cases. There are eight new non-travel related cases today: Two individuals were identified within the Wynwood area and experienced symptoms of Zika in late July. These cases are being announced today following confirmatory antibody testing to rule out other mosquito-borne illness such as Dengue and Chikungunya. Two individuals are associated with ongoing active transmission in Miami Beach. One individual is a Palm Beach resident, however, we are investigating to determine where exposure occurred. The other three individuals are Miami-Dade residents, however, we are investigating to determine where exposure occurred. DOH continues door-to-door outreach and targeted testing in Pinellas, Palm Beach and Miami-Dade counties and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the small identified areas in Wynwood and Miami Beach in Miami-Dade County, see maps below. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 621 Non-Travel Related Infections of Zika 64 Infections Involving Pregnant Women 86 Total 771 The department is currently conducting 17 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 6,649 people statewide. Florida currently has the capacity to test 5,306 people for active Zika virus and 8,801 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. Florida’s small case cluster is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted area in Miami-Dade County (see map below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 86. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 5,941 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. State of Florida Miami-Dade County About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.

The department is conducting 17 active investigations, including 14 in Miami-Dade, one in Pinellas and two in Palm Beach counties. The department continues door-to-door outreach and targeted testing in Pinellas, Palm Beach and Miami-Dade counties and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. The department has closed out five investigations including three in Miami-Dade County, one in Broward County and one in Palm Beach County. These cases were determined to be single cases with no additional transmission or linkage to areas of active transmission. http://www.floridahealth.gov/diseases-and-conditions/zika-virus/index.html?utm_source=flhealthIndex

Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX380263.1| Zika virus isolate FS92-2016 envelope protein gene, partial cds 2727 2727 100% 0.0 100% KX380263.1 Select seq gb|KX447521.1| Zika virus isolate 1_0080_PF polyprotein gene, partial cds 2713 2713 100% 0.0 99% KX447521.1 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 2713 2713 100% 0.0 99% KX447509.1 Select seq gb|KX216635.1| Zika virus isolate TS17-2016 envelope protein gene, partial cds 2709 2709 100% 0.0 99% KX216635.1 Select seq gb|KX216634.1| Zika virus isolate TS14-2016 envelope protein gene, partial cds 2709 2709 100% 0.0 99% KX216634.1 Select seq gb|KX806557.1| Zika virus isolate TS17-2016, complete genome 2709 2709 100% 0.0 99% KX806557.1 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 2709 2709 100% 0.0 99% KJ776791.2 Select seq gb|KX447520.1| Zika virus isolate 1_0016_PF polyprotein gene, partial cds 2709 2709 100% 0.0 99% KX447520.1 Select seq gb|KX447519.1| Zika virus isolate 1_0199_PF polyprotein gene, partial cds 2709 2709 100% 0.0 99% KX447519.1 Select seq gb|KX447518.1| Zika virus isolate 1_0117_PF polyprotein gene, partial cds 2709 2709 100% 0.0 99% KX447518.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 2709 2709 100% 0.0 99% KX447516.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 2709 2709 100% 0.0 99% KX447515.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 2709 2709 100% 0.0 99% KX447513.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 2709 2709 100% 0.0 99% KX447510.1 Select seq dbj|LC171327.1| Zika virus gene for polyprotein, partial cds, strain: ZIKV/Hu/Chiba/S36/2016 2709 2709 100% 0.0 99% LC171327.1 Select seq gb|KX576684.1| Zika virus vector pZIKV-ICD, complete sequence 2709 2709 100% 0.0 99% KX576684.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 2709 2709 100% 0.0 99% KX369547.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 2709 2709 100% 0.0 99% KX280026.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 2709 2709 100% 0.0 99% KX262887.1 Select seq gb|KX216638.1| Zika virus isolate ESS23-2015 envelope protein gene, partial cds 2704 2704 100% 0.0 99% KX216638.1 Select seq gb|KX216637.1| Zika virus isolate GS29-2016 envelope protein gene, partial cds 2704 2704 100% 0.0 99% KX216637.1 Select seq gb|KX216632.1| Zika virus isolate SIS58-2015 envelope protein gene, partial cds 2704 2704 100% 0.0 99% KX216632.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 2704 2704 100% 0.0 99% KX694534.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 2704 2704 100% 0.0 99% KX447517.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 2704 2704 100% 0.0 99% KX447514.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 2704 2704 100% 0.0 99% KX447511.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 2704 2704 100% 0.0 99% KX446951.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 2704 2704 100% 0.0 99% KX247632.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 2704 2704 100% 0.0 99% KX051563.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 2704 2704 100% 0.0 99% KU509998.3 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 2704 2704 100% 0.0 99% KU991811.1 Select seq gb|KU646828.1| Zika virus isolate Si322 polyprotein gene, partial cds 2704 2704 100% 0.0 99% KU646828.1 Select seq gb|KX216640.1| Zika virus isolate CKS63-2014 envelope protein gene, partial cds 2700 2700 100% 0.0 99% KX216640.1 Select seq gb|KX216636.1| Zika virus isolate SS27-2016 envelope protein gene, partial cds 2700 2700 100% 0.0 99% KX216636.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 2700 2700 100% 0.0 99% KX197205.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 2700 2700 100% 0.0 99% KX447512.1 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 2700 2700 100% 0.0 99% KX266255.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 2700 2700 100% 0.0 99% KX446950.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU866423.2 Select seq gb|KU758871.1| Zika virus isolate 17170 polyprotein gene, partial cds 2700 2700 100% 0.0 99% KU758871.1 Select seq gb|KU758870.1| Zika virus isolate 17160 polyprotein gene, partial cds 2700 2700 100% 0.0 99% KU758870.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 2700 2700 100% 0.0 99% KX253996.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 2700 2700 100% 0.0 99% KX247646.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 2700 2700 100% 0.0 99% KX198135.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 2700 2700 100% 0.0 99% KX197192.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KX185891.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 2700 2700 100% 0.0 99% KX156776.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 2700 2700 100% 0.0 99% KX156775.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 2700 2700 100% 0.0 99% KX156774.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 2700 2700 100% 0.0 99% KX117076.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU963796.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU955589.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 2700 2700 100% 0.0 99% KU870645.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 2700 2700 100% 0.0 99% KU922960.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 2700 2700 100% 0.0 99% KU922923.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 2700 2700 100% 0.0 99% KU820899.2 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU729218.1 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 2700 2700 100% 0.0 99% KU527068.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU647676.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 2700 2700 100% 0.0 99% KU321639.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 2697 2697 100% 0.0 99% KX766028.1 Select seq gb|KX380262.1| Zika virus isolate MS10-2016 envelope protein gene, partial cds 2695 2695 100% 0.0 99% KX380262.1 Select seq gb|KX216633.1| Zika virus isolate VS51-2016 envelope protein gene, partial cds 2695 2695 100% 0.0 99% KX216633.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU820897.5 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 2695 2695 100% 0.0 99% KX766029.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KX520666.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU758877.1 Select seq gb|KU758873.1| Zika virus isolate 18246 polyprotein gene, partial cds 2695 2695 100% 0.0 99% KU758873.1 Select seq gb|KU758869.1| Zika virus isolate 05211 polyprotein gene, partial cds 2695 2695 100% 0.0 99% KU758869.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU937936.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 2695 2695 100% 0.0 99% KX087102.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 2695 2695 100% 0.0 99% KU940228.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 2695 2695 100% 0.0 99% KU926309.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 2695 2695 100% 0.0 99% KU497555.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU501217.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU501216.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU365778.1 Select seq gb|KU312315.1| Zika virus isolate Z1106027 polyprotein gene, partial cds 2695 2695 100% 0.0 99% KU312315.1 Select seq gb|KU312314.1| Zika virus isolate Z1106031 polyprotein gene, partial cds 2695 2695 100% 0.0 99% KU312314.1 Select seq gb|KJ634273.1| Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds 2695 2695 100% 0.0 99% KJ634273.1 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 2691 2691 100% 0.0 99% KX702400.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KX548902.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 2691 2691 100% 0.0 99% KX377337.1 Select seq gb|KU758874.1| Zika virus isolate 20114 polyprotein gene, partial cds 2691 2691 100% 0.0 99% KU758874.1 Select seq gb|KU758868.1| Zika virus isolate 27229 polyprotein gene, partial cds 2691 2691 100% 0.0 99% KU758868.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU820898.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU740184.2 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 2691 2691 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 2691 2691 100% 0.0 99% KU853012.1 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU761564.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 2691 2691 100% 0.0 99% KU707826.1 Select seq gb|KU646827.1| Zika virus isolate Si323 polyprotein gene, partial cds 2691 2691 100% 0.0 99% KU646827.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 2691 2691 100% 0.0 99% KU501215.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU365780.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU365779.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU365777.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 2686 2686 100% 0.0 99% KX673530.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 2686 2686 100% 0.0 99% KX601168.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 2686 2686 100% 0.0 99% KX087101.2 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 2686 2686 100% 0.0 99% KX056898.1

LOCUS KX380263 1512 bp RNA linear VRL 07-SEP-2016 DEFINITION Zika virus isolate FS92-2016 envelope protein gene, partial cds. ACCESSION KX380263 VERSION KX380263.1 GI:1036637438 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 1512) AUTHORS Pyke,A.T. and Moore,P.R. TITLE First isolation of Zika virus in Australia from a clinical patient, imported from Tonga JOURNAL Unpublished REFERENCE 2 (bases 1 to 1512) AUTHORS Pyke,A.T. and Moore,P.R. TITLE Direct Submission JOURNAL Submitted (14-JUN-2016) Public Health Virology, Queensland Health Forensic and Scientific Services, 39 Kessels Road, Coopers Plains, QLD 4108, Australia COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1512 /organism="Zika virus" /mol_type="genomic RNA" /isolate="FS92-2016" /host="Homo sapiens" /db_xref="taxon:64320" /country="Fiji" /collection_date="2016" /note="genotype: Asian" CDS <1..>1512 /codon_start=1 /product="envelope protein" /protein_id="ANK57899.1" /db_xref="GI:1036637439" /translation="IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSA" ORIGIN 1 atcaggtgca taggagtcag caatagggac tttgtggaag gtatgtcagg tgggacttgg 61 gttgatgttg tcttggaaca tggaggttgt gtcaccgtaa tggcacagga caaaccgact 121 gtcgacatag agctggttac aacaacagtc agcaacatgg cggaggtaag atcctactgc 181 tatgaggcat caatatcgga catggcttcg gacagccgct gcccaacaca aggtgaagcc 241 taccttgaca agcaatcaga cactcaatat gtctgcaaaa gaacgttagt ggacagaggc 301 tggggaaatg gatgtggact ttttggcaaa gggagcctgg tgacctgcgc taagtttgca 361 tgctccaaga aaatgaccgg gaagagcatc cagccagaga atctggagta ccggataatg 421 ctgtcagttc atggctccca gcacagtggg atgatcgtta atgacacagg acatgaaact 481 gatgagaata gagcgaaggt tgagataacg cccaattcac caagagccga agccaccctg 541 gggggttttg gaagcctagg acttgattgt gaaccgagga caggccttga cttttcagat 601 ttgtattact tgactatgaa taacaagcac tggttggttc acaaggagtg gttccacgac 661 attccattac cttggcacgc tggggcagac accggaactc cacactggaa caacaaagaa 721 gcactggtag agttcaagga cgcacatgcc aaaaggcaga ctgtcgtggt tctagggagt 781 caagaaggag cagttcacac ggcccttgct ggagctctgg aggctgagat ggatggtgca 841 aagggaaggc tgtcctctgg ccacttgaaa tgtcgcctga aaatggataa acttagattg 901 aagggcgtgt catactcctt gtgtaccgca gcgttcacat tcaccaagat cccggctgaa 961 acactgcacg ggacagtcac agtggaggta cagtacgcag ggacagatgg accttgcaag 1021 gttccagctc agatggcggt ggacatgcaa actctgaccc cagttgggag gttgataacc 1081 gctaaccctg taatcactga aagcactgag aactctaaga tgatgctgga acttgatcca 1141 ccatttgggg actcttacat tgtcatagga gtcggggaga agaagatcac ccaccactgg 1201 cacaggagtg gcagcaccat tggaaaagca tttgaagcca ctgtgagagg tgccaagaga 1261 atggcagtct tgggagacac agcctgggac tttggatcag ttggaggcgc tctcaactca 1321 ttgggcaagg gcatccatca aatttttgga gcagctttca aatcattgtt tggaggaatg 1381 tcctggttct cacaaattct cattggaacg ttgctgatgt ggttgggtct gaacacaaag 1441 aatggatcta tttcccttat gtgcttggcc ttagggggag tgttgatctt cttatccaca 1501 gccgtctctg ct

Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX380262.1| Zika virus isolate MS10-2016 envelope protein gene, partial cds 2727 2727 100% 0.0 100% KX380262.1 Select seq gb|KX447520.1| Zika virus isolate 1_0016_PF polyprotein gene, partial cds 2713 2713 100% 0.0 99% KX447520.1 Select seq gb|KX447519.1| Zika virus isolate 1_0199_PF polyprotein gene, partial cds 2713 2713 100% 0.0 99% KX447519.1 Select seq gb|KX447518.1| Zika virus isolate 1_0117_PF polyprotein gene, partial cds 2713 2713 100% 0.0 99% KX447518.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 2713 2713 100% 0.0 99% KX447513.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 2713 2713 100% 0.0 99% KX447510.1 Select seq gb|KX576684.1| Zika virus vector pZIKV-ICD, complete sequence 2713 2713 100% 0.0 99% KX576684.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 2713 2713 100% 0.0 99% KX369547.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 2713 2713 100% 0.0 99% KX280026.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 2713 2713 100% 0.0 99% KX262887.1 Select seq gb|KX216638.1| Zika virus isolate ESS23-2015 envelope protein gene, partial cds 2709 2709 100% 0.0 99% KX216638.1 Select seq gb|KX216637.1| Zika virus isolate GS29-2016 envelope protein gene, partial cds 2709 2709 100% 0.0 99% KX216637.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 2709 2709 100% 0.0 99% KX694534.1 Select seq gb|KX447521.1| Zika virus isolate 1_0080_PF polyprotein gene, partial cds 2709 2709 100% 0.0 99% KX447521.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 2709 2709 100% 0.0 99% KX447511.1 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 2709 2709 100% 0.0 99% KX447509.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 2709 2709 100% 0.0 99% KX446951.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 2709 2709 100% 0.0 99% KX247632.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 2709 2709 100% 0.0 99% KX051563.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 2709 2709 100% 0.0 99% KU509998.3 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 2709 2709 100% 0.0 99% KU991811.1 Select seq gb|KU646828.1| Zika virus isolate Si322 polyprotein gene, partial cds 2709 2709 100% 0.0 99% KU646828.1 Select seq gb|KX216635.1| Zika virus isolate TS17-2016 envelope protein gene, partial cds 2704 2704 100% 0.0 99% KX216635.1 Select seq gb|KX216634.1| Zika virus isolate TS14-2016 envelope protein gene, partial cds 2704 2704 100% 0.0 99% KX216634.1 Select seq gb|KX806557.1| Zika virus isolate TS17-2016, complete genome 2704 2704 100% 0.0 99% KX806557.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 2704 2704 100% 0.0 99% KX197205.1 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 2704 2704 100% 0.0 99% KJ776791.2 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 2704 2704 100% 0.0 99% KX447516.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 2704 2704 100% 0.0 99% KX447515.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 2704 2704 100% 0.0 99% KX447512.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 2704 2704 100% 0.0 99% KX446950.1 Select seq gb|KU758871.1| Zika virus isolate 17170 polyprotein gene, partial cds 2704 2704 100% 0.0 99% KU758871.1 Select seq gb|KU758870.1| Zika virus isolate 17160 polyprotein gene, partial cds 2704 2704 100% 0.0 99% KU758870.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 2704 2704 100% 0.0 99% KX247646.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 2704 2704 100% 0.0 99% KX198135.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 2704 2704 100% 0.0 99% KX197192.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 2704 2704 100% 0.0 99% KX156776.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 2704 2704 100% 0.0 99% KX156775.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 2704 2704 100% 0.0 99% KX156774.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 2704 2704 100% 0.0 99% KU870645.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 2704 2704 100% 0.0 99% KU922960.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 2704 2704 100% 0.0 99% KU922923.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 2704 2704 100% 0.0 99% KU729218.1 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 2704 2704 100% 0.0 99% KU527068.1 Select seq gb|KU646827.1| Zika virus isolate Si323 polyprotein gene, partial cds 2704 2704 100% 0.0 99% KU646827.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 2704 2704 100% 0.0 99% KU647676.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 2704 2704 100% 0.0 99% KU321639.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 2702 2702 100% 0.0 99% KX766028.1 Select seq gb|KX216632.1| Zika virus isolate SIS58-2015 envelope protein gene, partial cds 2700 2700 100% 0.0 99% KX216632.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU820897.5 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 2700 2700 100% 0.0 99% KX766029.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 2700 2700 100% 0.0 99% KX447514.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KX520666.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU758877.1 Select seq gb|KU758873.1| Zika virus isolate 18246 polyprotein gene, partial cds 2700 2700 100% 0.0 99% KU758873.1 Select seq gb|KU758869.1| Zika virus isolate 05211 polyprotein gene, partial cds 2700 2700 100% 0.0 99% KU758869.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU937936.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 2700 2700 100% 0.0 99% KX087102.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 2700 2700 100% 0.0 99% KU940228.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 2700 2700 100% 0.0 99% KU926309.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 2700 2700 100% 0.0 99% KU497555.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU501217.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU501216.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU365778.1 Select seq gb|KU312315.1| Zika virus isolate Z1106027 polyprotein gene, partial cds 2700 2700 100% 0.0 99% KU312315.1 Select seq gb|KU312314.1| Zika virus isolate Z1106031 polyprotein gene, partial cds 2700 2700 100% 0.0 99% KU312314.1 Select seq gb|KX380263.1| Zika virus isolate FS92-2016 envelope protein gene, partial cds 2695 2695 100% 0.0 99% KX380263.1 Select seq gb|KX216640.1| Zika virus isolate CKS63-2014 envelope protein gene, partial cds 2695 2695 100% 0.0 99% KX216640.1 Select seq gb|KX216636.1| Zika virus isolate SS27-2016 envelope protein gene, partial cds 2695 2695 100% 0.0 99% KX216636.1 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 2695 2695 100% 0.0 99% KX702400.1 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 2695 2695 100% 0.0 99% KX266255.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KX548902.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 2695 2695 100% 0.0 99% KX377337.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU866423.2 Select seq gb|KU758874.1| Zika virus isolate 20114 polyprotein gene, partial cds 2695 2695 100% 0.0 99% KU758874.1 Select seq gb|KU758868.1| Zika virus isolate 27229 polyprotein gene, partial cds 2695 2695 100% 0.0 99% KU758868.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 2695 2695 100% 0.0 99% KX253996.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KX185891.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 2695 2695 100% 0.0 99% KX117076.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU963796.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU955589.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU820898.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU740184.2 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 2695 2695 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 2695 2695 100% 0.0 99% KU853012.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 2695 2695 100% 0.0 99% KU820899.2 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU761564.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 2695 2695 100% 0.0 99% KU707826.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 2695 2695 100% 0.0 99% KU501215.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU365780.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU365779.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU365777.1 Select seq gb|KU940224.1| Zika virus isolate Bahia09, partial genome 2693 2693 100% 0.0 99% KU940224.1 Select seq gb|KX216633.1| Zika virus isolate VS51-2016 envelope protein gene, partial cds 2691 2691 100% 0.0 99% KX216633.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 2691 2691 100% 0.0 99% KX673530.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 2691 2691 100% 0.0 99% KX447517.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 2691 2691 100% 0.0 99% KX601168.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 2691 2691 100% 0.0 99% KX087101.2 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KX056898.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU955590.1

LOCUS KX380262 1512 bp RNA linear VRL 07-SEP-2016 DEFINITION Zika virus isolate MS10-2016 envelope protein gene, partial cds. ACCESSION KX380262 VERSION KX380262.1 GI:1036637436 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 1512) AUTHORS Pyke,A.T. and Moore,P.R. TITLE First isolation of Zika virus in Australia from a clinical patient, imported from Tonga JOURNAL Unpublished REFERENCE 2 (bases 1 to 1512) AUTHORS Pyke,A.T. and Moore,P.R. TITLE Direct Submission JOURNAL Submitted (14-JUN-2016) Public Health Virology, Queensland Health Forensic and Scientific Services, 39 Kessels Road, Coopers Plains, QLD 4108, Australia COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1512 /organism="Zika virus" /mol_type="genomic RNA" /isolate="MS10-2016" /host="Homo sapiens" /db_xref="taxon:64320" /country="Mexico" /collection_date="2016" /note="genotype: Asian" CDS <1..>1512 /codon_start=1 /product="envelope protein" /protein_id="ANK57898.1" /db_xref="GI:1036637437" /translation="IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHVGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSA" ORIGIN 1 atcaggtgca taggagtcag caatagggac tttgtggaag gtatgtcagg tgggacttgg 61 gttgatgttg tcttggaaca tggaggttgt gtcaccgtaa tggcacagga caaaccgact 121 gtcgacatag agctggttac aacaacagtc agcaacatgg cggaggtaag atcctactgc 181 tatgaggcat caatatcaga catggcttcg gacagccgct gcccaacaca aggtgaagcc 241 taccttgaca agcaatcaga cactcaatat gtctgcaaaa gaacgttagt ggacagaggc 301 tggggaaatg gatgtggact ttttggcaaa gggagcctgg tgacatgcgc taagtttgca 361 tgctccaaga aaatgaccgg gaagagcatc cagccagaga atctggagta ccggataatg 421 ctgtcagttc atggctccca gcacagtggg atgatcgtta atgacacagg acatgaaact 481 gatgagaata gagcgaaggt tgagataacg cccaattcac caagagccga agccaccctg 541 gggggttttg gaagcctagg acttgattgt gaaccgagga caggccttga cttttcagat 601 ttgtattact tgactatgaa caacaagcac tggttggttc acaaggagtg gttccacgac 661 attccattac cttggcacgt tggggcagac accggaactc cacactggaa caacaaagaa 721 gcactggtag agttcaagga cgcacatgcc aaaaggcaaa ctgtcgtggt tctagggagt 781 caagaaggag cagttcacac ggcccttgct ggagctctgg aggctgagat ggatggtgca 841 aagggaaggc tgtcctctgg ccacttgaaa tgtcgcctga aaatggacaa acttagattg 901 aagggcgtgt catactcctt gtgtaccgca gcgttcacat tcaccaagat cccggctgaa 961 acactgcacg ggacagtcac agtggaggta cagtacgcag ggacagatgg accttgcaag 1021 gttccagctc agatggcggt ggacatgcaa actctgaccc cagttgggag gttgataacc 1081 gctaaccccg taatcactga aagcactgag aactctaaga tgatgctgga acttgatcca 1141 ccatttgggg actcttacat tgtcatagga gtcggggaga agaagatcac ccaccactgg 1201 cacaggagtg gcagcaccat tggaaaagca tttgaagcca ctgtgagagg tgccaagaga 1261 atggcagtct tgggagacac agcctgggac tttggatcag ttggaggcgc tctcaactca 1321 ttgggcaagg gcatccatca aatttttgga gcagctttca aatcattgtt tggaggaatg 1381 tcctggttct cacaaattct cattggaacg ttgctgatgt ggttgggtct gaacacaaag 1441 aatggatcta tttcccttat gtgcttggcc ttagggggag tgttgatctt cttatccaca 1501 gccgtctctg ct

Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX216640.1| Zika virus isolate CKS63-2014 envelope protein gene, partial cds 2727 2727 100% 0.0 100% KX216640.1 Select seq gb|KJ634273.1| Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds 2722 2722 100% 0.0 99% KJ634273.1 Select seq gb|KX447521.1| Zika virus isolate 1_0080_PF polyprotein gene, partial cds 2713 2713 100% 0.0 99% KX447521.1 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 2713 2713 100% 0.0 99% KX447509.1 Select seq gb|KX216635.1| Zika virus isolate TS17-2016 envelope protein gene, partial cds 2709 2709 100% 0.0 99% KX216635.1 Select seq gb|KX216634.1| Zika virus isolate TS14-2016 envelope protein gene, partial cds 2709 2709 100% 0.0 99% KX216634.1 Select seq gb|KX806557.1| Zika virus isolate TS17-2016, complete genome 2709 2709 100% 0.0 99% KX806557.1 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 2709 2709 100% 0.0 99% KJ776791.2 Select seq gb|KX447520.1| Zika virus isolate 1_0016_PF polyprotein gene, partial cds 2709 2709 100% 0.0 99% KX447520.1 Select seq gb|KX447519.1| Zika virus isolate 1_0199_PF polyprotein gene, partial cds 2709 2709 100% 0.0 99% KX447519.1 Select seq gb|KX447518.1| Zika virus isolate 1_0117_PF polyprotein gene, partial cds 2709 2709 100% 0.0 99% KX447518.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 2709 2709 100% 0.0 99% KX447516.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 2709 2709 100% 0.0 99% KX447515.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 2709 2709 100% 0.0 99% KX447513.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 2709 2709 100% 0.0 99% KX447510.1 Select seq gb|KX576684.1| Zika virus vector pZIKV-ICD, complete sequence 2709 2709 100% 0.0 99% KX576684.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 2709 2709 100% 0.0 99% KX369547.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 2709 2709 100% 0.0 99% KX280026.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 2709 2709 100% 0.0 99% KX262887.1 Select seq gb|KX216638.1| Zika virus isolate ESS23-2015 envelope protein gene, partial cds 2704 2704 100% 0.0 99% KX216638.1 Select seq gb|KX216637.1| Zika virus isolate GS29-2016 envelope protein gene, partial cds 2704 2704 100% 0.0 99% KX216637.1 Select seq gb|KX216632.1| Zika virus isolate SIS58-2015 envelope protein gene, partial cds 2704 2704 100% 0.0 99% KX216632.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 2704 2704 100% 0.0 99% KX694534.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 2704 2704 100% 0.0 99% KX447514.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 2704 2704 100% 0.0 99% KX447511.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 2704 2704 100% 0.0 99% KX446951.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 2704 2704 100% 0.0 99% KX247632.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 2704 2704 100% 0.0 99% KX051563.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 2704 2704 100% 0.0 99% KU509998.3 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 2704 2704 100% 0.0 99% KU991811.1 Select seq gb|KU646828.1| Zika virus isolate Si322 polyprotein gene, partial cds 2704 2704 100% 0.0 99% KU646828.1 Select seq gb|KX380263.1| Zika virus isolate FS92-2016 envelope protein gene, partial cds 2700 2700 100% 0.0 99% KX380263.1 Select seq gb|KX216636.1| Zika virus isolate SS27-2016 envelope protein gene, partial cds 2700 2700 100% 0.0 99% KX216636.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 2700 2700 100% 0.0 99% KX197205.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 2700 2700 100% 0.0 99% KX447512.1 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 2700 2700 100% 0.0 99% KX266255.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 2700 2700 100% 0.0 99% KX446950.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU866423.2 Select seq gb|KU758871.1| Zika virus isolate 17170 polyprotein gene, partial cds 2700 2700 100% 0.0 99% KU758871.1 Select seq gb|KU758870.1| Zika virus isolate 17160 polyprotein gene, partial cds 2700 2700 100% 0.0 99% KU758870.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 2700 2700 100% 0.0 99% KX253996.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 2700 2700 100% 0.0 99% KX247646.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 2700 2700 100% 0.0 99% KX198135.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 2700 2700 100% 0.0 99% KX197192.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KX185891.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 2700 2700 100% 0.0 99% KX156776.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 2700 2700 100% 0.0 99% KX156775.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 2700 2700 100% 0.0 99% KX156774.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 2700 2700 100% 0.0 99% KX117076.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU963796.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU955589.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 2700 2700 100% 0.0 99% KU870645.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 2700 2700 100% 0.0 99% KU922960.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 2700 2700 100% 0.0 99% KU922923.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 2700 2700 100% 0.0 99% KU820899.2 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU729218.1 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 2700 2700 100% 0.0 99% KU527068.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU647676.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 2700 2700 100% 0.0 99% KU321639.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 2697 2697 100% 0.0 99% KX766028.1 Select seq gb|KX380262.1| Zika virus isolate MS10-2016 envelope protein gene, partial cds 2695 2695 100% 0.0 99% KX380262.1 Select seq gb|KX216633.1| Zika virus isolate VS51-2016 envelope protein gene, partial cds 2695 2695 100% 0.0 99% KX216633.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU820897.5 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 2695 2695 100% 0.0 99% KX766029.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 2695 2695 100% 0.0 99% KX447517.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KX520666.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU758877.1 Select seq gb|KU758873.1| Zika virus isolate 18246 polyprotein gene, partial cds 2695 2695 100% 0.0 99% KU758873.1 Select seq gb|KU758869.1| Zika virus isolate 05211 polyprotein gene, partial cds 2695 2695 100% 0.0 99% KU758869.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU937936.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 2695 2695 100% 0.0 99% KX087102.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 2695 2695 100% 0.0 99% KU940228.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 2695 2695 100% 0.0 99% KU926309.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 2695 2695 100% 0.0 99% KU497555.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU501217.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU501216.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU365778.1 Select seq gb|KU312315.1| Zika virus isolate Z1106027 polyprotein gene, partial cds 2695 2695 100% 0.0 99% KU312315.1 Select seq gb|KU312314.1| Zika virus isolate Z1106031 polyprotein gene, partial cds 2695 2695 100% 0.0 99% KU312314.1 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 2691 2691 100% 0.0 99% KX702400.1 Select seq dbj|LC171327.1| Zika virus gene for polyprotein, partial cds, strain: ZIKV/Hu/Chiba/S36/2016 2691 2691 100% 0.0 99% LC171327.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KX548902.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 2691 2691 100% 0.0 99% KX377337.1 Select seq gb|KU758874.1| Zika virus isolate 20114 polyprotein gene, partial cds 2691 2691 100% 0.0 99% KU758874.1 Select seq gb|KU758868.1| Zika virus isolate 27229 polyprotein gene, partial cds 2691 2691 100% 0.0 99% KU758868.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU820898.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU740184.2 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 2691 2691 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 2691 2691 100% 0.0 99% KU853012.1 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU761564.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 2691 2691 100% 0.0 99% KU707826.1 Select seq gb|KU646827.1| Zika virus isolate Si323 polyprotein gene, partial cds 2691 2691 100% 0.0 99% KU646827.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 2691 2691 100% 0.0 99% KU501215.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU365780.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU365779.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU365777.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 2686 2686 100% 0.0 99% KX673530.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 2686 2686 100% 0.0 99% KX601168.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 2686 2686 100% 0.0 99% KX087101.2 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 2686 2686 100% 0.0 99% KX056898.1

LOCUS KX216640 1512 bp RNA linear VRL 07-SEP-2016 DEFINITION Zika virus isolate CKS63-2014 envelope protein gene, partial cds. ACCESSION KX216640 VERSION KX216640.1 GI:1029979487 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 1512) AUTHORS Moore,P.R. and Pyke,A.T. TITLE First isolation of Zika virus in Australia from a clinical patient, imported from Tonga JOURNAL Unpublished REFERENCE 2 (bases 1 to 1512) AUTHORS Moore,P.R. and Pyke,A.T. TITLE Direct Submission JOURNAL Submitted (04-MAY-2016) Public Health Virology, Queensland Health Forensic and Scientific Services, 39 Kessels Road, Coopers Plains, QLD 4108, Australia COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1512 /organism="Zika virus" /mol_type="genomic RNA" /isolate="CKS63-2014" /host="Homo sapiens" /db_xref="taxon:64320" /country="Cook Islands" /collection_date="2014" /note="genotype: Asian" CDS <1..>1512 /codon_start=1 /product="envelope protein" /protein_id="ANF28865.1" /db_xref="GI:1029979488" /translation="IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSA" ORIGIN 1 atcaggtgca taggagtcag caatagggac tttgtggaag gtatgtcagg tgggacttgg 61 gttgatgttg tcttggaaca tggaggttgt gtcaccgtaa tggcacagga caaaccgact 121 gtcgacatag agctggttac aacaacagtc agcaacatgg cggaggtaag atcctactgc 181 tatgaggcat caatatcgga catggcttcg gacagccgct gcccaacaca aggtgaagcc 241 taccttgaca agcaatcaga cactcaatat gtctgcaaaa gaacgttagt ggacagaggc 301 tggggaaatg gatgtggact ttttggcaaa gggagcctgg tgacatgcgc taagtttgca 361 tgctccaaga aaatgaccgg gaagagcatc cagccagaga atctggagta ccggataatg 421 ctgtcagttc atggctccca gcacagtggg atgatcgtta atgacacagg acatgaaact 481 gatgagaata gagcgaaggt tgagataacg cccaattcac caagagccga agccaccctg 541 gggggttttg gaagcctagg acttgattgt gaaccgagga caggccttga cttttcagat 601 ttgtattact tgactatgaa taacaagcac tggttagttc acaaggagtg gttccacgac 661 attccattac cttggcatgc tggggcagac accggaactc cacactggaa caacaaagaa 721 gcactggtag agttcaagga cgcacatgcc aaaaggcaaa ctgtcgtggt tctagggagt 781 caagaaggag cagttcacac ggcccttgct ggagctctgg aggctgagat ggatggtgca 841 aagggaaggc tgtcctctgg ccacttgaaa tgtcgcctga aaatggataa acttagattg 901 aagggcgtgt catactcctt gtgtaccgca gcgttcacat tcaccaaaat cccggctgaa 961 acactgcacg ggacagtcac agtggaggta cagtacgcag ggacagatgg accttgcaag 1021 gttccagctc agatggcggt ggacatgcaa actctgaccc cagttgggag gttgataacc 1081 gctaaccccg taatcactga aagcactgag aactctaaga tgatgctgga acttgatcca 1141 ccatttgggg actcttacat tgtcatagga gtcggggaga agaagatcac ccaccactgg 1201 cacaggagtg gcagcaccat tggaaaagca tttgaagcca ctgtgagagg tgccaagaga 1261 atggcagtct tgggagacac agcctgggac tttggatcag ttggaggcgc tctcaactca 1321 ttgggcaagg gcatccatca aatttttgga gcagctttca aatcattgtt tggaggaatg 1381 tcctggttct cacaaattct cattggaacg ttgctgatgt ggttgggtct gaacacaaag 1441 aatggatcta tttcccttat gtgcttggcc ttagggggag tgttgatctt cttatccaca 1501 gccgtctctg ct

Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX216639.1| Zika virus isolate SS57-2016 envelope protein gene, partial cds 2727 2727 100% 0.0 100% KX216639.1 Select seq gb|KX216636.1| Zika virus isolate SS27-2016 envelope protein gene, partial cds 2700 2700 100% 0.0 99% KX216636.1 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 2700 2700 100% 0.0 99% KX266255.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU866423.2 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 2700 2700 100% 0.0 99% KX253996.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KX185891.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 2700 2700 100% 0.0 99% KX117076.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU963796.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KU955589.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 2700 2700 100% 0.0 99% KU820899.2 Select seq gb|KX447521.1| Zika virus isolate 1_0080_PF polyprotein gene, partial cds 2695 2695 100% 0.0 99% KX447521.1 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 2695 2695 100% 0.0 99% KX447509.1 Select seq gb|KX216635.1| Zika virus isolate TS17-2016 envelope protein gene, partial cds 2691 2691 100% 0.0 99% KX216635.1 Select seq gb|KX216634.1| Zika virus isolate TS14-2016 envelope protein gene, partial cds 2691 2691 100% 0.0 99% KX216634.1 Select seq gb|KX806557.1| Zika virus isolate TS17-2016, complete genome 2691 2691 100% 0.0 99% KX806557.1 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 2691 2691 100% 0.0 99% KJ776791.2 Select seq gb|KX447520.1| Zika virus isolate 1_0016_PF polyprotein gene, partial cds 2691 2691 100% 0.0 99% KX447520.1 Select seq gb|KX447519.1| Zika virus isolate 1_0199_PF polyprotein gene, partial cds 2691 2691 100% 0.0 99% KX447519.1 Select seq gb|KX447518.1| Zika virus isolate 1_0117_PF polyprotein gene, partial cds 2691 2691 100% 0.0 99% KX447518.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 2691 2691 100% 0.0 99% KX447516.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 2691 2691 100% 0.0 99% KX447515.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 2691 2691 100% 0.0 99% KX447513.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 2691 2691 100% 0.0 99% KX447510.1 Select seq gb|KX576684.1| Zika virus vector pZIKV-ICD, complete sequence 2691 2691 100% 0.0 99% KX576684.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 2691 2691 100% 0.0 99% KX369547.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 2691 2691 100% 0.0 99% KX280026.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 2691 2691 100% 0.0 99% KX262887.1 Select seq gb|KX216638.1| Zika virus isolate ESS23-2015 envelope protein gene, partial cds 2686 2686 100% 0.0 99% KX216638.1 Select seq gb|KX216637.1| Zika virus isolate GS29-2016 envelope protein gene, partial cds 2686 2686 100% 0.0 99% KX216637.1 Select seq gb|KX216632.1| Zika virus isolate SIS58-2015 envelope protein gene, partial cds 2686 2686 100% 0.0 99% KX216632.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 2686 2686 100% 0.0 99% KX694534.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 2686 2686 100% 0.0 99% KX447514.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 2686 2686 100% 0.0 99% KX447511.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 2686 2686 100% 0.0 99% KX446951.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 2686 2686 100% 0.0 99% KX247632.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 2686 2686 100% 0.0 99% KX051563.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 2686 2686 100% 0.0 99% KU509998.3 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 2686 2686 100% 0.0 99% KU991811.1 Select seq gb|KU646828.1| Zika virus isolate Si322 polyprotein gene, partial cds 2686 2686 100% 0.0 99% KU646828.1 Select seq gb|KX380263.1| Zika virus isolate FS92-2016 envelope protein gene, partial cds 2682 2682 100% 0.0 99% KX380263.1 Select seq gb|KX216640.1| Zika virus isolate CKS63-2014 envelope protein gene, partial cds 2682 2682 100% 0.0 99% KX216640.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 2682 2682 100% 0.0 99% KX197205.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 2682 2682 100% 0.0 99% KX447512.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 2682 2682 100% 0.0 99% KX446950.1 Select seq gb|KU758871.1| Zika virus isolate 17170 polyprotein gene, partial cds 2682 2682 100% 0.0 99% KU758871.1 Select seq gb|KU758870.1| Zika virus isolate 17160 polyprotein gene, partial cds 2682 2682 100% 0.0 99% KU758870.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 2682 2682 100% 0.0 99% KX247646.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 2682 2682 100% 0.0 99% KX198135.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 2682 2682 100% 0.0 99% KX197192.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 2682 2682 100% 0.0 99% KX156776.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 2682 2682 100% 0.0 99% KX156775.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 2682 2682 100% 0.0 99% KX156774.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 2682 2682 100% 0.0 99% KU870645.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 2682 2682 100% 0.0 99% KU922960.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 2682 2682 100% 0.0 99% KU922923.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 2682 2682 100% 0.0 99% KU729218.1 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 2682 2682 100% 0.0 99% KU527068.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 2682 2682 100% 0.0 99% KU647676.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 2682 2682 100% 0.0 99% KU321639.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 2679 2679 100% 0.0 99% KX766028.1 Select seq gb|KX380262.1| Zika virus isolate MS10-2016 envelope protein gene, partial cds 2677 2677 100% 0.0 99% KX380262.1 Select seq gb|KX216633.1| Zika virus isolate VS51-2016 envelope protein gene, partial cds 2677 2677 100% 0.0 99% KX216633.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 2677 2677 100% 0.0 99% KU820897.5 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 2677 2677 100% 0.0 99% KX766029.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 2677 2677 100% 0.0 99% KX447517.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 2677 2677 100% 0.0 99% KX520666.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 2677 2677 100% 0.0 99% KU758877.1 Select seq gb|KU758873.1| Zika virus isolate 18246 polyprotein gene, partial cds 2677 2677 100% 0.0 99% KU758873.1 Select seq gb|KU758869.1| Zika virus isolate 05211 polyprotein gene, partial cds 2677 2677 100% 0.0 99% KU758869.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 2677 2677 100% 0.0 99% KU937936.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 2677 2677 100% 0.0 99% KX087102.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 2677 2677 100% 0.0 99% KU940228.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 2677 2677 100% 0.0 99% KU926309.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 2677 2677 100% 0.0 99% KU497555.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 2677 2677 100% 0.0 99% KU501217.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 2677 2677 100% 0.0 99% KU501216.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 2677 2677 100% 0.0 99% KU365778.1 Select seq gb|KU312315.1| Zika virus isolate Z1106027 polyprotein gene, partial cds 2677 2677 100% 0.0 99% KU312315.1 Select seq gb|KU312314.1| Zika virus isolate Z1106031 polyprotein gene, partial cds 2677 2677 100% 0.0 99% KU312314.1 Select seq gb|KJ634273.1| Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds 2677 2677 100% 0.0 99% KJ634273.1 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 2673 2673 100% 0.0 99% KX702400.1 Select seq dbj|LC171327.1| Zika virus gene for polyprotein, partial cds, strain: ZIKV/Hu/Chiba/S36/2016 2673 2673 100% 0.0 99% LC171327.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 2673 2673 100% 0.0 99% KX548902.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 2673 2673 100% 0.0 99% KX377337.1 Select seq gb|KU758874.1| Zika virus isolate 20114 polyprotein gene, partial cds 2673 2673 100% 0.0 99% KU758874.1 Select seq gb|KU758868.1| Zika virus isolate 27229 polyprotein gene, partial cds 2673 2673 100% 0.0 99% KU758868.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 2673 2673 100% 0.0 99% KU820898.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 2673 2673 100% 0.0 99% KU740184.2 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 2673 2673 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 2673 2673 100% 0.0 99% KU853012.1 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 2673 2673 100% 0.0 99% KU761564.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 2673 2673 100% 0.0 99% KU707826.1 Select seq gb|KU646827.1| Zika virus isolate Si323 polyprotein gene, partial cds 2673 2673 100% 0.0 99% KU646827.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 2673 2673 100% 0.0 99% KU501215.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 2673 2673 100% 0.0 99% KU365780.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 2673 2673 100% 0.0 99% KU365779.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 2673 2673 100% 0.0 99% KU365777.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 2668 2668 100% 0.0 99% KX673530.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 2668 2668 100% 0.0 99% KX601168.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 2668 2668 100% 0.0 99% KX087101.2

Pennsylvania Blood Tests Submitted for Zika TestingInformation updated Mondays at 2 p.m. Confirmed Infections: 108 Pending Test Results: 24 Last update: 09/12/2016 http://www.health.pa.gov/My Health/Diseases and Conditions/U-Z/Zikavirus/Pages/ZikaVirusHomePage.aspx#.V9bnS5grJgK

Pennsylvania Blood Tests Submitted for Zika TestingInformation updated Mondays at 2 p.m. Confirmed Infections: 108 Pending Test Results: 24 Last update: 09/12/2016