Jump to content

niman

Super Administrators
  • Posts

    74,774
  • Joined

  • Last visited

  • Days Won

    31

Everything posted by niman

  1. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  2. As of June 17, 201622 confirmed travel-related Zika cases in Georgia http://dph.georgia.gov/
  3. As of June 17, 201622 confirmed travel-related Zika cases in Georgia
  4. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  5. Zika case found in Pima County; 6th in Arizona POSTED:JUN 17 2016 09:15AM MST UPDATED:JUN 17 2016 04:13PM MST TUCSON, Ariz. (AP) — Pima County has seen its first case of travel-related Zika virus, making the sixth one in Arizona. The Pima County Health Department says a person who traveled in the Caribbean for an extended period of time and is now Arizona has tested positive for the virus. A spokesman said the department wasn't releasing the gender or age of the person infected because of privacy concerns. “This person did not become infected while here in Pima County,” said Pima County Health Department Director Francisco García. “As soon as we knew this person was at risk for Zika, we took the necessary steps to inform the individual on how to prevent mosquito bites.” Arizona health officials say there have been five other cases of residents who travelled in areas where the virus is circulating and came back infected. They are all in Maricopa County. “While travel related cases like this one are reminders that we should take steps to protect ourselves at home and during travel, the risk of having a person become infected with Zika virus while here in Pima County remains low,” Garcia said. The Zika virus causes mild and brief illness in most people but has been linked to fetal deaths and severe birth defects. Arizona Department of Health Serviceswww.azdhs.gov/zika Centers for Disease Control and Preventionwww.cdc.gov/zika
  6. “This person did not become infected while here in Pima County,” said Pima County Health Department Director Francisco García. “As soon as we knew this person was at risk for Zika, we took the necessary steps to inform the individual on how to prevent mosquito bites.” Arizona health officials say there have been five other cases of residents who travelled in areas where the virus is circulating and came back infected. They are all in Maricopa County. http://www.fox10phoenix.com/news/arizona-news/161082110-story
  7. Audio http://www.cdc.gov/media/releases/2016/t0617_zika.mp3
  8. Transcript for CDC Telebriefing: Zika Update Recommend on FacebookTweetPress Briefing TranscriptFriday, June 17, 2016, 10:00 a.m. ET Audio recording[MP3, 6.9 MB]Please Note:This transcript is not edited and may contain errors. OPERATOR: Welcome and thank you for standing by. I would like to remind parties that your lines have been placed on listen only until the question and answer portion of the conference. If you're wishing to ask a question, press star followed by one on the key pad of your telephone, and please be sure that your telephone is unmuted and clearly record your name at the prompt so that your question may be introduced. Today’s conference is being recorded. If you should have any objection, you may disconnect at this time. It is now my pleasure to turn the call over to Mrs. Kathy Harben. Thank you, you may begin. KATHY HARBEN: Thank you, Emily and thank you all for joining us this morning for this update on Zika virus, specifically the MMWR on the screening of blood donations for Zika virus infection using an investigational nucleic acid test in Puerto Rico. Joining us today is CDC Director, Dr. Tom Frieden and Dr. Matt Kuhnert, Director of CDC’s Office of Blood, Organ and Other Tissue Safety. Dr. Frieden will provide opening remarks before the Q&A Dr. Kuhnert will also have a few remarks. I’d now like to turn the call over to Dr. Frieden. TOM FRIEDEN: Thank you for joining us today. Summer is heating up and so is Zika. We’re sharing information on what may be our most accurate real-time leading indicator of Zika activity in Puerto Rico. I’ll give you the bottom line upfront. Based on the best information available, Zika infections appear to be increasing rapidly in Puerto Rico. The implication of this and the real importance of this information is that in the coming months it's possible that thousands of pregnant women in Puerto Rico could become infected with Zika. This could lead to dozens or hundreds of infants being born with microcephaly in the coming year and for the thousands of other infants born to women infected with Zika who don't have microcephaly, we simply don't know and may not know for years if there will be long-term consequences on brain development. Let me go back to what's being done and emphasize that this is part of a blood safety program which is keeping Zika out of the blood supply in Puerto Rico. So even though there's an increase in infection rates, there's no known risk from transfusion because of this highly sensitive test being used. Since April 3, blood centers in Puerto Rico have screened locally collected blood for Zika, using a highly accurate nucleic acid amplification test, this is a test that measures for the actual virus in the blood. It’s highly sensitive and highly specific. Screening blood that's donated for Zika protects the safety of patients and keeps the blood supply safe. At the same time, it gives us a window to see what's happening in infection rates generally, even though it's not a random sample of society. To date, there have been no confirmed cases of Zika spread through a blood transfusion anywhere in the United States or Puerto Rico and the other territories. A total of 68 out 12,777 blood donations in Puerto Rico have tested positive for Zika. That proportion has steadily increased. If you look at the graphic you can see a steady line upwards with infection rates. The highest percentage is the most recent week, 1.1 percent just last week, the week ending June 11th. Now although the blood donor population doesn't represent the general population, the increasing prevalence of blood donations that test positive for Zika likely reflect an overall increase in the infection in the population at large. Let me take a moment to clarify what this means. This is a test that measures whether someone is infected at the moment. They have virus in their blood. It’s not a test of whether they've been infected in recent months. We don't know precisely how long the virus stays in the blood by this particular test. By other tests, it's just a few days. This is more sensitive, so it may be a week or two. The result of that is that a 1 percent positivity rate at any given time translates into a more than 1 percent, perhaps 2 percent, we don't know exactly, rate of infection each month. This means that over the course of many months, for example, a nine-month pregnancy, there would be a substantial chance that a woman would become infected. I would reiterate that all donations that test positive are removed from the blood supply and donors who test positive get information about how to avoid spreading Zika to others. The increase in blood donations testing positive in Puerto Rico is concerning. It likely reflects an increase in the general population, but our concern here is about protecting pregnant women. With this rate of infection, the possibility that there could be thousands of pregnant women infected leading to dozens to hundreds of affected babies is what's of most concern. We’re working intensively in addition to keeping the blood supply safe with the Puerto Rico health department, the government, communities, and people throughout Puerto Rico to provide services for pregnant women; Deet, long sleeves, measures in their homes that might reduce their risk of getting infection, as well as to control the mosquitos. Controlling this mosquito is very difficult. It takes an entire community working together to protect a pregnant woman. We can't make the risk zero. We know that between Puerto Rico and the continental U.S. there have been more than 400 women identified who have likely Zika infections in pregnancy. Sadly, some of those pregnancies will result in affected infants. We can't make that risk zero but even if we can reduce it by 10 percent or 30 percent or 50 percent, that is a significant number of tragedies that we can prevent and we're doing everything we can to do that. Our priority remains to protect pregnant women. I’ll turn it over to Dr. Kuhnert to talk more about the testing and how that is protecting the blood supply. Matt? DR. MATT KUEHNERT: Thank you, Dr. Frieden. The test being used to screen blood in Puerto Rico is extremely accurate. It’s most effective, as Dr. Frieden mentioned, at identifying recent infection to protect the blood supply. Just to give some further insight on test accuracy, there is one blood center that's testing in the continental U.S. They have not seen any false positive results to date, and no positives at all which makes sense since there's currently no Zika-affected areas in the continental U.S. They've tested more than 9,000 donations. So this is a very good indicator of the accuracy of the test. I just wanted to also summarize the blood safety issues. Mosquito-borne diseases can be transmitted by blood transfusion. We’ve seen that in multiple examples. And to protect the blood supply, U.S. blood donors are routinely screened by questionnaire and by laboratory tests for risk of transmittable diseases. Transfusion-transmitted infections have been documented for several mosquito-borne diseases including West Nile virus and Dengue virus -- there's a strong possibility that Zika virus could be spread through blood transfusions. There’s been at least one case of Zika transmission by blood transfusion in Brazil. In areas without active transmission, such as the continental U.S., there are blood donor deferrals in place, excluding people who travel to Zika-infected areas and also excluding those with sexual contact with those who travel. But this isn't enough to identify Zika- infected donors in areas that have active mosquito-borne transmission of Zika virus because many won't have symptoms or will only have mild symptoms and won't know they've been infected. So laboratory testing of Zika virus is necessary because many donors won't have had symptoms. Through the interventions we have in place, the blood supply is being protected in Puerto Rico and through deferrals being protected in the continental U.S. I’ll turn it back to Dr. Frieden for a few summary remarks before Q&A. TOM FRIEDEN: Thank you very much Dr Kuehnert. Again, the bottom line is we're seeing a steady increase in infections in blood donors. That blood is being removed from the blood supply, so there's no reason to think that there's a risk of Zika from blood transfusion in Puerto Rico or anywhere else, but it does reflect a concerning trend in Puerto Rico. The priority is to protect pregnant women, to reduce the number of infants affected with microcephaly. That’s going to take the whole community - anything we can do to reduce those numbers will be critically important. We know we can't make them zero but everything we do to bring them down will be crucial. One of the challenges of combatting Zika is that the consequences of infections today will not become apparent for many months. That’s something which makes it challenging, but also makes us want to ensure that we're doing everything possible now so that we don't look back in three, six, or 12 months and say we wish we had done more back in June. I’ll stop there and I think Kathy Harben will open it up for questions. KATHY HARBEN: Yes, thank you, Dr. Frieden and Dr. Kuhnert. Emily, we're now ready to open up the line for Q&A. OPERATOR: Thank you. at this time, anyone wishing to ask a question or make a comment, please press star, followed by one on the key pad of your telephone, and please be sure your telephone is unmuted and clearly record your name at the prompt so that your question may be introduced. Once again, it is star followed by one to ask a question. One moment, please, for the first question. OPERATOR: Our first question is from Mike Stobbe from the Associated Press. MIKE STOBBE Hi. Thank you for taking my call. A couple questions if I may. First, Dr. Frieden, you talked about what may be coming in terms of case numbers of pregnant women and affected babies and fetuses. Could you walk us through what the projection is, the curve that's ahead of us? Is it over the summer that you think -- when do you think cases will reach their highest, for how many months ahead do we expect to see increases? And also could you remind us, when did Puerto Rico start using the test that Dr. Kuehnert was talking about? When did that first go into use? TOM FRIEDEN: First off, we don't have a crystal ball so we can't predict exactly what will happen. The two viruses spread by the same mosquito, Dengue and Chikungunya, generally peak over the summer and into the fall months. We’re not at the peak yet of the traditional time. If you look at what Chikungunya did the most recent virus to be introduced into Puerto Rico before Zika, the peak was over the summer months with the high rates going into the fall. So we haven't yet hit what is the traditional peak. We find that if, say, 20 percent to 30 percent of people become infected in a year, there are 32,000 births a year in Puerto Rico, even if the risk is limited to the first trimester, that's still thousands of infants at high risk of Zika. Our best estimate based on data from other countries is that of women infected in the first trimester, between 1 and 13 to 15 percent may have infants born with microcephaly. That’s where the estimates of potentially thousands of pregnant women, potentially dozens to hundreds of affected infants. Of course, we need to do everything possible to reduce that number. We also don't know for the infants born without microcephaly who were exposed to Zika in utero, whether there will be any long-term consequences and that's something that we may not know for some time. I think I said April 3 was the date of the start of testing. This is a new assay it was approved by the Food and Drug administration. It seems to be performing extremely well, both in terms of sensitivity and specificity. It’s highly effective at picking up relatively small amounts of the virus in the blood, and we are not aware of false positives so far. OPERATOR: Thank you. Our next question comes from Lisa Schnirring with CIDRAP News. LISA SCHNIRRING: Hi, thanks for being available today. Great information. I am wondering where this test is being used in the United States. That was good information, but it would be interesting to know where, if it's in kind of one of the vulnerable areas. Thanks much. TOM FRIEDEN: Dr. Kuehnert? DR. KUEHNERT: Sure, I can take that question. Thank you. Currently, the test is only being used in the continental U.S. by Gulf Coast Regional Blood Center in Houston. They put out a press release that they were doing so and started testing on May 23rd. As I mentioned in my comments, they've tested over 9,000 donations with no positives to date. Gulf Coast area of collection is in east Texas, including Harris County and the Houston area. There are other blood centers who are also planning to start screening, even though there's no active transmission of Zika in the continental U.S. They’re getting prepared, and so the blood centers are in those higher risk areas that you're probably thinking about in Texas and Gulf Coast states and Florida. Thanks. LISA SCHNIRRING: Thank you. TOM FRIEDEN: I’d add that other blood centers are also considering adding screening in the coming days and weeks. OPERATOR: Our next question comes from Lena Sun with the "The Washington Post." LENA SUN: Thank you. Two of my questions were already answered, but I do have a follow-up to this last one. So how many other blood centers are we talking about that might be -- that are considering adding screening in the coming days and weeks? TOM FRIEDEN: Dr. Kuehnert? DR. KUEHNERT: There's not really a list. There’s no requirement to test at this time with laboratory screening. As I mentioned, all the blood centers in the United States already do screening through deferrals through travel and deferrals, so the blood supply is being made safe through that. As I mentioned, there are some centers who, on their own, have selectively decided to consider testing. That’s a decision of theirs and they have not made that public. LENA SUN: So it's not a requirement by the government, right? DR. KUEHNERT: That's correct. TOM FRIEDEN: That's correct. And I would just reiterate the FDA did advise and all blood centers have been deferring donations from people who have traveled to Zika-affected areas, so we wouldn't expect to see positives at this point or a risk to the blood supply. LENA SUN: Okay, thank you. OPERATOR: Thank you, our next question comes from Julie Steenhuysen from Reuters. JULIE STEENHUYSEN: Hi. Good morning. Two questions. The test that is being used in Puerto Rico and the lab in the United States, is that the Roche test that the FDA approved for use in March? And if I’m right, if it is the Roche test, wasn't that only approved for areas with active mosquito-borne transmission? How is it that it could be used in Florida? Can you sort that out for me, please? TOM FRIEDEN: It is the Roche test in Puerto Rico, and Dr. Kuehnert will answer the test that's being used in Texas right now. Dr. Kuehnert? DR. KUEHNERT: The test is being used in Texas currently, not in Florida. It’s through an investigational new drug application that FDA authorized. Although the recommendation by FDA is that the test be used as an option in Zika areas where there is active transmission of Zika, there is an option for blood centers anywhere to use it. I also wanted to just step back a bit about Puerto Rico and the blood supply, that initially when the threat of Zika first emerged, that FDA put out recommendations to say that in an area of active transmission, that blood centers should either use pathogen-reduced blood through a pathogen reduction technology which is only FDA approved for – it freezes platelets and plasma, to use a screening test, or to outsource the blood. Until the Roche test was available, the option was only to outsource blood because there's very -- most blood transfused are red cells which is not FDA-approved for pathogen reduction technology. Until the Roche test was available, that's what occurred. On April 3rd, the test became available. To answer your question, again, if a blood center elects to test using the Roche assay, they are free to do so. JULIE STEENHUYSEN: I have one follow-up. You’re talking about for the rest of the centers basically are using deferral which counts on people who have traveled to a Zika-affected area being honest, right? Is there any risk, and has that been considered? DR. KUHNERT: There’s always a risk of a blood donor not answering a question accurately, either intentionally or unintentionally. However, the risk is quite low. There is always a risk with blood collection, whether you're talking about Zika or you're talking about HIV. There is risk, but it's very, very low. TOM FRIEDEN: Just to clarify, the very, very low there is in the 1 per -- matt, would you say millions for some of the rare infections? As with any product or medication, we always balance the anticipated risks against the anticipated benefits. For many conditions of blood transfusion it can be lifesaving or crucially important. KATHY HARBEN: Next question, please? OPERATOR: thank you. Our next question comes from Sandee Lamotte from CNN. SANDEE LAMOTTE: Hi there. Thanks for taking my question. Dr. Kuehnert, when it comes to the blood screening, talk to me about the aspect of blood not being actually positive for the Zika, is that a problem or not? DR. KUEHNERT: I think what you're asking about is a false negative. So in other words, Zika virus being there and it not being detected. As Dr. Frieden mentioned and I reiterated, this test is very, very sensitive. So this gets to the sensitivity of the test. The analyses that have been done have shown that the test detects even a few copies of virus per milliliter of blood. So it is very unlikely that a donor with Zika infection is going to be missed through screening. It is possible. It’s very, very early in the infection and there's very few viral copies in the blood stream but very unlikely. SANDEE LAMOTTE: Thank you. A follow-up. Is there additional cost for these blood centers in Houston and other places to do this extra testing? DR. KUHNERT: Under the FDA authorized IND, there is a charge of cost recovery for the test. I defer to Roche, I think, on what that amount is or the blood centers to fill you in. But it's a few dollars per unit. SANDEE LAMOTTE: thank you. Dr. Frieden, you mentioned earlier that you're very careful to determine that the donor population in Puerto Rico is not indicative of the general population. Talk to us again about why you are doing this generalizing to the various -- the general population and your worry about the numbers of pregnant women that will be infected. TOM FRIEDEN: we do believe, based on what has happened with other viruses that the blood donor population gives us our most real-time leading indicator of what is happening with infections in the population as a whole. Even though it's not a random sample or a systematic sample, it's a large number of people being tested from all walks of life. It’s geographically clustered in some places where people come in to donate blood. In the prior introduced virus Chikungunya, we were able to correlate quite closely what happened with blood donors with what was happening in community surveys of prevalence more generally. Strictly speaking, it is not a serosurvey but it serves that purpose to a significant extent. TOM FRIEDEN: let's go to the next question, please. OPERATOR: Our next question comes from Dan Vergano from Buzzfeed news. DAN VERGANO: I was wondering if you can follow up on that a little bit. How does this pattern of infection match Chikungunya in the past? Where would you expect to top out in past outbreaks of mosquito-borne virus? If it's 2 percent of the population weekly infected, in 50 weeks you have the entire population having suffered an infection. How does that actually play out? TOM FRIEDEN: We don't have a crystal ball, as I said, and we can't predict what will happen. with Chikungunya, about a quarter of the population became infected in less than the first year after introduction of the virus, and that these blood results suggest a similar level of infection, but that depends on what happens in the coming months and what can be done to both control the virus and protect pregnant women from infections. The difference here, and it's very important to emphasize that the priority in Zika is to protect pregnant women. In Chikungunya, you have an infection that's very painful, that's very apparent, where most people have symptoms, so that appears very differently to people in a community where it's spreading broadly. Here the risk is a risk somewhere between a few months and nine months from now when women who are pregnant and become infected with Zika deliver babies who might be affected by microcephaly or might have a more subtle but also problematic birth defect. So the numbers here are consistent with what happened with prior infections that spread widely through Puerto Rico. Only time will tell for sure, but it's certainly very concerning because of the risk to pregnant women. DAN VERGANO: If I can follow up, can we assume that the 1.1 percent who are testing positive are people with mild or no symptoms at all and somebody with obvious symptoms would have been screened out of this test prior to donating blood? TOM FRIEDEN: Yes, that's exactly right. These are people who didn't have any symptoms or didn't yet have any symptoms when they were screened. DAN VERGANO: Thank you. OPERATOR: Thank you, our next question comes from Meg Tirrell with CNBC. MEG TIRRELL: Hi guys. I’m wondering if you can help us understand the difference between this Roche test specifically for the blood supply and the quest diagnostics test that approved by the FDA for emergency use for patients who might have Zika. Help us understand why one would be used for one situation and not the other. TOM FRIEDEN: I’ll start and then Dr. Kuehnert may want to amplify. The Roche test is highly sensitive so it's going to find even tiny amounts of virus in the blood. In the test that's done in the CDC Trioplex PCR that is provided to state and local health departments that tests for not only Zika but also Dengue and Chikungunya and the quest test which tests just for Zika are less sensitive tests. They appear to work better on urine, at least the CDC test, than blood, where the number of viral copies may be higher. They’re used for individual patient diagnosis as opposed to a screening test for the blood supply. Dr. Kuehnert? DR. KUEHNERT: Just to clarify the question did you say the quest diagnostic test? Is that an antibody test? TOM FRIEDEN: Quest has a PCR approved by FDA for Zika. So it was comparing the Roche test with the quest test. The bottom line is Roche is for the blood supply, Quest is for patients who have symptoms or are concerned that they may have been infected in the past week or two. DR. KUEHNERT: I don't have anything to add to that, thank you. MEG TIRRELL: If I can follow up quickly. I understand that they are approved for different things, but I don't understand just why you wouldn't use the super sensitive Roche test in patients. Is it more expensive? Would it turn up more than you need to? I’m just confused by that. TOM FRIEDEN: I think what we're doing now is looking at all ways to optimize the tests that are out there. Some of it involves how much blood is drawn and how the tests are done, but the fact that the Roche test is so sensitive is something that we're looking at closely to see if we can tune the CDC assay to make it more sensitive. For the time being for the CDC assay, which has already been sent to more than a hundred labs around the U.S. and nearly a hundred countries around the world, what we have found is that the urine test is much more accurate, much more sensitive, than the blood test, that the likelihood of getting a positive in people who are infected in those first two weeks is very high if urine is obtained. So we've been informing physicians and those ordering the test and drawing the test to get both blood and urine because the urine will often be positive for individual clinical diagnoses not related to the blood supply and we're also looking at enhancements in the test to try to increase its accuracy and sensitivity. MEG TIRRELL: Thanks. OPERATOR: thank you. Our next question comes from Maggie Fox from NBC news. MAGGIE FOX: Thanks very much. I’m sorry if I’m repeating a question that's been asked already, but can you talk about how much this tells you about the percentage of people who have symptoms versus the percentage who don't have symptoms from Zika? Thanks. TOM FRIEDEN: This is not able to give us information on that question. The information from the past seems to be that about four out of five people with Zika have no symptoms. Confirming that in the present is quite challenging because there's no simple way to do it. But we do know from the data that came out earlier this week definitively that even women who don't have symptoms of Zika can give birth to infants with microcephaly. MAGGIE FOX: Can I just follow up and ask you, is there any way that you're going to be able to follow up on that show and find out the percentage of symptomatic versus asymptomatic people? Thanks. TOM FRIEDEN: That's something we will consider in the future. Right now our priority is to protect pregnant women, reducing risk in every way possible. DR. KUEHNERT: Could I add something? For blood donors, there is follow-up in order to measure the accuracy of the test with laboratory testing. Also, there will be a study plan to follow up the donors, and that will include a symptom questionnaire, both for symptoms that developed after donation. In addition, just routinely donors are asked to call the blood center back if they develop symptoms, so there's that data as well. MAGGIE FOX: Thanks. OPERATOR: As a reminder, anyone wishing to ask a question or make a comment, please press star followed by one on the key pad of your telephone and record your name at the prompt. And our next question comes from Meghan Rosen with Science News. MEGHAN ROSEN: Hello. Thank you for taking my question. I just wanted to know if the Roche test was PCR based and if not how does it work? TOM FRIEDEN: Yes, it is PCR based. MEGHAN ROSEN: Thank you. TOM FRIEDEN: I think we have time if there are one or two more questions, we have time for one or two more and then we'll wrap up. OPERATOR: Our next question comes from Mike Stobbe with the Associated Press. MIKE STOBBE: Thanks for hearing me again. Yesterday, the CDC released for the first time information about pregnancy outcomes in pregnant women who had been infected in the 50 states and the District of Columbia. There wasn't such information for the territories. Since we're talking here about what's anticipated in Puerto Rico, could you share with us what's been seen so far. How many pregnancies, what outcome data do you have on those? And if I may, I also wanted to ask you could you say anything else about how you think this would play out in the mainland USA if mosquito transmission and outbreaks occur, what would be the operating procedure for blood donations when that first happens in Florida or Texas or wherever an outbreak occurs? TOM FRIEDEN: First, I believe we hope to begin reporting information on pregnancy outcomes in territories starting next week. It’s a weekly report. It just is not ready for the territories for this week. I would emphasize that we don't anticipate seeing the majority of the outcomes yet because the infections are relatively recent. So between infection and pregnancy outcome, there's obviously a delay, particularly if, as we believe the highest risk of microcephaly is in the first trimester. In terms of blood screening in the continental U.S., I’ll ask Dr. Kuehnert to address that. DR. KUHNERT: Yes, thank you for the question. There is a comprehensive plan for state and local health departments to communicate with blood centers about areas of active transmission in their localities. The FDA recommendations point to the CDC website where such information will be posted so that all blood banks can work through deferrals and laboratory screening to make the blood supply safe. For the converse, if blood centers choose to test and they have a positive, they're instructed to inform the state and local health department immediately, and we will also be notified. In summary, there is a plan for blood safety if there's local transmission in the continental United States and Hawaii. KATHY HARBEN: Next question? OPERATOR: our next question comes from Marc Santora with the "New York Times." MARC SANTORA: Hi. On the subject of testing broadly, I was just wondering how much progress there is in having a commercial test available for the antibody test which it would seems to me would make it a lot easier to make testing of pregnant women a part of routine care. TOM FRIEDEN: thanks. We’re making progress there on a few different fronts. There are several companies that are pursuing emergency licensure of new tests for IGM. That’s the antibody test. In addition, CDC laboratory experts have established a way of producing large numbers of the IGM product using particles. This is a way of producing large batches safely, and we're now working with the FDA to get those approved. We’re in the process of -- in discussions I should say with many of the private labs to offer this test as a technology transfer in the coming weeks. So we hope that within several weeks to a month or two it will be becoming available in the private sector in addition to the current availability in the public sector through public health laboratories. I would highlight the fact that the testing we have for Zika is helpful but it's not perfect. We can't always distinguish Zika from other infections in people who have lived in areas where dengue and other related viruses are present. We don't have a way of reliably diagnosing infection that occurred two months or more previously so these are some of the things that are needed in terms of technological advancements. But in terms of the operational details of getting testing more widely available, we've been able to make a million tests at CDC. We’ve provided them to public health labs throughout the U.S. and the country and the world rather, and we're working to transfer them to private sector laboratories to increase availability throughout the healthcare system. KATHY HARBEN: I think we have time for one question if there is one. OPERATOR: Thank you. Our next question comes from Akshay Ganju with ABC News medical unit. AKSHAY GANJU thanks for taking my question. i was just quickly hoping you could repeat the total number of positives that you had seen in your blood testing in Puerto Rico. TOM FRIEDEN: In Puerto Rico, a total of 68 positives have been seen with the highest percentage in the most recent week of June 5th to 11th. If you look at the MMWR report itself, you can see the graphic showing a steady increase since late April in the proportion positive. This again is a point in time of virus in blood. The concern here is when we translate that into an exposure over multiple months it is many times that 1 percent rate. That’s why we're so concerned about pregnant women and protecting pregnant women. I’ll just close here with reiterating the bottom line, that the blood supply is being tested in Puerto Rico. Blood donors are being screened in the U.S. Any positive blood samples are removed from the system, so we don't think there's a risk to the blood supply, but it does, we believe, reflect an increase in Zika in Puerto Rico, and this could mean thousands of pregnant women in Puerto Rico infected, and that in turn could lead to dozens to hundreds of affected babies born in Puerto Rico in the coming year. We’re working very intensively with our health department, government and community colleagues in Puerto Rico to provide services for pregnant women to reduce their chances of getting infected and to control mosquitos. This takes a whole community, and although we know we can't make the risk zero, we can reduce it some by 10 or 30 or 50 percent, every infant with microcephaly that doesn't occur, is a tragedy prevented. We’re doing everything we can to reduce the risk of that outcome. Our priority remains to protect pregnant women because we don't want a few months from now when babies are born with birth defects that we look back and say there's more we wish we had done now. Thank you very much. I’ll now turn it over to Kathy Harben to close the call. KATHY HARBEN. Thank you, everyone, for joining us. This includes today's telebriefing. A transcript of this call will be posted to the CDC newsroom website as soon as possible. If you need additional information or have other questions, you can call the CDC press office at 404-639-3286. or e-mail us at [email protected]. OPERATOR: this concludes the CDC conference. Thank you so much for joining. You may disconnect at this time. ### U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES File Formats Help:How do I view different file formats (PDF, DOC, PPT, MPEG) on this site?Audio/Video filePage last reviewed: June 17, 2016Page last updated: June 17, 2016http://www.cdc.gov/media/releases/2016/t0617-zika.html
  9. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX027336.1|Yellow fever virus isolate CIC4, complete genome1846518465100%0.0100%KX027336.1Select seq gb|KX010995.1|Yellow fever virus isolate CIC2, complete genome1833018330100%0.099%KX010995.1Select seq gb|KX010996.1|Yellow fever virus isolate CIC3, complete genome1831418314100%0.099%KX010996.1Select seq gb|KX010994.1|Yellow fever virus isolate CIC1, complete genome1800618006100%0.099%KX010994.1Select seq gb|AY968064.1|Yellow fever virus strain Angola71, complete genome1768517685100%0.098%AY968064.1Select seq gb|DQ235229.1|Yellow fever virus strain Couma, complete genome1133511335100%0.085%DQ235229.1Select seq gb|AY968065.1|Yellow fever virus strain Uganda48a, complete genome1133511335100%0.085%AY968065.1Select seq gb|JN620362.1|Yellow fever virus strain Uganda 2010, complete genome1127911279100%0.084%JN620362.1Select seq gb|JF912185.1|Yellow fever virus strain BeAR513008, complete genome87658765100%0.079%JF912185.1Select seq gb|JF912179.1|Yellow fever virus strain BeAR378600, complete genome87638763100%0.079%JF912179.1Select seq gb|AY603338.1|Yellow fever virus strain Ivory Coast 1999, complete genome87608760100%0.079%AY603338.1Select seq gb|AY572535.1|Yellow fever virus strain Gambia 2001, complete genome87428742100%0.079%AY572535.1Select seq gb|JX898875.1|Yellow fever virus isolate ArD149815 from Senegal, complete genome87358735100%0.079%JX898875.1Select seq gb|JX898873.1|Yellow fever virus isolate ArD149214 from Senegal, complete genome87358735100%0.079%JX898873.1Select seq gb|JX898874.1|Yellow fever virus isolate ArD149194 from Senegal, complete genome87318731100%0.079%JX898874.1Select seq gb|JF912186.1|Yellow fever virus strain BeH526722, complete genome87318731100%0.079%JF912186.1Select seq gb|JX898868.1|Yellow fever virus isolate HD117294 from Senegal, complete genome87278727100%0.079%JX898868.1Select seq gb|JF912184.1|Yellow fever virus strain BeH463676, complete genome87248724100%0.079%JF912184.1Select seq gb|JF912183.1|Yellow fever virus strain BeH423602, complete genome87168716100%0.079%JF912183.1Select seq gb|KM388817.1|Yellow fever virus strain 2A polyprotein gene, complete cds87118711100%0.079%KM388817.1Select seq gb|JX898880.1|Yellow fever virus isolate ArD181564 from Senegal, complete genome87048704100%0.079%JX898880.1Select seq gb|KM388816.1|Yellow fever virus strain 10A polyprotein gene, complete cds87028702100%0.079%KM388816.1Select seq gb|JX898878.1|Yellow fever virus isolate ArD181250 from Senegal, complete genome87028702100%0.079%JX898878.1Select seq gb|JX898877.1|Yellow fever virus isolate ArD181464 from Senegal, complete genome87028702100%0.079%JX898877.1Select seq gb|JX898870.1|Yellow fever virus isolate ArD121040 from Senegal, complete genome86978697100%0.079%JX898870.1Select seq gb|JF912187.1|Yellow fever virus strain BeH622205, complete genome86938693100%0.079%JF912187.1Select seq gb|JF912188.1|Yellow fever virus strain BeH622493, complete genome86898689100%0.079%JF912188.1Select seq gb|JX898876.1|Yellow fever virus isolate ArD156468 from Senegal, complete genome86848684100%0.079%JX898876.1Select seq gb|JF912180.1|Yellow fever virus strain BeH394880, complete genome86808680100%0.079%JF912180.1Select seq gb|JF912189.1|Yellow fever virus strain BeAR646536, complete genome86538653100%0.079%JF912189.1Select seq gb|JF912182.1|Yellow fever virus strain BeH422973, complete genome86538653100%0.079%JF912182.1Select seq gb|JF912190.1|Yellow fever virus strain BeH655417, complete genome86488648100%0.079%JF912190.1Select seq gb|AY640589.1|Yellow fever virus strain ASIBI, complete genome86438643100%0.079%AY640589.1Select seq gb|HM582851.1|Yellow fever virus strain TVP11767 polyprotein gene, complete cds86398639100%0.079%HM582851.1Select seq gb|KF769016.1|Yellow fever virus strain Asibi, complete genome86378637100%0.079%KF769016.1Select seq gb|JX898869.1|Yellow fever virus isolate DakArAmt7 from Cote d'Ivoire, complete genome86348634100%0.079%JX898869.1Select seq gb|KM388815.1|Yellow fever virus strain 9A polyprotein gene, complete cds86308630100%0.079%KM388815.1Select seq gb|KM388814.1|Yellow fever virus strain 6A polyprotein gene, complete cds86308630100%0.079%KM388814.1Select seq gb|KM388818.1|Yellow fever virus strain 8A polyprotein gene, complete cds85888588100%0.079%KM388818.1Select seq gb|U21056.1|YFU21056Yellow fever virus French viscerotropic strain, complete genome85708570100%0.079%U21056.1Select seq gb|KF907504.1|Yellow fever virus strain 88/1999, complete genome85638563100%0.079%KF907504.1Select seq gb|JX898872.1|Yellow fever virus isolate ArD114972 from Senegal, complete genome85458545100%0.079%JX898872.1Select seq gb|JX898871.1|Yellow fever virus isolate ArD114896 from Senegal, complete genome85388538100%0.079%JX898871.1Select seq gb|DQ100292.1|Yellow fever virus strain 17DD-Brazil, complete genome85348534100%0.079%DQ100292.1Select seq gb|U21055.1|YFU21055Yellow fever virus French neurotropic strain, complete genome85258525100%0.078%U21055.1Select seq gb|U17066.1|YFU17066Yellow fever virus vaccine strain 17DD, complete genome85168516100%0.078%U17066.1Select seq gb|GQ379162.1|Yellow fever virus strain case #1, complete genome85148514100%0.078%GQ379162.1Select seq emb|X03700.1|Yellow fever virus complete genome, 17D vaccine strain85118511100%0.078%X03700.1Select seq gb|KF769015.1|Yellow fever virus strain 17D-204, complete genome85078507100%0.078%KF769015.1Select seq gb|JN811143.1|Yellow fever virus 17D YF-VAX Vero adapted Series C P11, complete genome85078507100%0.078%JN811143.1Select seq gb|JX503529.1|Yellow fever virus strain YF/Vaccine/USA/Sanofi-Pasteur-17D-204/UF795AA/YFVax, complete genome85078507100%0.078%JX503529.1Select seq gb|JN628279.1|Yellow fever virus strain 17D RKI, complete genome85078507100%0.078%JN628279.1Select seq gb|AF052444.1|AF052444Yellow fever virus clone HONG8 polyprotein gene, complete cds85078507100%0.078%AF052444.1Select seq gb|JX949181.1|Yellow fever virus strain 17D polyprotein gene, complete cds85028502100%0.078%JX949181.1Select seq gb|GQ379163.1|Yellow fever virus strain case #2, complete genome85028502100%0.078%GQ379163.1Select seq gb|FJ654700.1|Yellow fever virus 17D/Tiantan, complete genome85028502100%0.078%FJ654700.1Select seq gb|DQ118157.1|Yellow fever virus isolate YF-AVD2791-93F/04 from Spain, complete genome85028502100%0.078%DQ118157.1Select seq emb|X15062.1|Yellow fever virus genomic RNA85028502100%0.078%X15062.1Select seq gb|AF052446.1|AF052446Yellow fever virus clone HONG10 polyprotein gene, complete cds85028502100%0.078%AF052446.1Select seq gb|AF052439.1|AF052439Yellow fever virus clone HONG3 polyprotein gene, complete cds85028502100%0.078%AF052439.1Select seq gb|AF052437.1|AF052437Yellow fever virus clone HONG1 polyprotein gene, complete cds85028502100%0.078%AF052437.1Select seq gb|U17067.1|YFU17067Yellow fever virus vaccine strain 17D-213, complete genome85028502100%0.078%U17067.1Select seq gb|JN811141.1|Yellow fever virus 17D YF-VAX Vero adapted Series A P11, complete genome84988498100%0.078%JN811141.1Select seq gb|AF052445.1|AF052445Yellow fever virus clone HONG9 polyprotein gene, complete cds84988498100%0.078%AF052445.1Select seq gb|AF052438.1|AF052438Yellow fever virus clone HONG2 polyprotein gene, complete cds84988498100%0.078%AF052438.1Select seq gb|JN811142.1|Yellow fever virus 17D YF-VAX Vero adapted Series B P11, complete genome84938493100%0.078%JN811142.1Select seq gb|U54798.1|YFU54798Yellow fever virus strain 85-82H Ivory Coast, complete genome84918491100%0.078%U54798.1Select seq gb|AF094612.1|AF094612Yellow fever virus strain Trinidad 79A isolate 788379, complete genome84328432100%0.078%AF094612.1Select seq gb|JF912181.1|Yellow fever virus strain BeH413820, complete genome83958395100%0.078%JF912181.1Select seq gb|DQ322634.1|YFV replicon vector FMDV-2A-def, complete sequence8210832597%0.078%DQ322634.1Select seq gb|DQ322633.1|YFV replicon vector capsid-def, complete sequence8210832597%0.078%DQ322633.1Select seq gb|DQ322635.1|YFV replicon vector prME-def, complete sequence6542687381%0.078%DQ322635.1Select seq dbj|D14458.1|YFVCMENSYellow fever virus prM gene for precursor polyprotein, partial cds3157315734%0.080%D14458.1Select seq gb|AF052443.1|AF052443Yellow fever virus clone HONG7 polyprotein gene, partial cds2241224126%0.078%AF052443.1Select seq gb|AF052441.1|AF052441Yellow fever virus clone HONG5 polyprotein gene, partial cds2237223726%0.078%AF052441.1Select seq gb|GU951804.1|Yellow fever virus strain BeAn 131 polyprotein gene, partial cds2224222426%0.078%GU951804.1Select seq gb|AH005112.2|Yellow fever virus strain Y5 polyprotein and nonstructural protein NS2A mRNAs, partial cds2143250927%0.080%AH005112.2Select seq gb|AY960140.1|Yellow fever virus strain ArB28153 polyprotein gene, partial cds2131213117%0.086%AY960140.1Select seq gb|DQ322638.1|VEEV replicon vector YFV-C2, complete sequence2120212022%0.080%DQ322638.1Select seq gb|AF052440.1|AF052440Yellow fever virus clone HONG4 polyprotein gene, partial cds2116211622%0.080%AF052440.1Select seq gb|L06480.1|YFVCAPSIDMYellow fever virus capsid protein, M protein, and envelope protein mRNAs2116211622%0.080%L06480.1Select seq gb|DQ322642.1|VEEV replicon vector YFV-C3opt, complete sequence1929192922%0.078%DQ322642.1Select seq gb|DQ322640.1|VEEV replicon vector YFV-C3opt-NS2mut, complete sequence1929192922%0.078%DQ322640.1Select seq gb|U23578.1|YFU23578Yellow fever virus isolate SE7445/Uganda/1964/Human envelope protein (E) mRNA, partial cds1822182214%0.087%U23578.1Select seq gb|U23577.1|YFU23577Yellow fever virus isolate M-112/Sudan/1940/Human envelope protein (E) mRNA, partial cds1813181314%0.087%U23577.1Select seq gb|AY839636.1|Yellow fever virus strain ETH2777/Ethiopia61 envelope protein gene, partial cds1801180114%0.087%AY839636.1Select seq gb|DQ068260.1|Yellow fever virus strain SSUD03-01 envelope protein gene, partial cds1786178614%0.087%DQ068260.1Select seq gb|DQ068264.1|Yellow fever virus strain SSUD03-05 envelope protein gene, partial cds1783178314%0.087%DQ068264.1Select seq gb|DQ068263.1|Yellow fever virus strain SSUD03-04 envelope protein gene, partial cds1783178314%0.087%DQ068263.1Select seq gb|DQ068262.1|Yellow fever virus strain SSUD03-03 envelope protein gene, partial cds1783178314%0.087%DQ068262.1Select seq gb|AY839634.1|Yellow fever virus strain HB1782/CAR86 envelope protein gene, partial cds1783178314%0.087%AY839634.1Select seq gb|U23573.1|YFU23573Yellow fever virus isolate DaHB1504/C. African Republic/1985/Human envelope protein (E) mRNA, partial cds1777177714%0.087%U23573.1Select seq gb|U23569.1|YFU23569Yellow fever virus isolate 7914/Kenya/1993/Human envelope protein (E) mRNA, partial cds1768176814%0.087%U23569.1Select seq gb|U23575.1|YFU23575Yellow fever virus isolate KE93-477/Kenya/1993/Mosquito envelope protein (E) mRNA, partial cds1764176414%0.086%U23575.1Select seq gb|U23571.1|YFU23571Yellow fever virus isolate ArB8883/C. African Republic/1977/Human envelope protein (E) mRNA, partial cds1764176414%0.086%U23571.1Select seq gb|U23576.1|YFU23576Yellow fever virus isolate Kouma/Ethiopia/1961/Human envelope protein (E) mRNA, partial cds1759175914%0.086%U23576.1Select seq gb|AY960138.1|Yellow fever virus strain ArA 20628 polyprotein gene, partial cds1737173717%0.081%AY960138.1Select seq gb|AY960137.1|Yellow fever virus strain Ara29436 polyprotein gene, partial cds1698169817%0.081%AY960137.1Select seq gb|AY960139.1|Yellow fever virus strain Ara6734 polyprotein gene, partial cds1680168017%0.081%AY960139.1Select seq gb|DQ859058.1|Wesselsbron virus strain SAH-177 99871-2 polyprotein gene, complete cds1543206376%0.067%DQ859058.1Select seq gb|EU707555.1|Wesselsbron virus strain SAH177, complete genome1537205276%0.067%EU707555.1Select seq gb|GU073158.1|Yellow fever virus strain Senegal/Ko/ARDX/2000 envelope glycoprotein (E) gene, partial cds1508150814%0.082%GU073158.1Select seq gb|GU073145.1|Yellow fever virus strain Senegal/Ke/ArD149213/2000 envelope glycoprotein (E) gene, partial cds1508150814%0.082%GU073145.1Select seq gb|GU073144.1|Yellow fever virus strain Senegal/Ke/ArD149194/2000 envelope glycoprotein (E) gene, partial cds1508150814%0.082%GU073144.1Select seq gb|GU073136.1|Yellow fever virus strain Mali/Ba/HA872/1987 envelope glycoprotein (E) gene, partial cds1508150814%0.082%GU073136.1Select seq gb|GU073166.1|Yellow fever virus strain Senegal/Ko/HD117294/1995 envelope glycoprotein (E) gene, partial cds1503150314%0.082%GU073166.1Select seq gb|GU073152.1|Yellow fever virus strain Senegal/Ke/ArD156468/2001 envelope glycoprotein (E) gene, partial cds1503150314%0.082%GU073152.1Select seq gb|GU073143.1|Yellow fever virus strain Senegal/Ke/ArD149179/2000 envelope glycoprotein (E) gene, partial cds1503150314%0.082%GU073143.1Select seq gb|GU073141.1|Yellow fever virus strain Senegal/Ke/AnD26923/1978 envelope glycoprotein (E) gene, partial cds1503150314%0.082%GU073141.1Select seq gb|GU073156.1|Yellow fever virus strain Senegal/Ke/ArD25112/1977 envelope glycoprotein (E) gene, partial cds1499149914%0.082%GU073156.1Select seq gb|GU073153.1|Yellow fever virus strain Senegal/Ke/ArD156583/2001 envelope glycoprotein (E) gene, partial cds1499149914%0.082%GU073153.1Select seq gb|GU073137.1|Yellow fever virus strain Mali/Sa/ArA20267/1987 envelope glycoprotein (E) gene, partial cds1494149414%0.082%GU073137.1Select seq gb|GU073135.1|Yellow fever virus strain Gambia/MK/ArD27797/1979 envelope glycoprotein (E) gene, partial cds1494149414%0.082%GU073135.1Select seq gb|GU073149.1|Yellow fever virus strain Senegal/Ke/ArD149815/2000 envelope glycoprotein (E) gene, partial cds1481148114%0.082%GU073149.1Select seq gb|GU073163.1|Yellow fever virus strain Senegal/Ko/ArD114987/1995 envelope glycoprotein (E) gene, partial cds1476147614%0.082%GU073163.1Select seq gb|AY502949.1|Yellow fever virus strain Guinea/2000/human envelope protein (env) gene, partial cds1476147614%0.082%AY502949.1Select seq gb|GU073161.1|Yellow fever virus strain Senegal/Ko/ArD114970/1995 envelope glycoprotein (E) gene, partial cds1472147214%0.081%GU073161.1Select seq gb|GU073159.1|Yellow fever virus strain Senegal/Ko/ArD114891/1995 envelope glycoprotein (E) gene, partial cds1472147214%0.082%GU073159.1Select seq gb|GU073148.1|Yellow fever virus strain Senegal/Ke/ArD149791/2000 envelope glycoprotein (E) gene, partial cds1472147214%0.081%GU073148.1Select seq gb|GU073140.1|Yellow fever virus strain Senegal/Ka/HD122030/1996 envelope glycoprotein (E) gene, partial cds1472147214%0.082%GU073140.1Select seq gb|GU073142.1|Yellow fever virus strain Senegal/Ke/ArD121040/1996 envelope glycoprotein (E) gene, partial cds1467146714%0.082%GU073142.1Select seq gb|GU073146.1|Yellow fever virus strain Senegal/Ke/ArD149214/2000 envelope glycoprotein (E) gene, partial cds1463146314%0.082%GU073146.1Select seq gb|GU073160.1|Yellow fever virus strain Senegal/Ko/ArD114896/1995 envelope glycoprotein (E) gene, partial cds1456145614%0.082%GU073160.1Select seq gb|AY495561.1|Yellow fever virus isolate DNA-YF-4 protein E gene, partial cds1456145615%0.081%AY495561.1Select seq gb|GU073164.1|Yellow fever virus strain Senegal/Ko/ArD114988/1995 envelope glycoprotein (E) gene, partial cds1454145414%0.082%GU073164.1Select seq gb|GU073131.1|Yellow fever virus strain Cameroon/HD78359/1990 envelope glycoprotein (E) gene, partial cds1454145414%0.081%GU073131.1Select seq gb|AY359908.2|Yellow fever virus isolate DNA-YF-2 protein E gene, partial cds1454145415%0.081%AY359908.2Select seq gb|GU073157.1|Yellow fever virus strain Senegal/Ke/ArD99740/1993 envelope glycoprotein (E) gene, partial cds1451145114%0.082%GU073157.1Select seq gb|GU073147.1|Yellow fever virus strain Senegal/Ke/ArD149215/2000 envelope glycoprotein (E) gene, partial cds1449144914%0.082%GU073147.1Select seq gb|U23574.1|YFU23574Yellow fever virus isolate Dar1279/Senegal/1965/Human envelope protein (E) mRNA, partial cds1449144914%0.082%U23574.1Select seq gb|L02865.1|YFVENVAYellow fever virus wild-type envelope protein (env)1449144914%0.082%L02865.1Select seq gb|AY495567.1|Yellow fever virus vaccine flavimun experimental lot 3000129 protein E gene, partial cds1447144715%0.081%AY495567.1Select seq gb|GU073130.1|Yellow fever virus strain CAR/Bo/ArB5656/1974 envelope glycoprotein (E) gene, partial cds1445144514%0.081%GU073130.1Select seq gb|AY495571.1|Yellow fever virus vaccine flavimun experimental lot 3000131 protein E gene, partial cds1445144515%0.081%AY495571.1Select seq gb|AY359909.1|Yellow fever virus isolate DNA-YF-3 protein E gene, partial cds1445144515%0.081%AY359909.1Select seq gb|GU073139.1|Yellow fever virus strain Senegal/Ka/ArD122522/1996 envelope glycoprotein (E) gene, partial cds1443144314%0.082%GU073139.1Select seq gb|AY359907.1|Yellow fever virus isolate DNA-YF-1 protein E gene, partial cds1442144214%0.081%AY359907.1Select seq gb|AY839635.1|Yellow fever virus strain ArD76320/Senegal90 envelope protein gene, partial cds1440144014%0.082%AY839635.1Select seq gb|L02866.1|YFVENVBYellow fever virus envelope protein (env)1440144014%0.082%L02866.1Select seq gb|GU073133.1|Yellow fever virus strain CotedIvoire/SS/ARM154/1995 envelope glycoprotein (E) gene, partial cds1438143814%0.081%GU073133.1Select seq gb|AY495558.1|Yellow fever virus isolate DNA-YF-1 protein E gene, partial cds1438143815%0.081%AY495558.1Select seq gb|GU073162.1|Yellow fever virus strain Senegal/Ko/ArD114972/1995 envelope glycoprotein (E) gene, partial cds1436143614%0.082%GU073162.1Select seq gb|GU073150.1|Yellow fever virus strain Senegal/Ke/ArD149887/2000 envelope glycoprotein (E) gene, partial cds1436143614%0.082%GU073150.1Select seq gb|AY632543.1|Sepik virus polyprotein gene, complete cds1436183276%0.066%AY632543.1Select seq gb|AY495569.1|Yellow fever virus vaccine flavimun experimental lot 3000130 protein E gene, partial cds1436143614%0.081%AY495569.1Select seq gb|AY495566.1|Yellow fever virus isolate DNA-YF-7 protein E gene, partial cds1434143415%0.081%AY495566.1Select seq gb|AY495562.1|Yellow fever virus isolate DNA-YF-4 protein E gene, partial cds1434143415%0.081%AY495562.1Select seq gb|AY495559.1|Yellow fever virus isolate DNA-YF-2 protein E gene, partial cds1434143414%0.081%AY495559.1Select seq gb|GU073132.1|Yellow fever virus strain CotedIvoire/De/ArA523/1996 envelope glycoprotein (E) gene, partial cds1431143114%0.082%GU073132.1Select seq gb|DQ859063.1|Sepik virus strain 7148 polyprotein gene, complete cds1431182776%0.066%DQ859063.1Select seq gb|JN226796.1|Wesselsbron virus from South Africa, complete genome1424186575%0.066%JN226796.1Select seq gb|DQ837642.1|Sepik virus strain MK7148, complete genome1422181876%0.066%DQ837642.1Select seq gb|U23580.1|YFU23580Yellow fever virus isolate V-528A/Colombia/1979/Mosquito envelope protein (E) mRNA, partial cds1416141614%0.081%U23580.1Select seq gb|GU073165.1|Yellow fever virus strain Senegal/Ko/ArD114989/1995 envelope glycoprotein (E) gene, partial cds1413141314%0.082%GU073165.1Select seq gb|AY495573.1|Yellow fever virus reference stock RKI-17D-112/95 protein E gene, partial cds1411141114%0.081%AY495573.1Select seq gb|AY495570.1|Yellow fever virus vaccine flavimun experimental lot 3000130 protein E gene, partial cds1407140714%0.081%AY495570.1Select seq gb|U23570.1|YFU23570Yellow fever virus isolate AR350397/Brazil/1979/Mosquito envelope protein (E) mRNA, partial cds1407140714%0.081%U23570.1Select seq gb|AY495572.1|Yellow fever virus vaccine flavimun experimental lot 3000131 protein E gene, partial cds1404140414%0.081%AY495572.1Select seq gb|AY495568.1|Yellow fever virus vaccine flavimun experimental lot 3000129 protein E gene, partial cds1404140414%0.081%AY495568.1Select seq gb|U23579.1|YFU23579Yellow fever virus isolate T790882/Trinidad/1979/Mosquito envelope protein (E) mRNA, partial cds1398139814%0.081%U23579.1Select seq gb|U23568.1|YFU23568Yellow fever virus isolate 788379/Trinidad/1979/Mosquito envelope protein (E) mRNA, partial cds1398139814%0.081%U23568.1Select seq gb|GU073134.1|Yellow fever virus strain CotedIvoire/To/DakArAmt7/1973 envelope glycoprotein (E) gene, partial cds1395139513%0.082%GU073134.1Select seq gb|U23572.1|YFU23572Yellow fever virus isolate BA-55/Nigeria/1986/Human envelope protein (E) mRNA, partial cds1395139514%0.081%U23572.1Select seq gb|AY495574.1|Yellow fever virus reference stock RKI-17D-112/95 protein E gene, partial cds1388138814%0.081%AY495574.1Select seq gb|GU073151.1|Yellow fever virus strain Senegal/Ke/ArD156029/2001 envelope glycoprotein (E) gene, partial cds1386138613%0.082%GU073151.1Select seq gb|U23567.1|YFU23567Yellow fever virus isolate 56205/Nigeria/1991/Human envelope protein (E) mRNA, partial cds1386138614%0.081%U23567.1Select seq gb|U23566.1|YFU23566Yellow fever virus isolate 1914-81/Ecuador/1981/Human envelope protein (E) mRNA, partial cds1380138014%0.081%U23566.1Select seq gb|U23565.1|YFU23565Yellow fever virus isolate 1362/Peru/1977/Human envelope protein (E) mRNA, partial cds1380138014%0.081%U23565.1Select seq gb|GU073138.1|Yellow fever virus strain Mauritania/Ro/HD47471/1987 envelope glycoprotein (E) gene, partial cds1314131413%0.081%GU073138.1Select seq gb|U52422.1|YFU52422Yellow fever virus Uga48 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1279127911%0.084%U52422.1Select seq gb|U52392.1|YFU52392Yellow fever virus Car77(883) core, pre-membrane, membrane and envelope proteins mRNA, partial cds1267126711%0.083%U52392.1Select seq gb|DQ859067.1|Potiskum virus strain IBAN 10069 polyprotein gene, complete cds1213153563%0.066%DQ859067.1Select seq gb|DQ859062.1|Saboya virus strain Dak AR D4600 polyprotein gene, complete cds1155123767%0.065%DQ859062.1Select seq gb|AF369669.1|AF369669Yellow fever virus strain 14 FA polyprotein mRNA, partial cds115511556%0.098%AF369669.1Select seq gb|U52398.1|YFU52398Yellow fever virus Ecuador79 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1144114411%0.081%U52398.1Select seq gb|U52416.1|YFU52416Yellow fever virus Trinidad54 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1141114111%0.081%U52416.1Select seq gb|U52404.1|YFU52404Yellow fever virus Panama74 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1122112211%0.081%U52404.1Select seq gb|U52389.1|YFU52389Yellow fever virus Brazil35 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1117111711%0.081%U52389.1Select seq gb|U52403.1|YFU52403Yellow fever virus Nigeria46 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1108110811%0.080%U52403.1Select seq gb|U52410.1|YFU52410Yellow fever virus Peru95(153) core, pre-membrane, membrane and envelope proteins mRNA, partial cds1081108111%0.080%U52410.1Select seq gb|U52419.1|YFU52419Yellow fever virus Trinidad79 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1077107711%0.080%U52419.1Select seq gb|U52409.1|YFU52409Yellow fever virus Peru95(149) core, pre-membrane, membrane and envelope proteins mRNA, partial cds1068106811%0.080%U52409.1Select seq gb|U52413.1|YFU52413Yellow fever virus Senegal65 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1059105911%0.080%U52413.1Select seq gb|AF162449.1|AF162449Yellow fever virus isolate PER 1 envelope protein gene, partial cds9249249%0.080%AF162449.1Select seq gb|AF312554.1|AF312554Yellow fever virus glycoprotein E gene, partial cds9219219%0.080%AF312554.1Select seq gb|AF162451.1|AF162451Yellow fever virus isolate PER 3 envelope protein gene, partial cds9219219%0.080%AF162451.1Select seq gb|AF162452.1|AF162452Yellow fever virus isolate PER 4 envelope protein gene, partial cds9159159%0.080%AF162452.1Select seq gb|AF162450.1|AF162450Yellow fever virus isolate PER 2 envelope protein gene, partial cds9119119%0.080%AF162450.1Select seq gb|AF013417.1|AF013417Yellow fever virus strain TN-96 NS5 protein (NS5) gene, partial cds88488410%0.079%AF013417.1Select seq gb|U52424.1|YFU52424Yellow fever virus Uga48 non-structural protein 4A mRNA, partial cds8108107%0.084%U52424.1Select seq gb|AF369673.1|AF369673Yellow fever virus strain HB 1504 polyprotein mRNA, partial cds7807806%0.086%AF369673.1Select seq gb|DQ859057.1|Bouboui virus strain DAK AR B490 polyprotein gene, complete cds771157252%0.067%DQ859057.1Select seq gb|AF369697.1|AF369697Yellow fever virus strain LSF 4 polyprotein mRNA, partial cds7677676%0.085%AF369697.1Select seq gb|DQ859066.1|Jugra virus strain P-9-314 polyprotein gene, complete cds765134349%0.067%DQ859066.1Select seq gb|AF369692.1|AF369692Yellow fever virus strain M 90-5 polyprotein mRNA, partial cds7627626%0.085%AF369692.1Select seq gb|AF369696.1|AF369696Yellow fever virus strain Z 19039 polyprotein mRNA, partial cds7587586%0.085%AF369696.1Select seq gb|AF369695.1|AF369695Yellow fever virus strain SE 7445 polyprotein mRNA, partial cds7587586%0.085%AF369695.1Select seq gb|AF369676.1|AF369676Yellow fever virus strain BC 7914 polyprotein mRNA, partial cds7537536%0.085%AF369676.1Select seq gb|AY839631.1|Yellow fever virus strain HB1782/CAR86 polyprotein gene, partial cds7497496%0.085%AY839631.1Select seq gb|AF369694.1|AF369694Yellow fever virus strain A 709-4-A2 polyprotein mRNA, partial cds7447446%0.085%AF369694.1Select seq gb|AF369675.1|AF369675Yellow fever virus strain Couma polyprotein mRNA, partial cds7447446%0.085%AF369675.1Select seq gb|JX012100.1|Yellow fever virus isolate Ethiopia1966a polyprotein gene, partial cds7427426%0.085%JX012100.1Select seq gb|AF369674.1|AF369674Yellow fever virus strain Serie 227 polyprotein mRNA, partial cds7407406%0.084%AF369674.1Select seq gb|AF369672.1|AF369672Yellow fever virus strain ArB 17239 polyprotein mRNA, partial cds7407406%0.084%AF369672.1Select seq gb|JX012103.1|Yellow fever virus isolate Ethiopia1966d polyprotein gene, partial cds7387386%0.085%JX012103.1Select seq gb|U52394.1|YFU52394Yellow fever virus Car77(883) non-structural protein 4A mRNA, partial cds7387387%0.082%U52394.1Select seq gb|JX012097.1|Yellow fever virus isolate Sudan2003 polyprotein gene, partial cds7357356%0.085%JX012097.1Select seq gb|AY839633.1|Yellow fever virus strain ETH2777/Ethiopia61 polyprotein gene, partial cds7287286%0.084%AY839633.1Select seq gb|JX012099.1|Yellow fever virus isolate Ethiopia1961d polyprotein gene, partial cds7207206%0.085%JX012099.1Select seq gb|U52397.1|YFU52397Yellow fever virus Car77(900) non-structural protein 4A mRNA, partial cds7177177%0.082%U52397.1Select seq gb|JX012098.1|Yellow fever virus isolate Ethiopia1961c polyprotein gene, partial cds7157156%0.085%JX012098.1Select seq gb|AY540464.1|Yellow fever virus strain BeAr513008 polyprotein gene, partial cds7137136%0.084%AY540464.1Select seq gb|AY540477.1|Yellow fever virus strain 1345 polyprotein gene, partial cds7087086%0.083%AY540477.1Select seq gb|AY540467.1|Yellow fever virus strain BeAr513292 polyprotein gene, partial cds7087086%0.083%AY540467.1Select seq gb|AY540449.1|Yellow fever virus strain BeH203410 polyprotein gene, partial cds7087086%0.083%AY540449.1Select seq gb|AY540475.1|Yellow fever virus strain V528A polyprotein gene, partial cds7047046%0.083%AY540475.1Select seq gb|AY540473.1|Yellow fever virus strain "Tennessee" polyprotein gene, partial cds7047046%0.083%AY540473.1Select seq gb|AY540472.1|Yellow fever virus strain BeAr544276 polyprotein gene, partial cds7047046%0.083%AY540472.1Select seq gb|AY540466.1|Yellow fever virus strain BeAr513060 polyprotein gene, partial cds7047046%0.083%AY540466.1Select seq gb|AY540465.1|Yellow fever virus strain BeH512772 polyprotein gene, partial cds7047046%0.083%AY540465.1Select seq gb|AY540459.1|Yellow fever virus strain BeAr424083 polyprotein gene, partial cds7047046%0.083%AY540459.1Select seq gb|AY540455.1|Yellow fever virus strain BeH385780 polyprotein gene, partial cds7047046%0.083%AY540455.1Select seq gb|AY540452.1|Yellow fever virus strain BeAr233436 polyprotein gene, partial cds7047046%0.083%AY540452.1Select seq gb|AY540476.1|Yellow fever virus strain INS347613 polyprotein gene, partial cds6996996%0.083%AY540476.1Select seq gb|AY540470.1|Yellow fever virus strain BeAr527547 polyprotein gene, partial cds6996996%0.083%AY540470.1Select seq gb|AY540447.1|Yellow fever virus strain BeAr142658 polyprotein gene, partial cds6996996%0.083%AY540447.1Select seq gb|AY540436.1|Yellow fever virus strain BeAr628124 polyprotein gene, partial cds6956956%0.083%AY540436.1Select seq gb|DQ859056.1|Banzi virus strain SAH 336 polyprotein gene, complete cds695146963%0.066%DQ859056.1Select seq gb|DQ872411.1|Yellow fever virus strain GML902621 polyprotein gene, partial cds6956956%0.083%DQ872411.1Select seq gb|AY540481.1|Yellow fever virus strain CAREC797984 polyprotein gene, partial cds6956956%0.083%AY540481.1Select seq gb|AY540463.1|Yellow fever virus strain BeAr512943 polyprotein gene, partial cds6956956%0.083%AY540463.1Select seq gb|AY540462.1|Yellow fever virus strain BeAn510268 polyprotein gene, partial cds6956956%0.083%AY540462.1Select seq gb|AY540454.1|Yellow fever virus strain BeAr350397 polyprotein gene, partial cds6956956%0.083%AY540454.1Select seq gb|AY540453.1|Yellow fever virus strain BeH233393 polyprotein gene, partial cds6956956%0.083%AY540453.1Select seq gb|AY540450.1|Yellow fever virus strain BeAr233164 polyprotein gene, partial cds6956956%0.083%AY540450.1Select seq gb|AY540444.1|Yellow fever virus strain BeH107714 polyprotein gene, partial cds6956956%0.083%AY540444.1Select seq gb|L40951.1|FVVNS5PBanzi virus nonstructural protein 5 (NS5) gene, partial cds69369323%0.067%L40951.1Select seq gb|AY540485.1|Yellow fever virus strain CAREC891957 polyprotein gene, partial cds6906906%0.083%AY540485.1Select seq gb|AY540484.1|Yellow fever virus strain CAREC891954 polyprotein gene, partial cds6906906%0.083%AY540484.1Select seq gb|AY540483.1|Yellow fever virus strain CAREC890692 polyprotein gene, partial cds6906906%0.083%AY540483.1Select seq gb|AY540482.1|Yellow fever virus strain CAREC889920 polyprotein gene, partial cds6906906%0.083%AY540482.1Select seq gb|AY540480.1|Yellow fever virus strain Jimenez polyprotein gene, partial cds6906906%0.083%AY540480.1Select seq gb|AY540460.1|Yellow fever virus strain BeAr511437 polyprotein gene, partial cds6906906%0.083%AY540460.1Select seq gb|AY540441.1|Yellow fever virus strain BeAn23536 polyprotein gene, partial cds6906906%0.083%AY540441.1Select seq gb|AY437135.1|Yellow fever virus polyprotein gene, partial cds6886886%0.083%AY437135.1Select seq gb|AY540479.1|Yellow fever virus strain 614819 polyprotein gene, partial cds6866866%0.083%AY540479.1Select seq gb|AY540468.1|Yellow fever virus strain BeAr527785 polyprotein gene, partial cds6866866%0.083%AY540468.1Select seq gb|AY540458.1|Yellow fever virus strain BeH425381 polyprotein gene, partial cds6866866%0.083%AY540458.1Select seq gb|AY540443.1|Yellow fever virus strain BeAr44824 polyprotein gene, partial cds6866866%0.083%AY540443.1Select seq gb|AY540442.1|Yellow fever virus strain BeAr46299 polyprotein gene, partial cds6866866%0.083%AY540442.1Select seq gb|AY540488.1|Yellow fever virus strain PHO42H polyprotein gene, partial cds6816816%0.083%AY540488.1Select seq gb|AY540487.1|Yellow fever virus strain P128MC polyprotein gene, partial cds6816816%0.083%AY540487.1Select seq gb|AY540486.1|Yellow fever virus strain CAREC9515207 polyprotein gene, partial cds6816816%0.083%AY540486.1Select seq gb|AY540461.1|Yellow fever virus strain BeH511843 polyprotein gene, partial cds6816816%0.083%AY540461.1Select seq gb|AY540438.1|Yellow fever virus strain BeAN131 polyprotein gene, partial cds6816816%0.083%AY540438.1Select seq gb|FJ875520.1|Yellow fever virus strain SPAn289568 polyprotein gene, partial cds6776776%0.082%FJ875520.1Select seq gb|FJ875518.1|Yellow fever virus strain SPAn288183 polyprotein gene, partial cds6776776%0.082%FJ875518.1Select seq gb|AY540469.1|Yellow fever virus strain BeAr527198 polyprotein gene, partial cds6776776%0.082%AY540469.1Select seq gb|AY540440.1|Yellow fever virus strain BeAr189 polyprotein gene, partial cds6776776%0.082%AY540440.1Select seq gb|AY540439.1|Yellow fever virus strain BeAr162 polyprotein gene, partial cds6776776%0.082%AY540439.1Select seq gb|HM582843.1|Yellow fever virus strain BeH613582 polyprotein gene, partial cds6736736%0.083%HM582843.1Select seq gb|DQ859060.1|Edge Hill virus strain YMP 48 polyprotein gene, complete cds673142965%0.066%DQ859060.1Select seq gb|FJ875517.1|Yellow fever virus strain SPH258595 polyprotein gene, partial cds6726726%0.082%FJ875517.1Select seq gb|AY540456.1|Yellow fever virus strain BeH379501 polyprotein gene, partial cds6726726%0.082%AY540456.1Select seq gb|AY540437.1|Yellow fever virus strain BeH111 polyprotein gene, partial cds6726726%0.082%AY540437.1Select seq gb|HM582848.1|Yellow fever virus strain BeAr631464 polyprotein gene, partial cds6686686%0.083%HM582848.1Select seq gb|HM582839.1|Yellow fever virus strain TVP11646 polyprotein gene, partial cds6666666%0.083%HM582839.1Select seq gb|EU303239.1|Yellow fever virus note H203410 nonstructural protein 5 (NS5) gene, partial cds6636637%0.079%EU303239.1Select seq gb|HM582845.1|Yellow fever virus strain BeAr527785 polyprotein gene, partial cds6616616%0.082%HM582845.1Select seq gb|DQ859065.1|Uganda S virus polyprotein gene, complete cds661137965%0.066%DQ859065.1Select seq gb|AY540451.1|Yellow fever virus strain BeAn232869 polyprotein gene, partial cds6596596%0.082%AY540451.1Select seq gb|AY540434.1|Yellow fever virus strain OBS8026 polyprotein gene, partial cds6596596%0.082%AY540434.1Select seq gb|AY540490.1|Yellow fever virus strain 35708 polyprotein gene, partial cds6546546%0.082%AY540490.1Select seq gb|AY540474.1|Yellow fever virus strain INS382060 polyprotein gene, partial cds6546546%0.082%AY540474.1Select seq gb|AY161928.1|Yellow fever virus strain 1368 polyprotein gene, partial cds6526526%0.082%AY161928.1Select seq gb|HQ123568.1|Yellow fever virus strain PH71191 polyprotein gene, partial cds6506506%0.082%HQ123568.1Select seq gb|AY540445.1|Yellow fever virus strain BeAn142028 polyprotein gene, partial cds6456456%8e-18081%AY540445.1Select seq gb|AF369683.1|AF369683Yellow fever virus strain H117505 polyprotein mRNA, partial cds6456456%8e-18081%AF369683.1Select seq gb|AY540457.1|Yellow fever virus strain BeH413820 polyprotein gene, partial cds6416416%9e-17981%AY540457.1Select seq gb|AF369685.1|AF369685Yellow fever virus strain 56205 polyprotein mRNA, partial cds6416416%9e-17981%AF369685.1Select seq gb|AF369678.1|AF369678Yellow fever virus strain T. Adeoye polyprotein mRNA, partial cds6416416%9e-17981%AF369678.1Select seq gb|AY690831.1|Yellow fever virus strain SPU 160/03/23 polyprotein gene, partial cds6396395%3e-17885%AY690831.1Select seq gb|AY161951.1|Yellow fever virus strain OBS7904 polyprotein gene, partial cds6376376%1e-17781%AY161951.1Select seq gb|AY540433.1|Yellow fever virus strain OBS7937 polyprotein gene, partial cds6366366%4e-17781%AY540433.1Select seq gb|AY540431.1|Yellow fever virus strain OBS7687 polyprotein gene, partial cds6366366%4e-17781%AY540431.1Select seq gb|AF369682.1|AF369682Yellow fever virus strain H117491 polyprotein mRNA, partial cds6366366%4e-17781%AF369682.1Select seq gb|AF369680.1|AF369680Yellow fever virus strain M. Adejumo polyprotein mRNA, partial cds6366366%4e-17781%AF369680.1Select seq gb|AY161941.1|Yellow fever virus strain OBS2250 polyprotein gene, partial cds6326326%5e-17681%AY161941.1Select seq gb|AY161938.1|Yellow fever virus strain Cepa#2 polyprotein gene, partial cds6326326%5e-17681%AY161938.1Select seq gb|AY540432.1|Yellow fever virus strain OBS7549 polyprotein gene, partial cds6326326%5e-17681%AY540432.1Select seq gb|AF369681.1|AF369681Yellow fever virus strain A. Adeoye polyprotein mRNA, partial cds6326326%5e-17681%AF369681.1Select seq gb|AF369679.1|AF369679Yellow fever virus strain A. Jimo polyprotein mRNA, partial cds6326326%5e-17681%AF369679.1Select seq gb|KM388820.1|Yellow fever virus strain 3A polyprotein gene, partial cds6276276%2e-17481%KM388820.1Select seq gb|AY161948.1|Yellow fever virus strain 03535098 polyprotein gene, partial cds6276276%2e-17481%AY161948.1Select seq gb|AY161939.1|Yellow fever virus strain Cepa#1 polyprotein gene, partial cds6276276%2e-17481%AY161939.1Select seq gb|AY161934.1|Yellow fever virus strain ARVO544 polyprotein gene, partial cds6276276%2e-17481%AY161934.1Select seq gb|AY540478.1|Yellow fever virus strain OBS5041 polyprotein gene, partial cds6276276%2e-17481%AY540478.1Select seq gb|AF369684.1|AF369684Yellow fever virus strain BA 55 polyprotein mRNA, partial cds6276276%2e-17481%AF369684.1Select seq gb|AF369677.1|AF369677Yellow fever virus strain IB AR 45244 polyprotein mRNA, partial cds6276276%2e-17481%AF369677.1Select seq gb|HM582846.1|Yellow fever virus strain 15094 polyprotein gene, partial cds6216216%9e-17381%HM582846.1Select seq gb|AY161933.1|Yellow fever virus strain 1914 polyprotein gene, partial cds6196196%3e-17281%AY161933.1Select seq gb|AY161932.1|Yellow fever virus strain 1899/81 polyprotein gene, partial cds6196196%3e-17281%AY161932.1Select seq gb|DQ872412.1|Yellow fever virus strain CAREC788379 polyprotein gene, partial cds6186186%1e-17180%DQ872412.1Select seq gb|AY161947.1|Yellow fever virus strain OBS6530 polyprotein gene, partial cds6186186%1e-17181%AY161947.1Select seq gb|AY161945.1|Yellow fever virus strain OBS2243 polyprotein gene, partial cds6186186%1e-17181%AY161945.1Select seq gb|AY161944.1|Yellow fever virus strain HEB4246 polyprotein gene, partial cds6186186%1e-17181%AY161944.1Select seq gb|AY161936.1|Yellow fever virus strain HEB4236(153) polyprotein gene, partial cds6186186%1e-17181%AY161936.1Select seq gb|AF369689.1|AF369689Yellow fever virus strain SH 1339 polyprotein mRNA, partial cds6186186%1e-17180%AF369689.1Select seq gb|AF369688.1|AF369688Yellow fever virus strain SH 1464 polyprotein mRNA, partial cds6186186%1e-17180%AF369688.1Select seq gb|KM388819.1|Yellow fever virus strain 1A polyprotein gene, partial cds6166165%4e-17182%KM388819.1Select seq gb|AY161930.1|Yellow fever virus strain 287/78 polyprotein gene, partial cds6166166%4e-17180%AY161930.1Select seq gb|AY161940.1|Yellow fever virus strain OBS2240 polyprotein gene, partial cds6146146%1e-17080%AY161940.1Select seq gb|AY161937.1|Yellow fever virus strain 149 polyprotein gene, partial cds6146146%1e-17080%AY161937.1Select seq gb|AY161935.1|Yellow fever virus strain HEB4224 polyprotein gene, partial cds6146146%1e-17080%AY161935.1Select seq gb|AY161931.1|Yellow fever virus strain R35740 polyprotein gene, partial cds6146146%1e-17080%AY161931.1Select seq gb|AY540446.1|Yellow fever virus strain BeH141816 polyprotein gene, partial cds6146146%1e-17080%AY540446.1Select seq gb|AF369671.1|AF369671Yellow fever virus strain SH 28580 polyprotein mRNA, partial cds6146146%1e-17080%AF369671.1Select seq gb|AF369670.1|AF369670Yellow fever virus strain HD 38564 polyprotein mRNA, partial cds6146146%1e-17080%AF369670.1Select seq gb|AY161943.1|Yellow fever virus strain HEB4245 polyprotein gene, partial cds6106106%2e-16980%AY161943.1Select seq gb|AY161927.1|Yellow fever virus strain 1362/77 polyprotein gene, partial cds6096096%6e-16980%AY161927.1Select seq gb|AF369690.1|AF369690Yellow fever virus strain Dar Ar 276 polyprotein mRNA, partial cds6096096%6e-16980%AF369690.1Select seq gb|AF369687.1|AF369687Yellow fever virus strain SH1446 polyprotein mRNA, partial cds6096096%6e-16980%AF369687.1Select seq gb|AY161929.1|Yellow fever virus strain 1371 polyprotein gene, partial cds6076076%2e-16880%AY161929.1Select seq gb|AY839632.1|Yellow fever virus strain ArD76320/Senegal90 polyprotein gene, partial cds6076076%2e-16880%AY839632.1Select seq gb|AY161950.1|Yellow fever virus strain IQT5591 polyprotein gene, partial cds6056056%7e-16880%AY161950.1Select seq gb|AY161942.1|Yellow fever virus strain HEB4240 polyprotein gene, partial cds6056056%7e-16880%AY161942.1Select seq gb|AF369691.1|AF369691Yellow fever virus strain ArD93388 polyprotein gene, partial cds6056056%7e-16880%AF369691.1Select seq gb|AF369686.1|AF369686Yellow fever virus strain Jose Cachatra polyprotein mRNA, partial cds6056056%7e-16880%AF369686.1Select seq gb|U52402.1|YFU52402Yellow fever virus Nigeria46 non-structural protein 4A mRNA, partial cds6056057%7e-16878%U52402.1Select seq gb|HM582844.1|Yellow fever virus strain FMD1240 polyprotein gene, partial cds6036036%2e-16781%HM582844.1Select seq gb|KM388823.1|Yellow fever virus strain 7A polyprotein gene, partial cds5985985%1e-16582%KM388823.1Select seq gb|HM582847.1|Yellow fever virus strain FVB0196 polyprotein gene, partial cds5985986%1e-16580%HM582847.1Select seq gb|KU308380.1|Bamaga virus isolate CY4270 polyprotein gene, complete cds596144654%4e-16566%KU308380.1Select seq gb|AY161949.1|Yellow fever virus strain OBS6745 polyprotein gene, partial cds5965966%4e-16580%AY161949.1Select seq gb|EF158054.1|St. Louis encephalitis virus strain 75 D 90 polyprotein gene, partial cds59084622%2e-16369%EF158054.1Select seq gb|U52415.1|YFU52415Yellow fever virus Senegal65 non-structural protein 4A mRNA, partial cds5895897%5e-16378%U52415.1
  10. LOCUS KX027336 10823 bp RNA linear VRL 08-MAY-2016 DEFINITION Yellow fever virus isolate CIC4, complete genome. ACCESSION KX027336 VERSION KX027336.1 GI:1024994410 KEYWORDS . SOURCE Yellow fever virus (YFV) ORGANISM Yellow fever virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus; Yellow fever virus group. REFERENCE 1 (bases 1 to 10823) AUTHORS Cui,S., Wang,Q., Li,J., Chen,L., Li,X., Yang,P., Dou,X., Huo,D., Shi,W., Wu,S., Zhang,X., Zheng,Y., Liang,Z., Lyu,Y., Lu,G. and Du,Y. TITLE Direct Submission JOURNAL Submitted (06-APR-2016) Department of Infectious Disease and Endemic Disease Control, Beijing Center for Disease Prevetion and Control, 16 Hepingli Middle Street, Dongcheng District, Beijing 100013, China COMMENT ##Assembly-Data-START## Assembly Method :: Samtools v. v1.2 Sequencing Technology :: IonTorrent ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10823 /organism="Yellow fever virus" /mol_type="genomic RNA" /isolate="CIC4" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:11089" /country="China" /collection_date="19-Mar-2016" /note="HR0005-4; clinical-imported case 4" CDS 121..10359 /note="gp1" /codon_start=1 /product="polyprotein" /protein_id="ANC33492.1" /db_xref="GI:1024994411" /translation="MSGRKAQGRTLGVNMVRRGVRSLSNKIKQKTKQIGNRPGPSRGV QGFIFFFLFNILTGKKLTAHLKKLWRMLDPRQGLAVLRKVKRVVASLMRGLASRKRRS NEMAMVPLLLLGLLALSGGVTLVRKNRWLLLNVTAEDLGKTFSVGTGNCTTNILEAKY WCPDSMEYNCPNLSPREEPDDIDCWCYGVENVRVAYGRCDAVGRSKRSRRAIDLPTHE NHGLKTRQEKWMTGRMGERQLQKIERWLVRNPFFAVTALAIAYLVGNNTTQRVVIALL VLAVGPAYSAHCIGITDRDFIEGVHGGTWVSATLEQDKCVTVMAPDKPSLDISLQTVA IDGPAEARKVCYSAVLTHVKINDKCPSTGEAHLAEENDGDNACKRTYSDRGWGNGCGL FGKGSIVACAKFTCAKSMSLFEVDQTKIQYVIRAQLHVGAKQENWNTDIKTLKFDALS GSQEAEFTGYGKATLECQVQTAVDFGNSYIAEMEKDSWIVDRQWAQDLTLPWQSGSGG IWREMHHLVEFEPPHAATIRVLALGNQEGSLKTALTGAMRVTKDENDNNLYKLHGGHV SCRVKLSALTLKGTSYKMCTDKMSFVKNPTDTGHGTVVMQVKVPKGAPCKIPVIVADD LTAAVNKGILVTVNPIASTNDDEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGSSIG KLFTQTMKGAERLAVMGDAAWDFSSAGGFFTSVGKGIHTVFGSAFQGLFGGLSWITKV IMGAVLIWVGINTRNMTMSMSMILVGVIMMFLSLGVGADQGCAVNFGKRELKCGDGIF VFRDSDDWLTKYSYYPEDPVKLASIIKASHEEGKCGLNSVDSLEHEMWRSRADEINAI FEENEVDISVVVQDPKNIYQRGTQPFSRIRDGLQYGWKTWGKNLVFSPGRKNGSFIID GKSRKECPFSNRVWNSFQIEEFGMGVFTTRVFMDATFDYSVDCDGAILGAAVNGKKSA HGSPTFWMGSHEVNGTWMTHTLETLDYKECEWPLTHTIGTSVEESDMFMPRSIGGPVS SHNRIPGYKVQTNGPWMQVPLEVKREVCPGTSVVVDSNCDGRGKSTRSTTDSGKIIPE WCCRSCTMPPVSFHGSDGCWYPMEIRPMKTSDSHLVRSWVTAGEVHAVPFGLVSMMIA MEVVLRRRQGPKQMLVGGVVLLGAMLVGQVTVLDLVKFVVAVGLHFHEINNGGDAMYM ALIASFSIRPGLLMGFGLRTLWSPRERLVMAFGAAMVEIALGGMMGGLWQYLNAVSLC VLTINAISSRKASNMILPLMALMTPMTMHEVRMATMLFCTVVIIGVLHQNSKDTSMQK TIPIVALTLTSYMGLTQPFLGLCAYMSTQVFGRRSIPVNEALAAAGLVGVLAGLAFQD MENFLGPIAVGGILMMLVSVAGRVDGLELRKLGEISWEEEAEISGSSSRYDVALSEQG EFKLLSEDKVPWDQIVMTSLALVGAAIHPFALLLVLGGWILHIKGARRSGDVLWDIPT PKVIEECEHLEDGIYGIFQSTFLGASQRGVGVAQGGVFHTMWHVTRGAFLLRNGKKLV PSWASVKEDLVAYGGSWKLDGRWDGEEEVQLIAAVPGKSVVNVQTKPSLFKVKNGGEI GAVALDYPSGTSGSPIVNRNGEVVGLYGNGILVGDNSFVSAISQTELKEESKEELQEI PTMLKKGMTTILDFHPGAGKTRRFLPQILAECARRRLRTLVLAPTRVVLSEMKEAFQG LDVKFHTQAFSAHGSGKEVIDAMCHATLTYRMLEPTRVVNWEVIIMDEAHFLDPASIA ARGWAAHRARANESATILMTATPPGTSDEFPHSNGEIEDVQTDIPSEPWTTGHEWILA DKRPTAWFLPSIRAANVMAASLRKAGKNVVVLNRKTFEKEYPTIKQKKPDFILATDIA EMGANLCVERVLDCRTAYKPVLVDEGKKVAIKGPLRISASSAAQRRGRIGRNPNRDGD SYYYSEPTSEDNAHHVCWLEASMLLDNMEVRGGMVAPLYGIEGTKTPVSPGEMRLRDD QRRVFRELVRGCDLPVWLAWQVAKAGLKTNDRKWCFEGPEEHEILNDNGETVKCRSPG GAKRALRPRWCDERVSSDQSALADFIKFAEGRRGAAEMLVILTELPDFLAKKGGEAMD TISVFLHSEEGSRAYRNALSMMPEAMTIVMLFLLAGLLTSGAVIFFMSPKGMSRMSMA MGTMAGSGYLMFLGGVKPTHISYVMLIFFVLMVVIIPEPGQQRSIQDNQVAYLIIGIL TLLSVVAANELGMLEKTKEDFFGKRDITTPSGAIPWSWPDLDLKPGAAWTVYVGIVTM LSPMLHHWIKVEYGNLSLSGIAQSASVLSFMDKGIPFMKMNISVVILLVSGWNSITVI PLLCGIGGAMLHWTLKLPGIKAQQSKLAQKRVFHGVAKNPVVDGNPTADIEEAPEMPA LYEKKLALYLLLALSLMSVAMCRTPFSLAEGIVLSSAALGPLIEGNTSLLWNGPMAVS MTGVMRGNYYAFVGVMYNLWKMKTERRGSASGKTLGEVWKRELNLLDKQQFEMYKRTD IIEVDRDMARRHLAEGKVDTGVAVSRGTAKLRWFHERGYVKLEGRVTDLGCGRGGWCY YAAAQKEVSGVKGYTLGRDGHEKPMNVQSLGWNIVTFKDKTDIHRLEPLKCETLLCDI GESSPSSATEGERTLRVLDTVEKWLACGVDNFCIKVLAPYMPDVIEKLELLQRRFGGT VIRNPLSRNSTHEMYYVSGARSNITFTVNQTSRLLMRRMRRPTGKVTLEADVILPIGT RSVETDKGPLDKDAIEERVERIKNEYATTWFYDNDNPYRTWHYCGSYVTKTSGSAASM INGVIKILTFPWDRIEEVTRMAMTDTTPFGQQRVFKEKVDTRAKDPPAGTRKIMKVVN RWLFRHLSREKNPRLCTKEEFIAKVRSHAAVGAFLEEQEQWKTANEAVLDPKFWEMVD AERKLHQQGRCQSCVYNMMGKREKKLSEFGKAKGSRAIWYMWLGARFLEFEALGFLNE DHWASRENSGGGVEGIGLQYLGYVIRDLSTKEGGGFYADDTAGWDTRITEADLDDEQE IMSYMSPEQRKLAWAIMEMTYKNKVVKVLRPAPGGKAFMDIISRRDQRGSGQVVTYAL NTITNLKVQLIRMAEAEMVINHQHVQECGENVLERLETWLAENGCDRLSRMAVSGDDC VVRPVDDRFGLALSHLNAMSKVRKDISEWQPSKGWTDWENVPFCSHHFHELVLKDGRK IVVPCRDQDELIGRGRVSPGNGWMIKETACLSKAYANMWSLMYFHKRDMRLLSFAVSS AVPTAWVPSGRTTWSVHGRGEWMTTEDMLDVWNRVWVLNNPHMTDKTTIKEWRDVPYL TKRQDKLCGSLIGMTNRATWASHIHLVIHRIRTLIGQEKFTDYLTVMDRYSVDADLQP GELI" ORIGIN 1 agtaaatccc tgggtgctaa ttgaggtgca ttggtctgca aatcgagttg ctaggcaata 61 aacacatttg gattaatttt aatcgttcgt tgagcgatta gcagagaact gaccagagaa 121 atgtctggtc gaaaagctca gggtagaacc ctgggcgtca atatggtaag acgaggggtt 181 cgctccttgt caaacaaaat aaaacaaaaa acaaaacaga ttggaaacag acctggccct 241 tcaagaggtg ttcaaggatt tattttcttc tttttgttta acattctgac tgggaaaaag 301 ttgactgctc atctaaaaaa actctggagg atgcttgatc caaggcaggg gcttgctgta 361 ctgcgaaagg tcaaaagagt tgtagctagc ttaatgagag ggctggcttc caggaaacgt 421 agatccaatg aaatggccat ggtaccactc ctgttactgg gtttgttggc tctatcagga 481 ggagtgaccc tcgtcagaaa gaacagatgg ttgctcctga atgtaactgc tgaagacctg 541 gggaaaacgt tttcagtggg aactgggaat tgcaccacga atattctgga agcaaaatac 601 tggtgccccg actcaatgga atacaattgc cccaatctca gtccaagaga agagccagat 661 gacatagatt gctggtgtta tggagtggaa aatgtcagag tggcctatgg aagatgtgat 721 gcggtagggc gatcaaaacg ctccaggaga gcgattgatc tacccacaca tgagaaccat 781 ggactaaaga ctcggcagga gaagtggatg acaggcagaa tgggtgagag gcagctccag 841 aagattgaaa gatggctggt taggaatcca ttttttgcgg tcacagcatt ggcaatagcc 901 tatctggtgg gtaacaacac gacacaacga gtggtcatag cactactggt tctagcggtt 961 ggtccagcgt actctgccca ttgcataggg ataaccgaca gagatttcat tgaaggtgtc 1021 catgggggca cttgggtgtc agccactctg gagcaggaca aatgcgtgac tgtaatggcc 1081 cctgacaaac cttctctgga catctcacta caaacagtgg caatcgatgg accggctgaa 1141 gcgaggaagg tttgctacag tgcagtccta acccatgtga agatcaatga caaatgcccg 1201 agcactggtg aggcccacct tgcagaggaa aatgatggtg acaatgcttg taaacggaca 1261 tattctgaca gaggctgggg caatggctgt ggtctttttg ggaaaggaag catcgtggct 1321 tgtgccaagt ttacatgtgc caaatctatg agtctctttg aggtggatca gaccaaaatc 1381 caatatgtca tcagggccca gctccatgtg ggtgctaaac aggaaaactg gaacacagac 1441 ataaaaacgc tgaaatttga tgctctttct ggctcacagg aggctgaatt cactggttat 1501 ggaaaggcaa cactagagtg tcaggtccag actgccgtgg actttgggaa cagctacatc 1561 gcagagatgg aaaaagatag ctggatcgtt gaccgccaat gggcacagga cttgacactg 1621 ccatggcaga gtgggagtgg tggcatatgg agagaaatgc accaccttgt tgagtttgag 1681 cccccacatg ctgccacaat tagggtgctg gccttgggca atcaagaagg ctccttgaag 1741 accgctctca caggcgctat gcgcgtcacc aaggatgaga atgacaacaa cttgtacaaa 1801 ctgcacggtg gtcacgtctc ctgtagagtg aaactgtcag ccctcactct caaaggaaca 1861 tcctacaaga tgtgcacaga taaaatgtca tttgtcaaga atccaacgga tacagggcat 1921 ggcacagttg tcatgcaagt aaaggtcccc aaaggggccc catgcaagat tcccgtgatt 1981 gtggcagatg acctaacggc agcagtgaac aaaggcatct tggtcactgt caatcctatt 2041 gcatccacaa atgatgatga agttctgatt gaggtcaatc ccccttttgg ggatagctac 2101 atcatagttg ggactggaga ctcacgactg acctatcagt ggcacaaaga agggagttca 2161 ataggaaaat tgttcacaca gacaatgaaa ggagctgaac gtcttgcagt gatgggtgat 2221 gctgcttggg attttagttc tgctgggggg ttcttcacat ctgtgggaaa aggaatccat 2281 accgtgtttg gctcggcctt ccaggggctg tttggtggct tgagttggat cacgaaagtc 2341 atcatgggag ccgtgctcat ctgggtggga ataaacaccc gcaacatgac catgtccatg 2401 tccatgatct tggtaggtgt gatcatgatg tttctttcac taggagttgg ggctgaccaa 2461 ggatgtgctg ttaactttgg gaaacgcgag ctcaaatgcg gagatggcat ctttgtgttt 2521 agagactctg atgactggct cacaaagtac tcatactatc ctgaagaccc tgtcaaattg 2581 gcatccatca ttaaagcctc ccacgaggag ggcaaatgtg gattgaattc agttgattcc 2641 ctcgaacacg agatgtggag gagtagggcg gatgagatca acgccatttt tgaagaaaat 2701 gaagtagaca tctcggtcgt cgtccaagac ccaaagaaca tctaccaaag agggacccaa 2761 ccgttctcaa ggatccgtga cggattgcag tatggatgga agacttgggg aaaaaacctt 2821 gttttctcac cagggaggaa gaacggcagc ttcatcattg acgggaagtc acgaaaggag 2881 tgccccttct ctaacagagt gtggaactca ttccagattg aggagtttgg catgggggtc 2941 ttcacaacac gagtgtttat ggacgcgacc tttgactatt cagtggactg tgatggagcc 3001 atcctgggtg cagcggtgaa tggaaagaag agtgcccatg gatcacccac attttggatg 3061 ggaagtcatg aagtcaatgg aacgtggatg acacacactt tggaaactct tgattacaag 3121 gagtgtgaat ggccactgac acacactatt ggaacctcag tagaagaaag tgacatgttc 3181 atgccccggt ccattggagg tccggtgagt tctcacaacc gcatcccggg ttacaaggtg 3241 caaaccaatg ggccatggat gcaagtcccc ctggaagtaa aaagggaagt ctgtccaggg 3301 acaagcgtgg tggtggactc caactgtgat ggacgtggaa aatcaacgag atcaaccact 3361 gacagtggga aaataatccc ggaatggtgt tgcagatctt gtactatgcc tccagtcagc 3421 ttccatggaa gcgatggttg ttggtatcct atggagatca gacccatgaa aacatccgac 3481 agccacctag tgagatcctg ggtgactgca ggagaagttc atgcagtacc ctttggactg 3541 gtgagcatga tgattgccat ggaggtggtg ttgcgcagaa ggcaaggacc aaaacaaatg 3601 ctggtaggag gagttgtgct gcttggagcg atgttagtgg gacaagtcac agtcttagac 3661 cttgtgaagt ttgttgtggc agtgggattg cacttccatg aaattaataa cggaggagat 3721 gccatgtaca tggcattgat tgccagcttt tccatccggc caggcctgct catgggcttt 3781 gggctgcgca cactgtggag tcctcgcgag cgacttgtaa tggcatttgg agcagccatg 3841 gttgagattg ccttaggtgg aatgatgggt gggctttggc agtacttgaa cgccgtttca 3901 ctgtgtgtgc tcaccataaa tgcaatctca tcaaggaagg cctcaaatat gatcctcccc 3961 ctgatggcac tcatgactcc catgacaatg catgaggtga ggatggcgac gatgctgttc 4021 tgcactgttg tcataatagg ggtgcttcat cagaattcaa aagacacatc tatgcaaaag 4081 accattccca ttgtagccct gacactgacc tcatacatgg gcttgaccca gccctttcta 4141 gggctgtgtg catacatgtc cacgcaggtg tttggcagaa ggagtatacc tgtgaatgaa 4201 gccttggcag cggctggctt ggtgggagtg ctagcagggc tagccttcca agacatggaa 4261 aactttttgg gtccaatagc ggtggggggg atcctcatga tgctagttag tgtggcaggg 4321 agagttgatg gactagagct caggaaactt ggtgaaatct cctgggaaga agaagctgaa 4381 ataagtggaa gctctagccg ctatgatgtg gcactcagtg agcagggtga atttaaactc 4441 ctctcagagg acaaagtgcc ctgggaccag atagtaatga catccctagc cctcgtggga 4501 gcagccatac atccatttgc cctcttgctg gtcttgggag gatggatcct gcacattaaa 4561 ggtgctagga ggagtgggga tgttctttgg gacattccta cgccaaaggt gattgaggaa 4621 tgtgagcacc tggaggatgg gatctatggc atatttcagt caaccttcct tggagcctcg 4681 cagcgaggtg ttggagtggc gcagggaggg gtcttccaca caatgtggca tgtcactagg 4741 ggggcattcc tcttgaggaa tggaaagaaa ctggttccgt cttgggcttc tgtgaaggag 4801 gatctggtgg cttatggtgg ttcctggaaa ctagacggga gatgggatgg tgaggaggaa 4861 gtccaactca tcgctgctgt gcctggaaaa tctgttgtca acgttcaaac aaaaccaagc 4921 ttgttcaaag tgaaaaatgg tggtgagatt ggagcagttg ctctagacta ccccagtgga 4981 acctcaggct cccccattgt gaaccgaaat ggtgaagtgg ttgggctcta tggcaatgga 5041 attctggtgg gtgataactc ctttgtgtct gccatctcac aaactgaatt gaaggaagaa 5101 tccaaagaag aactgcaaga aataccaact atgctgaaaa aaggaatgac caccatcctt 5161 gacttccacc ctggggcggg gaaaacccgt aggttcctgc ctcaaatatt ggcggagtgt 5221 gccagaaggc gtttgcgcac tctggtatta gcacccacca gggttgtttt gtcagagatg 5281 aaagaagctt ttcaggggtt ggatgtgaaa ttccacacac aagctttctc agcccatggg 5341 agtgggaagg aggtcattga cgcaatgtgc catgcaaccc ttacatatag aatgctggaa 5401 ccaacaaggg tagtcaactg ggaggtcatt attatggatg aggcgcactt tctggatcct 5461 gctagcatag cagcgagagg ctgggcggct catagagcaa gagcaaatga gagcgccacc 5521 atacttatga ccgccacccc accaggcacc agtgacgaat tccctcactc caatggtgag 5581 attgaggacg tccagactga catccccagc gagccatgga ccacaggaca tgaatggatc 5641 ttggcggaca agcgcccaac tgcatggttc cttccatcga tcagagcagc aaatgtcatg 5701 gcagcctcgc tgcggaaagc gggaaaaaat gtggtggtac tgaataggaa aacctttgaa 5761 aaggagtacc ccaccattaa gcagaagaaa ccggatttca tccttgccac cgatatcgct 5821 gagatgggag caaacttgtg tgtggagaga gtcttggact gcagaactgc ctacaagcct 5881 gtcctggttg atgaagggaa gaaggtggct atcaaagggc cgctacgaat ctcagcgtca 5941 tcggccgctc agaggagagg acgcattgga cgcaatccca acagagatgg tgactcttac 6001 tactactcag aacctaccag tgaggacaat gcacaccatg tgtgctggct ggaggcttcc 6061 atgctcctgg ataacatgga ggttagaggg gggatggttg ctccacttta tggcattgag 6121 ggaacaaaga ctcccgtctc tccaggagaa atgaggctaa gagatgatca gagaagggtc 6181 tttagagagt tggtgcgagg gtgtgatttg ccagtgtggt tggcatggca agtggcaaaa 6241 gccggcctga agaccaatga ccgcaaatgg tgttttgagg gtcccgaaga gcatgaaata 6301 ctcaatgaca atggtgaaac agtaaagtgt agatctccgg gcggagcaaa aagagcattg 6361 agacctagat ggtgtgacga gagagtttcc tcagaccaga gtgccttggc tgacttcatt 6421 aagtttgcag aaggtagaag aggggctgct gagatgcttg tgatcctcac ggagttgccc 6481 gacttcctgg caaagaaggg tggggaagcc atggatacca tcagtgtgtt cctacattct 6541 gaagagggtt caagagcgta cagaaatgcc ctgtcaatga tgccagaagc catgaccatt 6601 gtcatgctct tcctgcttgc cggactcttg acctcaggag cggtgatttt cttcatgtcg 6661 ccaaaaggca tgagtagaat gtcaatggca atgggtacca tggctggcag tggatatctc 6721 atgtttctgg ggggagtaaa accaacccac atctcttacg tcatgttaat attctttgtc 6781 ctcatggtcg tcataattcc cgaaccagga cagcagagat caatccagga taaccaagtt 6841 gcctacctca taattgggat cttgacattg ttatcagttg tggcagctaa tgaactaggg 6901 atgctggaga agaccaagga agattttttt ggaaagagag acatcacaac accaagtggg 6961 gcaatcccat ggagttggcc tgacctggat ctgaaacctg gggcggcctg gacagtctat 7021 gtgggaatcg tgacgatgtt gtctcccatg ttacaccatt ggataaaagt tgagtatggc 7081 aatttgtcac tatcgggaat agcccaatct gcctcagttc tttcatttat ggacaaagga 7141 attcccttca tgaaaatgaa tatatctgtg gtcatacttt tggtcagtgg ctggaattca 7201 atcacagtga tccctctttt gtgcggcatt ggtggagcca tgctgcactg gacgctcaaa 7261 cttcctggga ttaaagccca gcaatcaaag ctggctcaaa aaagagtttt tcatggagtg 7321 gcaaaaaatc cagttgttga tggtaatcca actgctgaca ttgaggaagc cccagaaatg 7381 ccagctttat atgaaaagaa gctggctctt tacctccttc tggccctaag cctcatgtca 7441 gttgccatgt gcagaacccc tttttcctta gcggaaggaa tagtattgtc atctgccgcc 7501 cttggacctc tcattgaggg gaacactagt ctgttgtgga atggcccaat ggccgtttcc 7561 atgactggag tcatgcgtgg caactactat gcttttgtgg gagtcatgta caatctctgg 7621 aaaatgaaaa cagagcgtag agggagtgca agtggaaaaa cattgggtga ggtctggaag 7681 cgtgaactca acttgctaga caaacaacaa tttgaaatgt acaaaagaac agacatcatt 7741 gaggtggacc gagacatggc acgacgacac ttggcagagg gaaaggtgga cacgggagtg 7801 gccgtgtcga gagggactgc aaagctgaga tggttccacg agcgtggcta tgtgaagcta 7861 gaaggaaggg tcaccgatct tgggtgtgga cgtggaggct ggtgctacta tgcagcagct 7921 caaaaagaag ttagtggtgt gaaggggtat acccttggca gagatggcca tgagaaacct 7981 atgaatgtcc aaagcttggg atggaatatt gtgactttta aggacaagac tgatattcac 8041 cgactggagc cactcaagtg tgaaactctc ctctgtgaca tcggagaatc gtccccatcc 8101 tccgcaactg agggtgagag gaccttaaga gttctggaca cagttgaaaa gtggttggct 8161 tgtggagtgg ataacttttg catcaaagtt ctggcaccat acatgcccga tgtgatagag 8221 aaactggagc ttcttcaaag aagattcggt ggaaccgtca tcaggaatcc tctgtccaga 8281 aattctactc atgaaatgta ctacgtttca ggagcaagaa gtaacatcac attcacagtt 8341 aaccagacat cacgcctgct gatgcgaagg atgaggcggc ccacaggcaa agttaccttg 8401 gaagctgatg tcattcttcc gataggcacg cgcagtgtgg aaactgataa aggcccattg 8461 gataaggatg ctattgagga aagagttgag aggatcaaga atgaatatgc cactacatgg 8521 ttctatgaca atgacaaccc gtatagaacg tggcattatt gtggctccta tgtgaccaaa 8581 acgtcaggaa gtgcagccag catgataaat ggagtcatca aaatcctgac ttttccatgg 8641 gacaggatag aagaagtcac aagaatggca atgactgaca ccacaccttt tggacaacaa 8701 agagttttca aggagaaagt agacacaaga gcaaaagacc ctcctgctgg aacaaggaag 8761 atcatgaagg tggtgaatag atggttgttt cggcatctgt ccagggagaa gaaccccagg 8821 ttgtgcacca aagaagaatt cattgccaaa gtacggagcc atgcagcagt gggggctttt 8881 ctagaggaac aagagcagtg gaaaacggcc aatgaggcag tccttgatcc aaagttttgg 8941 gaaatggtcg atgcagaacg caaacttcat cagcaggggc gatgccaatc ctgtgtgtac 9001 aacatgatgg gaaagaggga aaagaaactc tctgaatttg gaaaggccaa agggagccgt 9061 gctatctggt acatgtggct tggggcacgg ttccttgagt ttgaagctct tgggttttta 9121 aatgaagatc actgggcctc ccgggagaac tcggggggag gagttgaggg cataggactc 9181 cagtacttgg gctatgttat cagggacttg tcaaccaaag aaggtggagg gttttatgcg 9241 gatgacacgg cagggtggga cacacgcatc acagaagctg acctggatga cgagcaagag 9301 atcatgagtt acatgagccc tgaacaaagg aagctggcct gggctataat ggaaatgaca 9361 tacaagaaca aagtggttaa ggtgctgagg ccagccccag gaggcaaggc cttcatggac 9421 atcatcagcc ggagagacca aagggggtca ggacaagttg tgacatacgc cctcaacacc 9481 ataaccaatc taaaagtcca gctcataaga atggctgaag ctgaaatggt gatcaaccat 9541 cagcatgtgc aggagtgtgg tgaaaatgtc ttagagcggc ttgaaacttg gcttgctgaa 9601 aacggatgtg acagattgag ccgaatggct gtgagtgggg atgattgtgt tgtgagaccg 9661 gtggatgaca gatttggcct ggccctttcc catcttaatg caatgtccaa agttaggaag 9721 gacatttcag aatggcaacc ctccaaagga tggacagatt gggaaaatgt tcctttctgc 9781 tctcaccact tccatgaact ggtgttgaaa gatgggagga agatagtggt gccttgcaga 9841 gatcaagatg aactgatagg gagagggaga gtgtccccag gaaatggctg gatgatcaag 9901 gaaacagcct gcctcagcaa agcttacgca aacatgtggt cactgatgta ctttcacaag 9961 agggacatga ggctactttc attcgctgtc tcctccgctg ttccaacggc ctgggtgccc 10021 agtggaagga caacgtggtc tgtccacgga agaggggagt ggatgacaac tgaggacatg 10081 ctagatgtct ggaacagggt gtgggtgttg aataacccgc acatgacgga caaaacaacc 10141 atcaaggagt ggagagatgt tccctacctc acaaagagac aggataagct ttgcgggtca 10201 ctgataggaa tgacaaacag ggccacatgg gcatctcaca tccaccttgt gatccaccgg 10261 atcagaactc taataggtca agagaagttc acagactacc tcaccgtcat ggacaggtat 10321 tctgttgatg ccgaccttca gccaggagag cttatctgag acattacaac atggaaaacc 10381 gggataaaaa ctacgggtgg agaaccggac tccccacttg agaaatgtaa ataagaaacc 10441 gggataaaaa caacggatgg agaaccggac tccacactga ataggttata aacgtcagcc 10501 caggatccaa aatttgaatg ggtcttgcca ccgctaagct gtgaggcggt gcgggctggg 10561 acagccgttt cccgggcaac gacatgcctg gtttctggga cttcccaacc cggagtaaaa 10621 tgaaggagcc tccgccacca ccctcccacg gggtgttgga aagatggggt ctagaggtta 10681 gaggagaccc tccagggaaa ttagtgggac catattgacg ccagggaaag accggagtgg 10741 ttctctgctt ttcctccagg ggtctgcgag cacagtttgc tctagaagaa gcagaccttt 10801 ggatgacaaa acacaaaacc act
  11. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX010996.1|Yellow fever virus isolate CIC3, complete genome1840118401100%0.0100%KX010996.1Select seq gb|KX027336.1|Yellow fever virus isolate CIC4, complete genome1831418314100%0.099%KX027336.1Select seq gb|KX010995.1|Yellow fever virus isolate CIC2, complete genome1830718307100%0.099%KX010995.1Select seq gb|KX010994.1|Yellow fever virus isolate CIC1, complete genome1796217962100%0.099%KX010994.1Select seq gb|AY968064.1|Yellow fever virus strain Angola71, complete genome1760217602100%0.098%AY968064.1Select seq gb|DQ235229.1|Yellow fever virus strain Couma, complete genome1131011310100%0.084%DQ235229.1Select seq gb|AY968065.1|Yellow fever virus strain Uganda48a, complete genome1127711277100%0.084%AY968065.1Select seq gb|JN620362.1|Yellow fever virus strain Uganda 2010, complete genome1126611266100%0.084%JN620362.1Select seq gb|JF912185.1|Yellow fever virus strain BeAR513008, complete genome87498749100%0.079%JF912185.1Select seq gb|JF912179.1|Yellow fever virus strain BeAR378600, complete genome87498749100%0.079%JF912179.1Select seq gb|JF912186.1|Yellow fever virus strain BeH526722, complete genome87228722100%0.079%JF912186.1Select seq gb|AY603338.1|Yellow fever virus strain Ivory Coast 1999, complete genome87158715100%0.079%AY603338.1Select seq gb|JF912184.1|Yellow fever virus strain BeH463676, complete genome87098709100%0.079%JF912184.1Select seq gb|JF912183.1|Yellow fever virus strain BeH423602, complete genome87028702100%0.079%JF912183.1Select seq gb|KM388817.1|Yellow fever virus strain 2A polyprotein gene, complete cds87008700100%0.079%KM388817.1Select seq gb|AY572535.1|Yellow fever virus strain Gambia 2001, complete genome86978697100%0.079%AY572535.1Select seq gb|KM388816.1|Yellow fever virus strain 10A polyprotein gene, complete cds86918691100%0.079%KM388816.1Select seq gb|JX898873.1|Yellow fever virus isolate ArD149214 from Senegal, complete genome86898689100%0.079%JX898873.1Select seq gb|JX898874.1|Yellow fever virus isolate ArD149194 from Senegal, complete genome86868686100%0.079%JX898874.1Select seq gb|JX898868.1|Yellow fever virus isolate HD117294 from Senegal, complete genome86828682100%0.079%JX898868.1Select seq gb|JX898875.1|Yellow fever virus isolate ArD149815 from Senegal, complete genome86808680100%0.079%JX898875.1Select seq gb|JF912187.1|Yellow fever virus strain BeH622205, complete genome86798679100%0.079%JF912187.1Select seq gb|JF912188.1|Yellow fever virus strain BeH622493, complete genome86758675100%0.079%JF912188.1Select seq gb|JF912180.1|Yellow fever virus strain BeH394880, complete genome86628662100%0.079%JF912180.1Select seq gb|JX898870.1|Yellow fever virus isolate ArD121040 from Senegal, complete genome86558655100%0.079%JX898870.1Select seq gb|JX898880.1|Yellow fever virus isolate ArD181564 from Senegal, complete genome86508650100%0.079%JX898880.1Select seq gb|JX898878.1|Yellow fever virus isolate ArD181250 from Senegal, complete genome86488648100%0.079%JX898878.1Select seq gb|JX898877.1|Yellow fever virus isolate ArD181464 from Senegal, complete genome86488648100%0.079%JX898877.1Select seq gb|JF912189.1|Yellow fever virus strain BeAR646536, complete genome86398639100%0.079%JF912189.1Select seq gb|JF912190.1|Yellow fever virus strain BeH655417, complete genome86378637100%0.079%JF912190.1Select seq gb|JF912182.1|Yellow fever virus strain BeH422973, complete genome86348634100%0.079%JF912182.1Select seq gb|HM582851.1|Yellow fever virus strain TVP11767 polyprotein gene, complete cds86308630100%0.079%HM582851.1Select seq gb|JX898876.1|Yellow fever virus isolate ArD156468 from Senegal, complete genome86268626100%0.079%JX898876.1Select seq gb|KM388815.1|Yellow fever virus strain 9A polyprotein gene, complete cds86158615100%0.079%KM388815.1Select seq gb|KM388814.1|Yellow fever virus strain 6A polyprotein gene, complete cds86158615100%0.079%KM388814.1Select seq gb|JX898869.1|Yellow fever virus isolate DakArAmt7 from Cote d'Ivoire, complete genome86068606100%0.079%JX898869.1Select seq gb|AY640589.1|Yellow fever virus strain ASIBI, complete genome85888588100%0.079%AY640589.1Select seq gb|KF769016.1|Yellow fever virus strain Asibi, complete genome85838583100%0.079%KF769016.1Select seq gb|KM388818.1|Yellow fever virus strain 8A polyprotein gene, complete cds85708570100%0.079%KM388818.1Select seq gb|KF907504.1|Yellow fever virus strain 88/1999, complete genome85478547100%0.078%KF907504.1Select seq gb|U21056.1|YFU21056Yellow fever virus French viscerotropic strain, complete genome85258525100%0.078%U21056.1Select seq gb|JX898872.1|Yellow fever virus isolate ArD114972 from Senegal, complete genome85008500100%0.078%JX898872.1Select seq gb|JX898871.1|Yellow fever virus isolate ArD114896 from Senegal, complete genome84938493100%0.078%JX898871.1Select seq gb|DQ100292.1|Yellow fever virus strain 17DD-Brazil, complete genome84868486100%0.078%DQ100292.1Select seq gb|U21055.1|YFU21055Yellow fever virus French neurotropic strain, complete genome84808480100%0.078%U21055.1Select seq gb|GQ379162.1|Yellow fever virus strain case #1, complete genome84688468100%0.078%GQ379162.1Select seq gb|U17066.1|YFU17066Yellow fever virus vaccine strain 17DD, complete genome84688468100%0.078%U17066.1Select seq emb|X03700.1|Yellow fever virus complete genome, 17D vaccine strain84648464100%0.078%X03700.1Select seq gb|KF769015.1|Yellow fever virus strain 17D-204, complete genome84598459100%0.078%KF769015.1Select seq gb|JN811143.1|Yellow fever virus 17D YF-VAX Vero adapted Series C P11, complete genome84598459100%0.078%JN811143.1Select seq gb|JX503529.1|Yellow fever virus strain YF/Vaccine/USA/Sanofi-Pasteur-17D-204/UF795AA/YFVax, complete genome84598459100%0.078%JX503529.1Select seq gb|JN628279.1|Yellow fever virus strain 17D RKI, complete genome84598459100%0.078%JN628279.1Select seq gb|AF052444.1|AF052444Yellow fever virus clone HONG8 polyprotein gene, complete cds84598459100%0.078%AF052444.1Select seq gb|JX949181.1|Yellow fever virus strain 17D polyprotein gene, complete cds84558455100%0.078%JX949181.1Select seq gb|FJ654700.1|Yellow fever virus 17D/Tiantan, complete genome84558455100%0.078%FJ654700.1Select seq gb|DQ118157.1|Yellow fever virus isolate YF-AVD2791-93F/04 from Spain, complete genome84558455100%0.078%DQ118157.1Select seq emb|X15062.1|Yellow fever virus genomic RNA84558455100%0.078%X15062.1Select seq gb|AF052446.1|AF052446Yellow fever virus clone HONG10 polyprotein gene, complete cds84558455100%0.078%AF052446.1Select seq gb|AF052439.1|AF052439Yellow fever virus clone HONG3 polyprotein gene, complete cds84558455100%0.078%AF052439.1Select seq gb|AF052437.1|AF052437Yellow fever virus clone HONG1 polyprotein gene, complete cds84558455100%0.078%AF052437.1Select seq gb|U17067.1|YFU17067Yellow fever virus vaccine strain 17D-213, complete genome84558455100%0.078%U17067.1Select seq gb|GQ379163.1|Yellow fever virus strain case #2, complete genome84538453100%0.078%GQ379163.1Select seq gb|U54798.1|YFU54798Yellow fever virus strain 85-82H Ivory Coast, complete genome84518451100%0.078%U54798.1Select seq gb|JN811141.1|Yellow fever virus 17D YF-VAX Vero adapted Series A P11, complete genome84508450100%0.078%JN811141.1Select seq gb|AF052445.1|AF052445Yellow fever virus clone HONG9 polyprotein gene, complete cds84508450100%0.078%AF052445.1Select seq gb|AF052438.1|AF052438Yellow fever virus clone HONG2 polyprotein gene, complete cds84508450100%0.078%AF052438.1Select seq gb|JN811142.1|Yellow fever virus 17D YF-VAX Vero adapted Series B P11, complete genome84468446100%0.078%JN811142.1Select seq gb|AF094612.1|AF094612Yellow fever virus strain Trinidad 79A isolate 788379, complete genome83868386100%0.078%AF094612.1Select seq gb|JF912181.1|Yellow fever virus strain BeH413820, complete genome83748374100%0.078%JF912181.1Select seq gb|DQ322634.1|YFV replicon vector FMDV-2A-def, complete sequence8161827697%0.078%DQ322634.1Select seq gb|DQ322633.1|YFV replicon vector capsid-def, complete sequence8161827697%0.078%DQ322633.1Select seq gb|DQ322635.1|YFV replicon vector prME-def, complete sequence6504683781%0.078%DQ322635.1Select seq dbj|D14458.1|YFVCMENSYellow fever virus prM gene for precursor polyprotein, partial cds3155315534%0.080%D14458.1Select seq gb|GU951804.1|Yellow fever virus strain BeAn 131 polyprotein gene, partial cds2221222126%0.078%GU951804.1Select seq gb|AF052443.1|AF052443Yellow fever virus clone HONG7 polyprotein gene, partial cds2221222126%0.078%AF052443.1Select seq gb|AF052441.1|AF052441Yellow fever virus clone HONG5 polyprotein gene, partial cds2215221526%0.078%AF052441.1Select seq gb|AH005112.2|Yellow fever virus strain Y5 polyprotein and nonstructural protein NS2A mRNAs, partial cds2123247127%0.080%AH005112.2Select seq gb|AY960140.1|Yellow fever virus strain ArB28153 polyprotein gene, partial cds2120212017%0.086%AY960140.1Select seq gb|DQ322638.1|VEEV replicon vector YFV-C2, complete sequence2111211122%0.080%DQ322638.1Select seq gb|AF052440.1|AF052440Yellow fever virus clone HONG4 polyprotein gene, partial cds2107210722%0.080%AF052440.1Select seq gb|L06480.1|YFVCAPSIDMYellow fever virus capsid protein, M protein, and envelope protein mRNAs2107210722%0.080%L06480.1Select seq gb|DQ322642.1|VEEV replicon vector YFV-C3opt, complete sequence1918191822%0.078%DQ322642.1Select seq gb|DQ322640.1|VEEV replicon vector YFV-C3opt-NS2mut, complete sequence1918191822%0.078%DQ322640.1Select seq gb|U23578.1|YFU23578Yellow fever virus isolate SE7445/Uganda/1964/Human envelope protein (E) mRNA, partial cds1808180814%0.087%U23578.1Select seq gb|U23577.1|YFU23577Yellow fever virus isolate M-112/Sudan/1940/Human envelope protein (E) mRNA, partial cds1799179914%0.087%U23577.1Select seq gb|AY839636.1|Yellow fever virus strain ETH2777/Ethiopia61 envelope protein gene, partial cds1784178414%0.087%AY839636.1Select seq gb|DQ068260.1|Yellow fever virus strain SSUD03-01 envelope protein gene, partial cds1772177214%0.086%DQ068260.1Select seq gb|U23573.1|YFU23573Yellow fever virus isolate DaHB1504/C. African Republic/1985/Human envelope protein (E) mRNA, partial cds1772177214%0.086%U23573.1Select seq gb|DQ068264.1|Yellow fever virus strain SSUD03-05 envelope protein gene, partial cds1766176614%0.086%DQ068264.1Select seq gb|DQ068263.1|Yellow fever virus strain SSUD03-04 envelope protein gene, partial cds1766176614%0.086%DQ068263.1Select seq gb|DQ068262.1|Yellow fever virus strain SSUD03-03 envelope protein gene, partial cds1766176614%0.086%DQ068262.1Select seq gb|AY839634.1|Yellow fever virus strain HB1782/CAR86 envelope protein gene, partial cds1766176614%0.086%AY839634.1Select seq gb|U23569.1|YFU23569Yellow fever virus isolate 7914/Kenya/1993/Human envelope protein (E) mRNA, partial cds1754175414%0.086%U23569.1Select seq gb|U23575.1|YFU23575Yellow fever virus isolate KE93-477/Kenya/1993/Mosquito envelope protein (E) mRNA, partial cds1748174814%0.086%U23575.1Select seq gb|U23571.1|YFU23571Yellow fever virus isolate ArB8883/C. African Republic/1977/Human envelope protein (E) mRNA, partial cds1748174814%0.086%U23571.1Select seq gb|U23576.1|YFU23576Yellow fever virus isolate Kouma/Ethiopia/1961/Human envelope protein (E) mRNA, partial cds1743174314%0.086%U23576.1Select seq gb|AY960138.1|Yellow fever virus strain ArA 20628 polyprotein gene, partial cds1727172717%0.081%AY960138.1Select seq gb|AY960137.1|Yellow fever virus strain Ara29436 polyprotein gene, partial cds1687168717%0.081%AY960137.1Select seq gb|AY960139.1|Yellow fever virus strain Ara6734 polyprotein gene, partial cds1660166017%0.080%AY960139.1Select seq gb|DQ859058.1|Wesselsbron virus strain SAH-177 99871-2 polyprotein gene, complete cds1517203076%0.067%DQ859058.1Select seq gb|EU707555.1|Wesselsbron virus strain SAH177, complete genome1512202176%0.067%EU707555.1Select seq gb|GU073158.1|Yellow fever virus strain Senegal/Ko/ARDX/2000 envelope glycoprotein (E) gene, partial cds1501150114%0.082%GU073158.1Select seq gb|GU073145.1|Yellow fever virus strain Senegal/Ke/ArD149213/2000 envelope glycoprotein (E) gene, partial cds1501150114%0.082%GU073145.1Select seq gb|GU073144.1|Yellow fever virus strain Senegal/Ke/ArD149194/2000 envelope glycoprotein (E) gene, partial cds1501150114%0.082%GU073144.1Select seq gb|GU073136.1|Yellow fever virus strain Mali/Ba/HA872/1987 envelope glycoprotein (E) gene, partial cds1501150114%0.082%GU073136.1Select seq gb|GU073166.1|Yellow fever virus strain Senegal/Ko/HD117294/1995 envelope glycoprotein (E) gene, partial cds1498149814%0.082%GU073166.1Select seq gb|GU073143.1|Yellow fever virus strain Senegal/Ke/ArD149179/2000 envelope glycoprotein (E) gene, partial cds1498149814%0.082%GU073143.1Select seq gb|GU073152.1|Yellow fever virus strain Senegal/Ke/ArD156468/2001 envelope glycoprotein (E) gene, partial cds1489148914%0.082%GU073152.1Select seq gb|GU073141.1|Yellow fever virus strain Senegal/Ke/AnD26923/1978 envelope glycoprotein (E) gene, partial cds1489148914%0.082%GU073141.1Select seq gb|GU073137.1|Yellow fever virus strain Mali/Sa/ArA20267/1987 envelope glycoprotein (E) gene, partial cds1489148914%0.082%GU073137.1Select seq gb|GU073156.1|Yellow fever virus strain Senegal/Ke/ArD25112/1977 envelope glycoprotein (E) gene, partial cds1483148314%0.082%GU073156.1Select seq gb|GU073153.1|Yellow fever virus strain Senegal/Ke/ArD156583/2001 envelope glycoprotein (E) gene, partial cds1483148314%0.082%GU073153.1Select seq gb|GU073135.1|Yellow fever virus strain Gambia/MK/ArD27797/1979 envelope glycoprotein (E) gene, partial cds1480148014%0.081%GU073135.1Select seq gb|GU073163.1|Yellow fever virus strain Senegal/Ko/ArD114987/1995 envelope glycoprotein (E) gene, partial cds1471147114%0.081%GU073163.1Select seq gb|AY502949.1|Yellow fever virus strain Guinea/2000/human envelope protein (env) gene, partial cds1469146914%0.082%AY502949.1Select seq gb|GU073159.1|Yellow fever virus strain Senegal/Ko/ArD114891/1995 envelope glycoprotein (E) gene, partial cds1467146714%0.082%GU073159.1Select seq gb|GU073149.1|Yellow fever virus strain Senegal/Ke/ArD149815/2000 envelope glycoprotein (E) gene, partial cds1467146714%0.082%GU073149.1Select seq gb|GU073140.1|Yellow fever virus strain Senegal/Ka/HD122030/1996 envelope glycoprotein (E) gene, partial cds1467146714%0.082%GU073140.1Select seq gb|GU073161.1|Yellow fever virus strain Senegal/Ko/ArD114970/1995 envelope glycoprotein (E) gene, partial cds1465146514%0.081%GU073161.1Select seq gb|GU073148.1|Yellow fever virus strain Senegal/Ke/ArD149791/2000 envelope glycoprotein (E) gene, partial cds1465146514%0.081%GU073148.1Select seq gb|GU073142.1|Yellow fever virus strain Senegal/Ke/ArD121040/1996 envelope glycoprotein (E) gene, partial cds1460146014%0.082%GU073142.1Select seq gb|GU073146.1|Yellow fever virus strain Senegal/Ke/ArD149214/2000 envelope glycoprotein (E) gene, partial cds1456145614%0.082%GU073146.1Select seq gb|AY495561.1|Yellow fever virus isolate DNA-YF-4 protein E gene, partial cds1449144915%0.081%AY495561.1Select seq gb|GU073164.1|Yellow fever virus strain Senegal/Ko/ArD114988/1995 envelope glycoprotein (E) gene, partial cds1447144714%0.082%GU073164.1Select seq gb|GU073131.1|Yellow fever virus strain Cameroon/HD78359/1990 envelope glycoprotein (E) gene, partial cds1447144714%0.081%GU073131.1Select seq gb|AY359908.2|Yellow fever virus isolate DNA-YF-2 protein E gene, partial cds1447144715%0.081%AY359908.2Select seq gb|GU073157.1|Yellow fever virus strain Senegal/Ke/ArD99740/1993 envelope glycoprotein (E) gene, partial cds1445144514%0.082%GU073157.1Select seq gb|GU073147.1|Yellow fever virus strain Senegal/Ke/ArD149215/2000 envelope glycoprotein (E) gene, partial cds1442144214%0.082%GU073147.1Select seq gb|L02865.1|YFVENVAYellow fever virus wild-type envelope protein (env)1442144214%0.082%L02865.1Select seq gb|GU073160.1|Yellow fever virus strain Senegal/Ko/ArD114896/1995 envelope glycoprotein (E) gene, partial cds1440144014%0.081%GU073160.1Select seq gb|AY495571.1|Yellow fever virus vaccine flavimun experimental lot 3000131 protein E gene, partial cds1440144015%0.081%AY495571.1Select seq gb|AY495567.1|Yellow fever virus vaccine flavimun experimental lot 3000129 protein E gene, partial cds1440144015%0.081%AY495567.1Select seq gb|GU073130.1|Yellow fever virus strain CAR/Bo/ArB5656/1974 envelope glycoprotein (E) gene, partial cds1438143814%0.081%GU073130.1Select seq gb|AY359909.1|Yellow fever virus isolate DNA-YF-3 protein E gene, partial cds1438143815%0.081%AY359909.1Select seq gb|GU073139.1|Yellow fever virus strain Senegal/Ka/ArD122522/1996 envelope glycoprotein (E) gene, partial cds1436143614%0.082%GU073139.1Select seq gb|AY359907.1|Yellow fever virus isolate DNA-YF-1 protein E gene, partial cds1436143614%0.081%AY359907.1Select seq gb|U23574.1|YFU23574Yellow fever virus isolate Dar1279/Senegal/1965/Human envelope protein (E) mRNA, partial cds1436143614%0.081%U23574.1Select seq gb|GU073133.1|Yellow fever virus strain CotedIvoire/SS/ARM154/1995 envelope glycoprotein (E) gene, partial cds1433143314%0.081%GU073133.1Select seq gb|AY495558.1|Yellow fever virus isolate DNA-YF-1 protein E gene, partial cds1433143315%0.081%AY495558.1Select seq gb|AY839635.1|Yellow fever virus strain ArD76320/Senegal90 envelope protein gene, partial cds1433143314%0.081%AY839635.1Select seq gb|L02866.1|YFVENVBYellow fever virus envelope protein (env)1433143314%0.081%L02866.1Select seq gb|GU073150.1|Yellow fever virus strain Senegal/Ke/ArD149887/2000 envelope glycoprotein (E) gene, partial cds1431143114%0.081%GU073150.1Select seq gb|GU073162.1|Yellow fever virus strain Senegal/Ko/ArD114972/1995 envelope glycoprotein (E) gene, partial cds1429142914%0.081%GU073162.1Select seq gb|AY495569.1|Yellow fever virus vaccine flavimun experimental lot 3000130 protein E gene, partial cds1429142914%0.081%AY495569.1Select seq gb|AY495562.1|Yellow fever virus isolate DNA-YF-4 protein E gene, partial cds1429142915%0.080%AY495562.1Select seq gb|AY495566.1|Yellow fever virus isolate DNA-YF-7 protein E gene, partial cds1427142715%0.080%AY495566.1Select seq gb|AY495559.1|Yellow fever virus isolate DNA-YF-2 protein E gene, partial cds1427142714%0.081%AY495559.1Select seq gb|GU073132.1|Yellow fever virus strain CotedIvoire/De/ArA523/1996 envelope glycoprotein (E) gene, partial cds1424142414%0.081%GU073132.1Select seq gb|JN226796.1|Wesselsbron virus from South Africa, complete genome1416184975%0.066%JN226796.1Select seq gb|U23580.1|YFU23580Yellow fever virus isolate V-528A/Colombia/1979/Mosquito envelope protein (E) mRNA, partial cds1415141514%0.081%U23580.1Select seq gb|GU073165.1|Yellow fever virus strain Senegal/Ko/ArD114989/1995 envelope glycoprotein (E) gene, partial cds1406140614%0.081%GU073165.1Select seq gb|U23570.1|YFU23570Yellow fever virus isolate AR350397/Brazil/1979/Mosquito envelope protein (E) mRNA, partial cds1406140614%0.081%U23570.1Select seq gb|AY495573.1|Yellow fever virus reference stock RKI-17D-112/95 protein E gene, partial cds1404140414%0.081%AY495573.1Select seq gb|AY632543.1|Sepik virus polyprotein gene, complete cds1402178976%0.066%AY632543.1Select seq gb|AY495570.1|Yellow fever virus vaccine flavimun experimental lot 3000130 protein E gene, partial cds1402140214%0.080%AY495570.1Select seq gb|AY495568.1|Yellow fever virus vaccine flavimun experimental lot 3000129 protein E gene, partial cds1398139814%0.080%AY495568.1Select seq gb|DQ859063.1|Sepik virus strain 7148 polyprotein gene, complete cds1397178476%0.066%DQ859063.1Select seq gb|AY495572.1|Yellow fever virus vaccine flavimun experimental lot 3000131 protein E gene, partial cds1397139714%0.080%AY495572.1Select seq gb|U23579.1|YFU23579Yellow fever virus isolate T790882/Trinidad/1979/Mosquito envelope protein (E) mRNA, partial cds1397139714%0.081%U23579.1Select seq gb|U23568.1|YFU23568Yellow fever virus isolate 788379/Trinidad/1979/Mosquito envelope protein (E) mRNA, partial cds1393139314%0.081%U23568.1Select seq gb|GU073134.1|Yellow fever virus strain CotedIvoire/To/DakArAmt7/1973 envelope glycoprotein (E) gene, partial cds1389138913%0.081%GU073134.1Select seq gb|DQ837642.1|Sepik virus strain MK7148, complete genome1388177576%0.066%DQ837642.1Select seq gb|AY495574.1|Yellow fever virus reference stock RKI-17D-112/95 protein E gene, partial cds1380138014%0.080%AY495574.1Select seq gb|U23572.1|YFU23572Yellow fever virus isolate BA-55/Nigeria/1986/Human envelope protein (E) mRNA, partial cds1379137914%0.081%U23572.1Select seq gb|GU073151.1|Yellow fever virus strain Senegal/Ke/ArD156029/2001 envelope glycoprotein (E) gene, partial cds1370137013%0.081%GU073151.1Select seq gb|U23567.1|YFU23567Yellow fever virus isolate 56205/Nigeria/1991/Human envelope protein (E) mRNA, partial cds1370137014%0.080%U23567.1Select seq gb|U23566.1|YFU23566Yellow fever virus isolate 1914-81/Ecuador/1981/Human envelope protein (E) mRNA, partial cds1370137014%0.080%U23566.1Select seq gb|U23565.1|YFU23565Yellow fever virus isolate 1362/Peru/1977/Human envelope protein (E) mRNA, partial cds1370137014%0.080%U23565.1Select seq gb|GU073138.1|Yellow fever virus strain Mauritania/Ro/HD47471/1987 envelope glycoprotein (E) gene, partial cds1306130613%0.080%GU073138.1Select seq gb|U52422.1|YFU52422Yellow fever virus Uga48 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1285128511%0.084%U52422.1Select seq gb|U52392.1|YFU52392Yellow fever virus Car77(883) core, pre-membrane, membrane and envelope proteins mRNA, partial cds1269126911%0.083%U52392.1Select seq gb|DQ859067.1|Potiskum virus strain IBAN 10069 polyprotein gene, complete cds1191150863%0.066%DQ859067.1Select seq gb|AF369669.1|AF369669Yellow fever virus strain 14 FA polyprotein mRNA, partial cds115011506%0.098%AF369669.1Select seq gb|U52398.1|YFU52398Yellow fever virus Ecuador79 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1137113711%0.081%U52398.1Select seq gb|U52416.1|YFU52416Yellow fever virus Trinidad54 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1133113311%0.081%U52416.1Select seq gb|DQ859062.1|Saboya virus strain Dak AR D4600 polyprotein gene, complete cds1124130065%0.065%DQ859062.1Select seq gb|U52404.1|YFU52404Yellow fever virus Panama74 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1115111511%0.081%U52404.1Select seq gb|U52389.1|YFU52389Yellow fever virus Brazil35 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1113111311%0.081%U52389.1Select seq gb|U52403.1|YFU52403Yellow fever virus Nigeria46 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1104110411%0.080%U52403.1Select seq gb|U52419.1|YFU52419Yellow fever virus Trinidad79 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1079107911%0.080%U52419.1Select seq gb|U52410.1|YFU52410Yellow fever virus Peru95(153) core, pre-membrane, membrane and envelope proteins mRNA, partial cds1074107411%0.080%U52410.1Select seq gb|U52409.1|YFU52409Yellow fever virus Peru95(149) core, pre-membrane, membrane and envelope proteins mRNA, partial cds1072107211%0.080%U52409.1Select seq gb|U52413.1|YFU52413Yellow fever virus Senegal65 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1054105411%0.079%U52413.1Select seq gb|AF162449.1|AF162449Yellow fever virus isolate PER 1 envelope protein gene, partial cds9109109%0.080%AF162449.1Select seq gb|AF312554.1|AF312554Yellow fever virus glycoprotein E gene, partial cds9049049%0.080%AF312554.1Select seq gb|AF162451.1|AF162451Yellow fever virus isolate PER 3 envelope protein gene, partial cds9049049%0.080%AF162451.1Select seq gb|AF162452.1|AF162452Yellow fever virus isolate PER 4 envelope protein gene, partial cds9019019%0.080%AF162452.1Select seq gb|AF162450.1|AF162450Yellow fever virus isolate PER 2 envelope protein gene, partial cds8958959%0.080%AF162450.1Select seq gb|AF013417.1|AF013417Yellow fever virus strain TN-96 NS5 protein (NS5) gene, partial cds88188110%0.079%AF013417.1Select seq gb|U52424.1|YFU52424Yellow fever virus Uga48 non-structural protein 4A mRNA, partial cds8128127%0.084%U52424.1Select seq gb|AF369673.1|AF369673Yellow fever virus strain HB 1504 polyprotein mRNA, partial cds7857856%0.086%AF369673.1Select seq gb|AF369697.1|AF369697Yellow fever virus strain LSF 4 polyprotein mRNA, partial cds7717716%0.086%AF369697.1Select seq gb|AF369692.1|AF369692Yellow fever virus strain M 90-5 polyprotein mRNA, partial cds7677676%0.085%AF369692.1Select seq gb|AF369696.1|AF369696Yellow fever virus strain Z 19039 polyprotein mRNA, partial cds7627626%0.085%AF369696.1Select seq gb|AF369695.1|AF369695Yellow fever virus strain SE 7445 polyprotein mRNA, partial cds7627626%0.085%AF369695.1Select seq gb|DQ859057.1|Bouboui virus strain DAK AR B490 polyprotein gene, complete cds758155052%0.067%DQ859057.1Select seq gb|AF369676.1|AF369676Yellow fever virus strain BC 7914 polyprotein mRNA, partial cds7587586%0.085%AF369676.1Select seq gb|AY839631.1|Yellow fever virus strain HB1782/CAR86 polyprotein gene, partial cds7557556%0.085%AY839631.1Select seq gb|AF369694.1|AF369694Yellow fever virus strain A 709-4-A2 polyprotein mRNA, partial cds7497496%0.085%AF369694.1Select seq gb|AF369675.1|AF369675Yellow fever virus strain Couma polyprotein mRNA, partial cds7497496%0.085%AF369675.1Select seq gb|JX012100.1|Yellow fever virus isolate Ethiopia1966a polyprotein gene, partial cds7477476%0.085%JX012100.1Select seq gb|DQ859066.1|Jugra virus strain P-9-314 polyprotein gene, complete cds746132153%0.067%DQ859066.1Select seq gb|AF369674.1|AF369674Yellow fever virus strain Serie 227 polyprotein mRNA, partial cds7447446%0.085%AF369674.1Select seq gb|AF369672.1|AF369672Yellow fever virus strain ArB 17239 polyprotein mRNA, partial cds7447446%0.085%AF369672.1Select seq gb|JX012103.1|Yellow fever virus isolate Ethiopia1966d polyprotein gene, partial cds7427426%0.085%JX012103.1Select seq gb|JX012097.1|Yellow fever virus isolate Sudan2003 polyprotein gene, partial cds7407406%0.085%JX012097.1Select seq gb|U52394.1|YFU52394Yellow fever virus Car77(883) non-structural protein 4A mRNA, partial cds7377377%0.081%U52394.1Select seq gb|AY839633.1|Yellow fever virus strain ETH2777/Ethiopia61 polyprotein gene, partial cds7317316%0.085%AY839633.1Select seq gb|JX012099.1|Yellow fever virus isolate Ethiopia1961d polyprotein gene, partial cds7267266%0.085%JX012099.1Select seq gb|JX012098.1|Yellow fever virus isolate Ethiopia1961c polyprotein gene, partial cds7197196%0.085%JX012098.1Select seq gb|U52397.1|YFU52397Yellow fever virus Car77(900) non-structural protein 4A mRNA, partial cds7177177%0.081%U52397.1Select seq gb|AY540464.1|Yellow fever virus strain BeAr513008 polyprotein gene, partial cds7087086%0.083%AY540464.1Select seq gb|AY540477.1|Yellow fever virus strain 1345 polyprotein gene, partial cds7047046%0.083%AY540477.1Select seq gb|AY540467.1|Yellow fever virus strain BeAr513292 polyprotein gene, partial cds7047046%0.083%AY540467.1Select seq gb|AY540449.1|Yellow fever virus strain BeH203410 polyprotein gene, partial cds7047046%0.083%AY540449.1Select seq gb|AY540475.1|Yellow fever virus strain V528A polyprotein gene, partial cds6996996%0.083%AY540475.1Select seq gb|AY540473.1|Yellow fever virus strain "Tennessee" polyprotein gene, partial cds6996996%0.083%AY540473.1Select seq gb|AY540472.1|Yellow fever virus strain BeAr544276 polyprotein gene, partial cds6996996%0.083%AY540472.1Select seq gb|AY540466.1|Yellow fever virus strain BeAr513060 polyprotein gene, partial cds6996996%0.083%AY540466.1Select seq gb|AY540465.1|Yellow fever virus strain BeH512772 polyprotein gene, partial cds6996996%0.083%AY540465.1Select seq gb|AY540459.1|Yellow fever virus strain BeAr424083 polyprotein gene, partial cds6996996%0.083%AY540459.1Select seq gb|AY540455.1|Yellow fever virus strain BeH385780 polyprotein gene, partial cds6996996%0.083%AY540455.1Select seq gb|AY540452.1|Yellow fever virus strain BeAr233436 polyprotein gene, partial cds6996996%0.083%AY540452.1Select seq gb|AY540476.1|Yellow fever virus strain INS347613 polyprotein gene, partial cds6956956%0.083%AY540476.1Select seq gb|AY540470.1|Yellow fever virus strain BeAr527547 polyprotein gene, partial cds6956956%0.083%AY540470.1Select seq gb|AY540447.1|Yellow fever virus strain BeAr142658 polyprotein gene, partial cds6956956%0.083%AY540447.1Select seq gb|AY540436.1|Yellow fever virus strain BeAr628124 polyprotein gene, partial cds6906906%0.083%AY540436.1Select seq gb|DQ872411.1|Yellow fever virus strain GML902621 polyprotein gene, partial cds6906906%0.083%DQ872411.1Select seq gb|AY540481.1|Yellow fever virus strain CAREC797984 polyprotein gene, partial cds6906906%0.083%AY540481.1Select seq gb|AY540463.1|Yellow fever virus strain BeAr512943 polyprotein gene, partial cds6906906%0.083%AY540463.1Select seq gb|AY540462.1|Yellow fever virus strain BeAn510268 polyprotein gene, partial cds6906906%0.083%AY540462.1Select seq gb|AY540454.1|Yellow fever virus strain BeAr350397 polyprotein gene, partial cds6906906%0.083%AY540454.1Select seq gb|AY540453.1|Yellow fever virus strain BeH233393 polyprotein gene, partial cds6906906%0.083%AY540453.1Select seq gb|AY540450.1|Yellow fever virus strain BeAr233164 polyprotein gene, partial cds6906906%0.083%AY540450.1Select seq gb|AY540444.1|Yellow fever virus strain BeH107714 polyprotein gene, partial cds6906906%0.083%AY540444.1Select seq gb|DQ859056.1|Banzi virus strain SAH 336 polyprotein gene, complete cds688146461%0.066%DQ859056.1Select seq gb|AY540485.1|Yellow fever virus strain CAREC891957 polyprotein gene, partial cds6866866%0.083%AY540485.1Select seq gb|AY540484.1|Yellow fever virus strain CAREC891954 polyprotein gene, partial cds6866866%0.083%AY540484.1Select seq gb|AY540483.1|Yellow fever virus strain CAREC890692 polyprotein gene, partial cds6866866%0.083%AY540483.1Select seq gb|AY540482.1|Yellow fever virus strain CAREC889920 polyprotein gene, partial cds6866866%0.083%AY540482.1Select seq gb|AY540480.1|Yellow fever virus strain Jimenez polyprotein gene, partial cds6866866%0.083%AY540480.1Select seq gb|AY540460.1|Yellow fever virus strain BeAr511437 polyprotein gene, partial cds6866866%0.083%AY540460.1Select seq gb|AY540441.1|Yellow fever virus strain BeAn23536 polyprotein gene, partial cds6866866%0.083%AY540441.1Select seq gb|AY437135.1|Yellow fever virus polyprotein gene, partial cds6826826%0.083%AY437135.1Select seq gb|AY540487.1|Yellow fever virus strain P128MC polyprotein gene, partial cds6816816%0.083%AY540487.1Select seq gb|AY540479.1|Yellow fever virus strain 614819 polyprotein gene, partial cds6816816%0.083%AY540479.1Select seq gb|AY540468.1|Yellow fever virus strain BeAr527785 polyprotein gene, partial cds6816816%0.083%AY540468.1Select seq gb|AY540458.1|Yellow fever virus strain BeH425381 polyprotein gene, partial cds6816816%0.083%AY540458.1Select seq gb|AY540443.1|Yellow fever virus strain BeAr44824 polyprotein gene, partial cds6816816%0.083%AY540443.1Select seq gb|AY540442.1|Yellow fever virus strain BeAr46299 polyprotein gene, partial cds6816816%0.083%AY540442.1Select seq gb|L40951.1|FVVNS5PBanzi virus nonstructural protein 5 (NS5) gene, partial cds67967923%0.067%L40951.1Select seq gb|AY540488.1|Yellow fever virus strain PHO42H polyprotein gene, partial cds6776776%0.082%AY540488.1Select seq gb|AY540486.1|Yellow fever virus strain CAREC9515207 polyprotein gene, partial cds6776776%0.082%AY540486.1Select seq gb|AY540461.1|Yellow fever virus strain BeH511843 polyprotein gene, partial cds6776776%0.082%AY540461.1Select seq gb|AY540438.1|Yellow fever virus strain BeAN131 polyprotein gene, partial cds6776776%0.082%AY540438.1Select seq gb|FJ875520.1|Yellow fever virus strain SPAn289568 polyprotein gene, partial cds6726726%0.082%FJ875520.1Select seq gb|FJ875518.1|Yellow fever virus strain SPAn288183 polyprotein gene, partial cds6726726%0.082%FJ875518.1Select seq gb|EU303239.1|Yellow fever virus note H203410 nonstructural protein 5 (NS5) gene, partial cds6726727%0.079%EU303239.1Select seq gb|AY540469.1|Yellow fever virus strain BeAr527198 polyprotein gene, partial cds6726726%0.082%AY540469.1Select seq gb|AY540440.1|Yellow fever virus strain BeAr189 polyprotein gene, partial cds6726726%0.082%AY540440.1Select seq gb|AY540439.1|Yellow fever virus strain BeAr162 polyprotein gene, partial cds6726726%0.082%AY540439.1Select seq gb|HM582843.1|Yellow fever virus strain BeH613582 polyprotein gene, partial cds6686686%0.083%HM582843.1Select seq gb|FJ875517.1|Yellow fever virus strain SPH258595 polyprotein gene, partial cds6686686%0.082%FJ875517.1Select seq gb|AY540456.1|Yellow fever virus strain BeH379501 polyprotein gene, partial cds6686686%0.082%AY540456.1Select seq gb|AY540437.1|Yellow fever virus strain BeH111 polyprotein gene, partial cds6686686%0.082%AY540437.1Select seq gb|DQ859060.1|Edge Hill virus strain YMP 48 polyprotein gene, complete cds666142569%0.066%DQ859060.1Select seq gb|HM582848.1|Yellow fever virus strain BeAr631464 polyprotein gene, partial cds6646646%0.083%HM582848.1Select seq gb|AY540434.1|Yellow fever virus strain OBS8026 polyprotein gene, partial cds6636636%0.082%AY540434.1Select seq gb|HM582839.1|Yellow fever virus strain TVP11646 polyprotein gene, partial cds6616616%0.082%HM582839.1Select seq gb|HM582845.1|Yellow fever virus strain BeAr527785 polyprotein gene, partial cds6576576%0.082%HM582845.1Select seq gb|AY161928.1|Yellow fever virus strain 1368 polyprotein gene, partial cds6556556%0.082%AY161928.1Select seq gb|DQ859065.1|Uganda S virus polyprotein gene, complete cds654135665%0.066%DQ859065.1Select seq gb|AY540451.1|Yellow fever virus strain BeAn232869 polyprotein gene, partial cds6546546%0.082%AY540451.1Select seq gb|AY540490.1|Yellow fever virus strain 35708 polyprotein gene, partial cds6506506%0.081%AY540490.1Select seq gb|AY540474.1|Yellow fever virus strain INS382060 polyprotein gene, partial cds6506506%0.081%AY540474.1Select seq gb|HQ123568.1|Yellow fever virus strain PH71191 polyprotein gene, partial cds6466466%2e-18082%HQ123568.1Select seq gb|AY690831.1|Yellow fever virus strain SPU 160/03/23 polyprotein gene, partial cds6456455%8e-18085%AY690831.1Select seq gb|AY540457.1|Yellow fever virus strain BeH413820 polyprotein gene, partial cds6456456%8e-18081%AY540457.1Select seq gb|AY161951.1|Yellow fever virus strain OBS7904 polyprotein gene, partial cds6416416%9e-17981%AY161951.1Select seq gb|AY540445.1|Yellow fever virus strain BeAn142028 polyprotein gene, partial cds6416416%9e-17981%AY540445.1Select seq gb|AY540433.1|Yellow fever virus strain OBS7937 polyprotein gene, partial cds6416416%9e-17981%AY540433.1Select seq gb|AY540431.1|Yellow fever virus strain OBS7687 polyprotein gene, partial cds6416416%9e-17981%AY540431.1Select seq gb|AF369683.1|AF369683Yellow fever virus strain H117505 polyprotein mRNA, partial cds6416416%9e-17981%AF369683.1Select seq gb|AY161941.1|Yellow fever virus strain OBS2250 polyprotein gene, partial cds6366366%4e-17781%AY161941.1Select seq gb|AY161938.1|Yellow fever virus strain Cepa#2 polyprotein gene, partial cds6366366%4e-17781%AY161938.1Select seq gb|AY540432.1|Yellow fever virus strain OBS7549 polyprotein gene, partial cds6366366%4e-17781%AY540432.1Select seq gb|AF369685.1|AF369685Yellow fever virus strain 56205 polyprotein mRNA, partial cds6366366%4e-17781%AF369685.1Select seq gb|AF369678.1|AF369678Yellow fever virus strain T. Adeoye polyprotein mRNA, partial cds6366366%4e-17781%AF369678.1Select seq gb|AY161948.1|Yellow fever virus strain 03535098 polyprotein gene, partial cds6326326%5e-17681%AY161948.1Select seq gb|AY161939.1|Yellow fever virus strain Cepa#1 polyprotein gene, partial cds6326326%5e-17681%AY161939.1Select seq gb|AY161934.1|Yellow fever virus strain ARVO544 polyprotein gene, partial cds6326326%5e-17681%AY161934.1Select seq gb|AY540478.1|Yellow fever virus strain OBS5041 polyprotein gene, partial cds6326326%5e-17681%AY540478.1Select seq gb|AF369682.1|AF369682Yellow fever virus strain H117491 polyprotein mRNA, partial cds6326326%5e-17681%AF369682.1Select seq gb|AF369680.1|AF369680Yellow fever virus strain M. Adejumo polyprotein mRNA, partial cds6326326%5e-17681%AF369680.1Select seq gb|AF369681.1|AF369681Yellow fever virus strain A. Adeoye polyprotein mRNA, partial cds6276276%2e-17481%AF369681.1Select seq gb|AF369679.1|AF369679Yellow fever virus strain A. Jimo polyprotein mRNA, partial cds6276276%2e-17481%AF369679.1Select seq gb|HM582846.1|Yellow fever virus strain 15094 polyprotein gene, partial cds6256256%7e-17481%HM582846.1Select seq gb|AY161933.1|Yellow fever virus strain 1914 polyprotein gene, partial cds6256256%7e-17481%AY161933.1Select seq gb|AY161932.1|Yellow fever virus strain 1899/81 polyprotein gene, partial cds6256256%7e-17481%AY161932.1Select seq gb|DQ872412.1|Yellow fever virus strain CAREC788379 polyprotein gene, partial cds6236236%3e-17381%DQ872412.1Select seq gb|AY161947.1|Yellow fever virus strain OBS6530 polyprotein gene, partial cds6236236%3e-17381%AY161947.1Select seq gb|AY161945.1|Yellow fever virus strain OBS2243 polyprotein gene, partial cds6236236%3e-17381%AY161945.1Select seq gb|AY161944.1|Yellow fever virus strain HEB4246 polyprotein gene, partial cds6236236%3e-17381%AY161944.1Select seq gb|AF369684.1|AF369684Yellow fever virus strain BA 55 polyprotein mRNA, partial cds6236236%3e-17381%AF369684.1Select seq gb|AF369677.1|AF369677Yellow fever virus strain IB AR 45244 polyprotein mRNA, partial cds6236236%3e-17381%AF369677.1Select seq gb|KM388820.1|Yellow fever virus strain 3A polyprotein gene, partial cds6216216%9e-17381%KM388820.1Select seq gb|AY161930.1|Yellow fever virus strain 287/78 polyprotein gene, partial cds6196196%3e-17281%AY161930.1Select seq gb|AY161940.1|Yellow fever virus strain OBS2240 polyprotein gene, partial cds6186186%1e-17181%AY161940.1Select seq gb|AY161937.1|Yellow fever virus strain 149 polyprotein gene, partial cds6186186%1e-17181%AY161937.1Select seq gb|AY161935.1|Yellow fever virus strain HEB4224 polyprotein gene, partial cds6186186%1e-17181%AY161935.1Select seq gb|AY161931.1|Yellow fever virus strain R35740 polyprotein gene, partial cds6186186%1e-17181%AY161931.1Select seq gb|AY540446.1|Yellow fever virus strain BeH141816 polyprotein gene, partial cds6186186%1e-17180%AY540446.1Select seq gb|AY161943.1|Yellow fever virus strain HEB4245 polyprotein gene, partial cds6166166%4e-17180%AY161943.1Select seq gb|AY161936.1|Yellow fever virus strain HEB4236(153) polyprotein gene, partial cds6146146%1e-17080%AY161936.1Select seq gb|AY161927.1|Yellow fever virus strain 1362/77 polyprotein gene, partial cds6146146%1e-17080%AY161927.1Select seq gb|AF369689.1|AF369689Yellow fever virus strain SH 1339 polyprotein mRNA, partial cds6146146%1e-17080%AF369689.1Select seq gb|AF369688.1|AF369688Yellow fever virus strain SH 1464 polyprotein mRNA, partial cds6146146%1e-17080%AF369688.1Select seq gb|KM388819.1|Yellow fever virus strain 1A polyprotein gene, partial cds6126125%5e-17082%KM388819.1Select seq gb|AY161929.1|Yellow fever virus strain 1371 polyprotein gene, partial cds6106106%2e-16980%AY161929.1Select seq gb|HM582844.1|Yellow fever virus strain FMD1240 polyprotein gene, partial cds6096096%6e-16981%HM582844.1Select seq gb|AY161950.1|Yellow fever virus strain IQT5591 polyprotein gene, partial cds6096096%6e-16980%AY161950.1Select seq gb|AY161942.1|Yellow fever virus strain HEB4240 polyprotein gene, partial cds6096096%6e-16980%AY161942.1Select seq gb|AF369671.1|AF369671Yellow fever virus strain SH 28580 polyprotein mRNA, partial cds6096096%6e-16980%AF369671.1Select seq gb|AF369670.1|AF369670Yellow fever virus strain HD 38564 polyprotein mRNA, partial cds6096096%6e-16980%AF369670.1Select seq gb|AF369690.1|AF369690Yellow fever virus strain Dar Ar 276 polyprotein mRNA, partial cds6056056%7e-16880%AF369690.1Select seq gb|AF369687.1|AF369687Yellow fever virus strain SH1446 polyprotein mRNA, partial cds6056056%7e-16880%AF369687.1Select seq gb|U52402.1|YFU52402Yellow fever virus Nigeria46 non-structural protein 4A mRNA, partial cds6056057%7e-16878%U52402.1Select seq gb|HM582847.1|Yellow fever virus strain FVB0196 polyprotein gene, partial cds6036036%2e-16780%HM582847.1Select seq gb|AY839632.1|Yellow fever virus strain ArD76320/Senegal90 polyprotein gene, partial cds6016016%8e-16780%AY839632.1Select seq gb|AY161949.1|Yellow fever virus strain OBS6745 polyprotein gene, partial cds6006006%3e-16680%AY161949.1Select seq gb|AF369691.1|AF369691Yellow fever virus strain ArD93388 polyprotein gene, partial cds6006006%3e-16680%AF369691.1Select seq gb|AF369686.1|AF369686Yellow fever virus strain Jose Cachatra polyprotein mRNA, partial cds6006006%3e-16680%AF369686.1Select seq gb|KU308380.1|Bamaga virus isolate CY4270 polyprotein gene, complete cds594137857%1e-16465%KU308380.1Select seq gb|KM388823.1|Yellow fever virus strain 7A polyprotein gene, partial cds5925925%4e-16482%KM388823.1Select seq gb|U52415.1|YFU52415Yellow fever virus Senegal65 non-structural protein 4A mRNA, partial cds5875877%2e-16277%U52415.1
  12. LOCUS KX010996 10823 bp RNA linear VRL 08-MAY-2016 DEFINITION Yellow fever virus isolate CIC3, complete genome. ACCESSION KX010996 VERSION KX010996.1 GI:1024994400 KEYWORDS . SOURCE Yellow fever virus (YFV) ORGANISM Yellow fever virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus; Yellow fever virus group. REFERENCE 1 (bases 1 to 10823) AUTHORS Cui,S., Liang,Z., Wang,Q., Chen,L., Li,X., Li,J., Du,Y., Lu,G., Huo,D., Lyu,Y., Zhang,L., Zheng,Y., Chen,Y., Li,X. and Li,S. TITLE Direct Submission JOURNAL Submitted (25-MAR-2016) Department of Infectious Disease and Endemic Disease Control, Beijing Center for Disease Prevetion and Control, 16 Hepingli Middle Street, Dongcheng District, Beijing 100013, China COMMENT ##Assembly-Data-START## Assembly Method :: samtools v. v1.2 Sequencing Technology :: IonTorrent ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10823 /organism="Yellow fever virus" /mol_type="genomic RNA" /isolate="CIC3" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:11089" /country="China" /collection_date="18-Mar-2016" /note="clinical-imported case 3" CDS 121..10359 /note="gp1" /codon_start=1 /product="polyprotein" /protein_id="ANC33491.1" /db_xref="GI:1024994401" /translation="MSGRKAQGRTLGVNMVRRGVRSLSNKIKQKTKQIGNRPGPSRGV QGFIFFFLFNILTGKKLTAHLKKLWRMLDPRQGLAVLRKVKRVVASLMRGLASRKRRS NEMAMVPLLLLGLLALSGGVTLVRKNRWLLLNVTAEDLGKTFSVGTGNCTTNILEAKY WCPDSMEYNCPNLSPREEPDDIDCWCYGVENVRVAYGRCDAVGRSKRSRRAIDLPTHE NHGLKTRQEKWMTGRMGERQLQKIERWLVRNPFFAVTALAIAYLVGNNTTQRVVIALL VLAVGPAYSAHCIGITDRDFIEGVHGGTWVSATLEQDKCVTVMAPDKPSLDISLQTVA IDGPAEARKVCYSAVLTHVKINDKCPSTGEAHLAEENDGDNACKRTYSDRGWGNGCGL FGKGSIVACAKFTCAKSMSLFEVDQTKIQYVIRAQLHVGAKQENXNTDIKTLKFXALS GSQEAEFTGYGKATLECQVQTAVDFGNSYIAEMEKDSWIVDRQWAQDLTLPWQSGSGG IWREMHHLVEFEPPHAATIRVLALGNQEGSLKTALTGAMRVTKDENDNNLYKLHGGHV SCRVKLSALTLKGTSYKMCTDKMSFVKNPTDTGHGTVVMQVKVPKGAPCKIPVIVADD LTAAVNKGILVTVNPIASTNDDEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGSSIG KXFTQTMKGAERLAVMGDAAWDFSSAGGFFTSVGKGIHTVFXSAFQGLFGGLSWITKV IMGAVLIWVGINTRNMTMSMSMILVGVIMMFLSLGVGADQGCAVNFGKRELKCGDGIF VFRDSDDWLTKYSYYPEDPVKLASIIKASHEEGKCGLNSVDSLEHEMWRSRADEINAI FEENEVDISVVVQDPKNIYQRGTHPFSRIRDGLQYGWKTWGKNLVFSPGRKNGSFIID GKSRKECPFSNRVWNSFQIEEFGMGVFTTRVFMDATFDYSVDCDGAILGAAVNGKKSA HGSPTFWMGSHEVNGTWMIHTLETLDYKECEWPLTHTIGTSVEESDMFMPRSIGGPVS SHNRIPGYKVQTNGPWMQVPLEVKREVCPGTSVVVDSNCDGRGKSTRSTTDSGKIIPE WCCRSCTMPPVSFHGSDGCWYPMEIRPMKTSDSHLVRSWVTAGEVHAVPFGLVSMMIA MEVVLRRRQGPKQMLVGGVVLLGAMLVGQVTVLDLVKFVVAVGLHFHEINNGGDAMYM ALIASFSIRPGLLMGFGLRTLWSPRERLVMAFGAAMVEIALGGMMGGLWQYLNAVSLC VLTINAISSRKASNMILPLMALMTPMTMHEVRMATMLFCTVVIIGVLHQNSKXTSXXK TIPIVALTLTSYMGLTQPFLGLCAYMSTQVFGRRSIPVNEALAAAGLVGVLAGLAFQD MENFLGPIAVGGILMMLVSVAGRVDGLELRKLGEISWEEEAEISGSSSRYDXALSEQG EFKLLSEDKVPWDQIVMTSLALVGAAIHPFALLLVLGGWILHIKGARRSGDVLWDIPT PKVIEECEHLEDGIYGIFQSTFLGASQRGVGVAQGGVFHTMWHVTRGAFLLRNGKKLV PSWASVKEDLVAYGGSWKLDGRWDGEEEVQLIAAVPGKSVVNVQTKPSLFKVKNGGEI GAVALDYPSGTSGSPIVNRNGEVVGLYGNGILVGDNSFVSAISQTELKEESKEELQEI PTMLKKGMTTILDFHPGAGKTRRFLPQILAECARRRLRTLVLAPTRVVLSEMKEAFQG LDVKFHTQAFSAHGSGKEVIDAMCHATLTYRMLEPTRVVNWEVIIMDEAHFLDPASIA ARGWAAHRARANESATILMTATPPGTSDEFPHSNGEIEDVQTDIPSEPWTTGHEWILA DKRPTAWFLPSIRAANVMAASLRKAGKNVVVLNRKTFEKEYPTIKQKKPDFILATDIA EMGANLCVERVLDCRTAYKPVLVDEGKKVAIKGPLRISASSAAQRRGRIGRNPNRDGD SYYYSEPTSEDNAHHVCWLEASMLLDNMEVRGGMVAPLYGIEGTKTPVSPGEMRLRDD QRRVFRELVRGCDLPVWLAWQVAKAGLKTNDRKWCFEGPEEHXILNDNGETVKCRSPG GAKRALRPRWCDERVSSDQSALADFIKFAEGRRGAAEMLVVLTELPDFLAKKGGEAMD TISVFLHSEEGSRAYRNALSMMPEAMTIVMLFLLAGLLTSGAVIFFMSPKGMSRMSMA MGTMAGSGYLMFLGGVKPTHISYVMLIFFVLMVVIIPEPGQQRSIQDNQVAYLIIGIL TLLSVVAANELGMLEKTKEDFFGKXDITTPSGAIPWSWPDLDLKPGAAWTVXVGIVTM LSPMLHHWIKVEYGNLSLSGIAQSASVLSFMDKGIPFMKMNISVVILLVSGWNSITVI PLLCGIGGAMLHWTLILPGIKAQQSKLAQKRVFHGVAKNPVVXGNPTADIEEAPEMPA LYEKKLALYLLLALSLMSVAMCRTPFSLAEGIVLSSAALGPLIEGNTSLLWNGPMAVS MTGVMRGNYYAFVGVMYNLWKMKTGRRGRASGKTLGEVWKRELNLLDKQQFEMYKRTD IIEVDRDMARRHLAEGKVDTGVAVSRGTAKLRWFHERGYVKLEGRVTDLGCGRGGWCY YAAAQKEVSGVKGYTLGRDGHEKPMNVQSLGWNIVTFKDKTDXHRLEPLKCETLLCDI GESSPSSATEGERTLRVLDTVEKWLACGVDNFCIKVLAPYMPDVIEKLELLQRRFGGT VIRNPLSRNSTHEMYYVSGARSNITFTVNQTSRLLMRRMRRPTGKVTLEADVILPIGT RSVETDKGPLDKDAIEERVERIKNEYATTWFYDNDNPYRTWHYCGSYVTKTSGSAASM INGVIKILTFPWDRIEEVTRMAMTDTTPFGQQRVFKEKVDTRAKDPPAGTRKIMKVVN RWLFRHLSREKNPRLCTKEEFIAKVRSHAAVGAFLEEQEQWKTANEAVLDPKFWEMVD AERKLHQQGRCQSCVYNMMGKREKKLSEFGKAKGSRAIWYMWLGARFLEFEALGFLNE DHWASRENSGGGVEGIGLQYLGYVIRDLSTKEGGGFYADDTAGWDTRITEADLDDEQE IMSYMSPEQRKLAWAIMEMTXKXKVVKVLRPAPGGKAFMDIISRRDQRGSGQVVTYAL NTITNLKVQLIRMAEAEMVINHQHVQECGENVLERLETWLAENGCDRLSRMAVSGDDC VVRPVDDRFGLALSHLNAMSKVRKDISEWQPSKGWTDWENVPFCSHHFHELVLKDGRK IVVPCRDQDELIGRGRVSPGNGWMIKETACLSKAYANMWSLMYFHKRDMRLLSFAVSS AVPTAWVPSGRTTWSVHGRGEWMTTEDMLDVWNRVWVLNNPHMTDKTTIKEWRDVPYL TKRQDKLCGSLIGMXNRATWASHIHLVIHRIRTLIGQEKFTDYLTVMDRYSVDADLQP GELI" ORIGIN 1 agtaaatccc tgtgtgctaa ttgaggtgca ttggtctgca aatcgagttg ctaggcaata 61 aacacatttg gattwayttt aatcgttcgt tgagcgatta gcagagaact gaccagagaa 121 atgtctggtc gaaaagctca gggtagaacc ctgggcgtca atatggtaag acgaggggtt 181 cgctccttgt caaacaaaat aaaacaaaaa acaaaacaga ttggaaacag acctggccct 241 tcaagaggtg ttcaaggatt tattttcttc tttttgttta acattctgac tgggaaaaag 301 ttgacwgctc atctaaaaaa actctggagg atgcttgatc caaggcaggg gcttgctgta 361 ctgcgaaagg tcaaaagagt tgtagctagc ttaatgagag ggctggcttc caggaaacgt 421 agatccaatg aaatggccat ggtaccactc ctgttactgg gtttgttggc tctatcagga 481 ggagtgaccc tcgtcagaaa gaacagatgg ttgctcctga atgtaactgc tgaagacctg 541 gggaaaacgt tttcagtggg aactgggaat tgcaccacga atattctgga agcaaaatac 601 tggtgccccg actcaatgga atacaattgc cccaatctca gtccaagaga agagccagat 661 gacatagatt gctggtgtta tggagtggaa aatgtcagag tggcctatgg aagatgtgat 721 gcggtagggc gatcaaaacg ctccaggaga gcgattgatc tacccacaca tgagaaccat 781 ggactaaaga ctcggcagga gaagtggatg acaggcagaa tgggtgagag gcagctccag 841 aagattgaaa gatggctggt taggaatcca ttttttgcgg tcacagcatt ggcaatagct 901 tatctggtgg gtaacaacac gacacaacga gtggtcatag cactactggt tctagcggtt 961 ggtccagcgt actctgccca ttgcataggg ataaccgaca gagatttcat tgaaggtgtc 1021 catgggggca cttgggtgtc agccactctg gagcaggaca aatgcgtgac tgtaatggcc 1081 cctgacaaac cttctctgga catctcacta caaacagtgg caatcgatgg accggctgaa 1141 gcgaggaagg tttgctacag tgcagtccta acccatgtga agatcaatga caaatgcccg 1201 agcactggtg aggcccacct tgcagaggaa aatgatggtg acaatgcttg taaacggaca 1261 tattctgaca gaggctgggg caatggctgt ggtctttttg ggaaaggaag catcgtggct 1321 tgtgccaagt ttacatgtgc caaatctatg agtctctttg aggtggatca gaccaaaatc 1381 caatatgtca tcagggccca gctccatgtg ggtgctaaac aggaaaacyg gaacacagac 1441 ataaaaacgc tgaaatttga kgctctttct ggctcacagg aggctgaatt cactggttat 1501 ggaaaggcaa cactagagtg tcaggtccag actgccgtgg actttgggaa cagctacatc 1561 gcagagatgg aaaaagatag ctggatcgtt gaccgccaat gggcacagga cttgacactg 1621 ccatggcaga gtgggagtgg tggcatatgg agagaaatgc accaccttgt tgagtttgag 1681 cccccacatg ctgccacaat tagggtgctg gccttgggca atcaagaagg ctccttgaag 1741 accgctctca caggcgctat gcgcgtcacc aaggatgaga atgacaacaa cttgtacaaa 1801 ctgcacggtg gtcacgtctc ctgtagagtg aaactgtcag ccctcactct caaaggaaca 1861 tcctacaaga tgtgcacaga caaaatgtca tttgtcaaga atccaacgga tacagggcat 1921 ggcacagttg tcatgcaagt aaaggtcccc aaaggggccc catgcaagat tcccgtgatt 1981 gtggcagatg acctaacggc agcagtgaac aaaggcatct tggtcactgt caatcctatt 2041 gcatccacaa atgatgatga agttctgatt gaggtcaatc ccccttttgg ggatagctac 2101 atcatagttg ggactggaga ctcacgactg acctatcagt ggcacaaaga agggagttca 2161 ataggaaaat ygttcacaca gacaatgaaa ggagctgaac gtcttgcagt gatgggtgat 2221 gctgcttggg attttagttc tgctgggggg ttcttcacat ctgtgggaaa aggaatccat 2281 accgtgtttg rctcggcctt ccaggggctg tttggtggct tgagttggat cacgaaagtc 2341 atcatgggag cagtgctcat ctgggtggga ataaacaccc gcaacatgac catgtccatg 2401 tccatgatct tggtaggtgt gatcatgatg tttctttcac taggagttgg ggctgaccaa 2461 ggatgtgctg ttaactttgg gaaacgcgag ctcaaatgcg gagatggcat ctttgtgttt 2521 agagactctg atgactggct cacaaagtac tcatactatc ctgaagaccc tgtcaaattg 2581 gcatccatca ttaaagcctc ccacgaggag ggcaaatgtg gattgaattc agttgattcc 2641 ctcgaacacg agatgtggag gagtagggcg gatgagatca acgccatttt tgaagaaaat 2701 gaagtagaca tctcggtcgt cgtccaagac ccaaagaaca tctaccaaag agggacccac 2761 ccgttctcaa ggatccgtga cggattgcag tatggatgga agacctgggg aaaaaacctt 2821 gttttctcac cagggaggaa gaacggcagc ttcatcattg acgggaagtc acgaaaggag 2881 tgccccttct ctaacagagt gtggaactca ttccagattg aggagtttgg catgggggtc 2941 ttcacaacac gagtgtttat ggacgcgacc tttgactatt cagtggactg tgatggagcc 3001 atcctgggtg cagcggtgaa tggaaagaag agtgcccatg gatcacccac attttggatg 3061 ggaagtcatg aagtcaatgg aacgtggatg atacacactt tggaaactct tgattacaag 3121 gagtgtgaat ggccactgac acacactatt ggaacctcag tagaagaaag tgacatgttc 3181 atgccccggt ccattggagg tccggtgagt tctcacaacc gcatcccggg ttacaaggtg 3241 caaaccaatg ggccatggat gcaagtcccc ctggaagtaa aaagggaagt ctgtccaggg 3301 acaagcgtgg tggtggactc caactgtgat ggacgtggaa aatcaacgag atcaaccact 3361 gacagtggga aaataatccc ggaatggtgt tgcagatctt gyactatgcc tccagtcagc 3421 ttccatggaa gcgatggttg ttggtatcct atggagatca gacccatgaa aacatccgac 3481 agccacctag tgagatcctg ggtgactgca ggagaagttc atgcagtacc ctttggactg 3541 gtgagcatga tgattgccat ggaggtggtg ttgcgcagaa ggcaaggacc aaaacaaatg 3601 ctggtaggag gagttgtgct gcttggagcg atgttagtgg gacaagtcac agtcttagac 3661 cttgtgaagt ttgttgtggc agtgggattg cacttccatg aaattaataa cggaggagat 3721 gccatgtaca tggcattgat tgccagcttt tccatccggc caggcctgct catgggcttt 3781 gggctgcgca cactgtggag tcctcgcgag cgacttgtaa tggcatttgg agcagccatg 3841 gttgagattg ccttaggtgg aatgatgggt gggctttggc agtacttgaa cgccgtttca 3901 ctgtgtgtgc tcaccatcaa tgcaatctca tcaaggaagg cctcaaatat gatcctcccc 3961 ctgatggcac tcatgactcc catgacaatg catgaggtga ggatggcgac gatgctgttc 4021 tgcactgttg tcataatagg ggtgcttcat cagaattcaa aasacacatc wawsmmaaag 4081 accattccca ttgtagccct gacactgacc tcatacatgg gcttgaccca gccctttcta 4141 gggctgtgtg catacatgtc cacgcaggtg tttggcagaa ggagtatacc tgtgaatgaa 4201 gccttggcag cggctggctt ggtgggagtg ctagcagggc tagccttcca agacatggaa 4261 aactttttgg gtccaatagc ggtggggggg atcctcatga tgttagttag tgtggcaggg 4321 agagttgatg gactagagct caggaaactt ggtgaaatct cctgggaaga agaagctgaa 4381 ataagtggaa gctctagccg ctatgatgyg gcactcagtg agcagggtga atttaaactc 4441 ctctcagagg acaaagtgcc ctgggaccag atagtaatga catccctagc cctcgtggga 4501 gcagccatac atccatttgc cctcttgctg gtcttgggag gatggatcct gcacattaaa 4561 ggtgctagga ggagtgggga tgttctttgg gacattccta cgccaaaggt gattgaggaa 4621 tgtgagcacc tggaggatgg gatctatggc atatttcagt caaccttcct tggagcctcg 4681 cagcgaggtg ttggagtggc gcagggaggg gtcttccaca caatgtggca tgtcactagg 4741 ggggcattcc tcttgaggaa tggaaagaaa ctggttccgt cttgggcttc tgtgaaggag 4801 gatctggtgg cttatggtgg ttcctggaaa ctagacggga gatgggatgg tgaggaggaa 4861 gtccaactca tcgctgctgt gcctggaaaa tctgttgtca acgttcaaac aaaaccaagc 4921 ttgttcaarg tgaaaaatgg tggtgagatt ggagcagttg ctctagacta ccccagtgga 4981 acctcaggct cccccattgt gaaccgaaat ggtgaagtgg ttgggctcta tggcaatgga 5041 attctggtgg gtgataactc ctttgtgtct gccatctcac aaactgaatt gaaggaagaa 5101 tccaaagaag aactgcaaga aataccaact atgctgaaaa aaggaatgac caccatcctt 5161 gacttccacc ctggggcggg gaaaacccgt aggttcctgc ctcaaatatt ggcggagtgt 5221 gccagaaggc gtttgcgcac tctggtatta gcacccacca gggttgtttt gtcagagatg 5281 aaagaagctt ttcaggggtt ggatgtgaaa ttccacacac aagctttctc agcccatggg 5341 agtgggaagg aggtcattga cgcaatgtgc catgcaaccc ttacatatag aatgctggaa 5401 ccaacaaggg tagtcaactg ggaggtcatt attatggatg aggcgcactt tctggatcct 5461 gctagcatag cagcgagagg ctgggcggct catagagcaa gagcaaatga gagcgccacc 5521 atacttatga ccgccacccc accaggcacc agtgacgaat tccctcactc caatggtgag 5581 attgaggacg tccagactga catccccagc gagccatgga ccacaggaca tgaatggatc 5641 ttggcggaca agcgcccaac tgcatggttc cttccatcga tcagagcagc aaatgtcatg 5701 gcagcctcgc tgcggaaagc gggaaaaaat gtggtggtac tgaataggaa aacctttgaa 5761 aaggagtacc ccaccattaa gcagaagaaa ccggatttca tccttgccac cgatatcgct 5821 gagatgggag caaacttgtg tgtggagaga gtcttggact gcagaactgc ctacaagcct 5881 gtcctggttg atgaagggaa gaaggtggct atcaaagggc cgctacgaat ctcagcgtca 5941 tcggccgctc agaggagagg acgcattgga cgcaatccca acagagatgg tgactcttac 6001 tactactcag aacctaccag tgaggacaat gcacaccatg tgtgctggct ggaggcttcc 6061 atgctcctgg ataacatgga ggttagaggg gggatggttg ctccacttta tggcattgag 6121 ggaacaaaga ctcccgtctc tccaggagaa atgaggctaa gagatgatca gagaagggtc 6181 tttagagagt tggtgcgagg gtgtgatttg ccagtgtggt tggcatggca agtggcaaaa 6241 gccggcctga agaccaatga ccgcaaatgg tgttttgagg gtcccgaaga gcatgamata 6301 ctcaatgaca atggtgaaac agtaaagtgt agatctccgg gcggagcaaa aagagcattg 6361 agacctagat ggtgtgacga gagagtttcc tcagaccaga gtgccttggc tgacttcatt 6421 aagtttgcag aaggtagaag aggggctgct gagatgcttg tggtcctcac ggagttgccc 6481 gacttcctgg caaagaaggg tggggaagcc atggatacca tcagtgtgtt cctacattct 6541 gaagagggtt caagagcgta cagaaatgcc ctgtcaatga tgccagaagc catgaccatt 6601 gtcatgctct tcctgcttgc cggactcttg acctcaggag cggtgatttt cttcatgtcg 6661 ccaaaaggca tgagtagaat gtcaatggca atgggtacca tggctggcag tggatatctc 6721 atgtttctgg ggggagtaaa accaacccac atctcttacg tcatgttaat attctttgtc 6781 ctcatggtcg tcataattcc cgaaccagga cagcagagat caatccagga taaccaagtt 6841 gcctacctca taattgggat cttgacattg ttatcagttg tggcagctaa tgaactaggg 6901 atgctggaga agaccaagga agattttttt ggaaagagmg acatcacaac accaagtggg 6961 gcaatcccat ggagttggcc tgacctggat ctgaaacctg gggcggcctg gacagtctwt 7021 gtgggaatcg tgacgatgtt gtctcccatg ttacaccatt ggataaaagt tgagtatggc 7081 aatttgtcac tatcgggaat agcccaatct gcctcagttc tttcatttat ggacaaagga 7141 attcccttca tgaaaatgaa tatatctgtg gtcatacttt tggtcagtgg ctggaattca 7201 atcacagtga tccctctttt gtgcggcatt ggtggagcca tgctgcactg gacgctcata 7261 cttcctggga ttaaagccca gcaatcaaag ctggctcaaa aaagagtttt tcatggagta 7321 gcaaaaaatc cagttgttga kggcaatcca actgctgaca ttgaggaagc cccagaaatg 7381 ccagctttat atgaaaagaa gctggctctt tacctccttc tggccctaag cctcatgtca 7441 gttgccatgt gcagaacccc tttttcctta gcggaaggaa tagtactgtc atctgccgcc 7501 cttggacctc tcattgaggg gaacactagt ctgttgtgga atggcccaat ggccgtttcc 7561 atgactggag tcatgcgtgg caactactac gcttttgtgg gagtcatgta caatctctgg 7621 aaaatgaaaa cagggcgtag agggagagca agtggaaaaa cattgggtga ggtctggaag 7681 cgtgaactta acytgctaga caaacaacaa tttgaaatgt acaaaagaac agacatcatt 7741 gaggtggacc gagacatggc acgacgacac ttggcagagg gaaaggtgga cacgggagtg 7801 gccgtgtcga gagggactgc aaagctgaga tggttccacg agcgtggcta tgtgaagcta 7861 gaaggaaggg tcaccgatct tgggtgtgga cgtggaggct ggtgctacta tgcagcagct 7921 caaaaagaag ttagtggtgt gaaggggtat acccttggca gagatggcca tgagaaacct 7981 atgaatgtcc aaagcttggg atggaatatt gtgactttta aggacaagac tgatrttcac 8041 cgactggagc cactcaagtg tgaaactctc ctctgtgaca tcggagaatc gtccccatcc 8101 tccgcaactg agggtgagag gaccttaaga gttctggaca cagttgaaaa gtggttggct 8161 tgtggagtgg ataacttttg catcaaagtt ctggcaccat acatgcccga tgtgatagag 8221 aaactggagc ttcttcaaag aagattcggt ggaaccgtca tcaggaatcc tctgtccaga 8281 aattctactc atgaaatgta ctacgtttca ggagcaagaa gtaacatcac attcacagtt 8341 aaccagacat cacgcctgct gatgcgaagg atgaggcggc ccacaggcaa agttaccttg 8401 gaagctgatg tcattcttcc gataggcacg cgcagtgtgg aaactgataa aggcccattg 8461 gataaggatg ctattgagga aagagttgag agaatcaaga atgaatatgc cactacatgg 8521 ttctatgaca atgacaaccc gtatagaacg tggcattatt gtggctccta tgtgaccaaa 8581 acgtcaggaa gtgcagccag catgataaat ggagtcatca aaatcttgac ttttccatgg 8641 gacaggatag aagaagtcac aagaatggca atgactgaca ccacaccttt tggacaacaa 8701 agagttttca aggagaaagt agacacaaga gcaaaagacc ctcctgctgg aacaaggaag 8761 atcatgaagg tggtgaatag atggttgttt cggcatctgt ccagggagaa gaaccccagg 8821 ttgtgcacca aagaagaatt cattgccaaa gtacggagcc atgcagcagt gggggctttt 8881 ctagaggaac aagagcagtg gaaaacggcc aatgaggcag tccttgatcc aaagttttgg 8941 gaaatggtcg atgcagaacg caaacttcat cagcaggggc gatgccaatc ctgtgtgtac 9001 aacatgatgg gaaagaggga aaagaaactc tctgaatttg gaaaggccaa agggagccgt 9061 gctatctggt acatgtggct tggggcacgg ttccttgagt ttgaagctct tgggttttta 9121 aatgaagatc actgggcctc ccgggagaac tcggggggag gagttgaggg cataggactc 9181 cagtacttgg gctatgttat cagggacttg tcaaccaaag aaggtggagg gttttatgcg 9241 gatgacacgg cagggtggga cacacgcatc acagaagctg acctggatga cgagcaagag 9301 atcatgagtt acatgagccc tgaacaaagg aagctggcct gggctataat ggaaatgaca 9361 twcaarmaca aagtggttaa ggtgctgagg ccagccccag gaggcaaggc cttcatggac 9421 atcatcagcc ggagagacca aagggggtca ggacaagttg tgacatacgc cctcaacacc 9481 ataaccaatc taaaagtcca gctcataaga atggctgaag ctgaaatggt gatcaaccat 9541 cagcatgtgc aggagtgtgg tgaaaatgtc ttagagcggc ttgaaacttg gcttgctgaa 9601 aacggatgtg acagattgag ccgaatggct gtgagtgggg atgattgtgt tgtgagaccg 9661 gtggatgaca gatttggcct ggccctttcc catcttaatg caatgtccaa agttaggaag 9721 gacatttcag aatggcaacc ctccaaagga tggacagatt gggaaaatgt tcctttctgc 9781 tctcaccact tccatgaact ggtgttgaaa gatgggagga agatagtggt gccttgcaga 9841 gatcaagatg aactgatagg gagagggaga gtgtccccag gaaatggctg gatgatcaag 9901 gaaacagcct gcctcagcaa agcttacgca aacatgtggt cactgatgta ctttcacaag 9961 agggacatga ggctactttc attcgctgtc tcctccgctg ttccaacggc ctgggtgccc 10021 agtggaagga caacgtggtc tgtccacgga agaggggagt ggatgacaac tgaggacatg 10081 ctagatgtct ggaacagggt gtgggtgttg aataacccgc acatgacgga caaaacaacc 10141 atcaaggagt ggagagatgt tccctacctc acaaagagac aggataagct ttgcgggtca 10201 ctgataggaa tgrcaaacag ggccacatgg gcatctcaca tccaccttgt gatccaccgg 10261 atcagaactc taataggtca agagaagttc acagactacc tcaccgtcat ggacaggtat 10321 tctgttgatg ccgaccttca gccaggagag cttatctgag acattacaac atggaaaacc 10381 gggataaaaa ctacgggtgg agaaccggac tccccacttg aaacatgtaa atagaaaacc 10441 gggataaaaa ctacgggcgg agaaccggac tccccactga ataggttata aacgtcagcc 10501 caggatccaa aatttgaatg ggtcttgcca ccgctaagct gtgaggcggt gcgggctggg 10561 acagccgttt cccgggcaac gacatgcctg gtttctggga cttcccaacc cggagtaaaa 10621 cgaaggagcc tccgccacca ccctcccacg gggtgttgga aagatggggt ctagaggtta 10681 gaggagaccc tccagggaaa ttagtgggac catattgacg ccagggaaag accggagtgg 10741 ttctctgctt ttcctccagg ggtctgcgag cacagtttgc tctagaagaa gcagaccttt 10801 ggatgacaaa acacaaaacc act
  13. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX010995.1|Yellow fever virus isolate CIC2, complete genome1841718417100%0.0100%KX010995.1Select seq gb|KX027336.1|Yellow fever virus isolate CIC4, complete genome1833018330100%0.099%KX027336.1Select seq gb|KX010996.1|Yellow fever virus isolate CIC3, complete genome1830718307100%0.099%KX010996.1Select seq gb|KX010994.1|Yellow fever virus isolate CIC1, complete genome1800618006100%0.099%KX010994.1Select seq gb|AY968064.1|Yellow fever virus strain Angola71, complete genome1765017650100%0.098%AY968064.1Select seq gb|DQ235229.1|Yellow fever virus strain Couma, complete genome1133911339100%0.085%DQ235229.1Select seq gb|JN620362.1|Yellow fever virus strain Uganda 2010, complete genome1129511295100%0.084%JN620362.1Select seq gb|AY968065.1|Yellow fever virus strain Uganda48a, complete genome1129311293100%0.084%AY968065.1Select seq gb|JF912179.1|Yellow fever virus strain BeAR378600, complete genome87568756100%0.079%JF912179.1Select seq gb|JF912185.1|Yellow fever virus strain BeAR513008, complete genome87538753100%0.079%JF912185.1Select seq gb|AY603338.1|Yellow fever virus strain Ivory Coast 1999, complete genome87368736100%0.079%AY603338.1Select seq gb|JF912186.1|Yellow fever virus strain BeH526722, complete genome87338733100%0.079%JF912186.1Select seq gb|JF912184.1|Yellow fever virus strain BeH463676, complete genome87188718100%0.079%JF912184.1Select seq gb|AY572535.1|Yellow fever virus strain Gambia 2001, complete genome87188718100%0.079%AY572535.1Select seq gb|JX898873.1|Yellow fever virus isolate ArD149214 from Senegal, complete genome87118711100%0.079%JX898873.1Select seq gb|JF912183.1|Yellow fever virus strain BeH423602, complete genome87098709100%0.079%JF912183.1Select seq gb|JX898874.1|Yellow fever virus isolate ArD149194 from Senegal, complete genome87078707100%0.079%JX898874.1Select seq gb|JX898868.1|Yellow fever virus isolate HD117294 from Senegal, complete genome87048704100%0.079%JX898868.1Select seq gb|JX898875.1|Yellow fever virus isolate ArD149815 from Senegal, complete genome87028702100%0.079%JX898875.1Select seq gb|KM388817.1|Yellow fever virus strain 2A polyprotein gene, complete cds86898689100%0.079%KM388817.1Select seq gb|KM388816.1|Yellow fever virus strain 10A polyprotein gene, complete cds86808680100%0.079%KM388816.1Select seq gb|JF912187.1|Yellow fever virus strain BeH622205, complete genome86798679100%0.079%JF912187.1Select seq gb|JX898870.1|Yellow fever virus isolate ArD121040 from Senegal, complete genome86758675100%0.079%JX898870.1Select seq gb|JF912188.1|Yellow fever virus strain BeH622493, complete genome86758675100%0.079%JF912188.1Select seq gb|JX898880.1|Yellow fever virus isolate ArD181564 from Senegal, complete genome86708670100%0.079%JX898880.1Select seq gb|JX898877.1|Yellow fever virus isolate ArD181464 from Senegal, complete genome86688668100%0.079%JX898877.1Select seq gb|JX898878.1|Yellow fever virus isolate ArD181250 from Senegal, complete genome86668666100%0.079%JX898878.1Select seq gb|JF912180.1|Yellow fever virus strain BeH394880, complete genome86628662100%0.079%JF912180.1Select seq gb|JX898876.1|Yellow fever virus isolate ArD156468 from Senegal, complete genome86448644100%0.079%JX898876.1Select seq gb|JF912182.1|Yellow fever virus strain BeH422973, complete genome86418641100%0.079%JF912182.1Select seq gb|JF912189.1|Yellow fever virus strain BeAR646536, complete genome86398639100%0.079%JF912189.1Select seq gb|HM582851.1|Yellow fever virus strain TVP11767 polyprotein gene, complete cds86378637100%0.079%HM582851.1Select seq gb|JF912190.1|Yellow fever virus strain BeH655417, complete genome86268626100%0.079%JF912190.1Select seq gb|JX898869.1|Yellow fever virus isolate DakArAmt7 from Cote d'Ivoire, complete genome86158615100%0.079%JX898869.1Select seq gb|KM388815.1|Yellow fever virus strain 9A polyprotein gene, complete cds86088608100%0.079%KM388815.1Select seq gb|KM388814.1|Yellow fever virus strain 6A polyprotein gene, complete cds86088608100%0.079%KM388814.1Select seq gb|AY640589.1|Yellow fever virus strain ASIBI, complete genome86088608100%0.079%AY640589.1Select seq gb|KF769016.1|Yellow fever virus strain Asibi, complete genome86038603100%0.079%KF769016.1Select seq gb|KM388818.1|Yellow fever virus strain 8A polyprotein gene, complete cds85678567100%0.079%KM388818.1Select seq gb|KF907504.1|Yellow fever virus strain 88/1999, complete genome85478547100%0.079%KF907504.1Select seq gb|U21056.1|YFU21056Yellow fever virus French viscerotropic strain, complete genome85458545100%0.078%U21056.1Select seq gb|JX898872.1|Yellow fever virus isolate ArD114972 from Senegal, complete genome85228522100%0.078%JX898872.1Select seq gb|JX898871.1|Yellow fever virus isolate ArD114896 from Senegal, complete genome85138513100%0.078%JX898871.1Select seq gb|DQ100292.1|Yellow fever virus strain 17DD-Brazil, complete genome85048504100%0.078%DQ100292.1Select seq gb|U21055.1|YFU21055Yellow fever virus French neurotropic strain, complete genome85008500100%0.078%U21055.1Select seq gb|GQ379162.1|Yellow fever virus strain case #1, complete genome84868486100%0.078%GQ379162.1Select seq gb|U17066.1|YFU17066Yellow fever virus vaccine strain 17DD, complete genome84868486100%0.078%U17066.1Select seq emb|X03700.1|Yellow fever virus complete genome, 17D vaccine strain84828482100%0.078%X03700.1Select seq gb|KF769015.1|Yellow fever virus strain 17D-204, complete genome84778477100%0.078%KF769015.1Select seq gb|JN811143.1|Yellow fever virus 17D YF-VAX Vero adapted Series C P11, complete genome84778477100%0.078%JN811143.1Select seq gb|JX503529.1|Yellow fever virus strain YF/Vaccine/USA/Sanofi-Pasteur-17D-204/UF795AA/YFVax, complete genome84778477100%0.078%JX503529.1Select seq gb|JN628279.1|Yellow fever virus strain 17D RKI, complete genome84778477100%0.078%JN628279.1Select seq gb|AF052444.1|AF052444Yellow fever virus clone HONG8 polyprotein gene, complete cds84778477100%0.078%AF052444.1Select seq gb|JX949181.1|Yellow fever virus strain 17D polyprotein gene, complete cds84738473100%0.078%JX949181.1Select seq gb|FJ654700.1|Yellow fever virus 17D/Tiantan, complete genome84738473100%0.078%FJ654700.1Select seq gb|DQ118157.1|Yellow fever virus isolate YF-AVD2791-93F/04 from Spain, complete genome84738473100%0.078%DQ118157.1Select seq emb|X15062.1|Yellow fever virus genomic RNA84738473100%0.078%X15062.1Select seq gb|AF052446.1|AF052446Yellow fever virus clone HONG10 polyprotein gene, complete cds84738473100%0.078%AF052446.1Select seq gb|AF052439.1|AF052439Yellow fever virus clone HONG3 polyprotein gene, complete cds84738473100%0.078%AF052439.1Select seq gb|AF052438.1|AF052438Yellow fever virus clone HONG2 polyprotein gene, complete cds84738473100%0.078%AF052438.1Select seq gb|AF052437.1|AF052437Yellow fever virus clone HONG1 polyprotein gene, complete cds84738473100%0.078%AF052437.1Select seq gb|U17067.1|YFU17067Yellow fever virus vaccine strain 17D-213, complete genome84738473100%0.078%U17067.1Select seq gb|GQ379163.1|Yellow fever virus strain case #2, complete genome84718471100%0.078%GQ379163.1Select seq gb|JN811141.1|Yellow fever virus 17D YF-VAX Vero adapted Series A P11, complete genome84688468100%0.078%JN811141.1Select seq gb|AF052445.1|AF052445Yellow fever virus clone HONG9 polyprotein gene, complete cds84688468100%0.078%AF052445.1Select seq gb|U54798.1|YFU54798Yellow fever virus strain 85-82H Ivory Coast, complete genome84668466100%0.078%U54798.1Select seq gb|JN811142.1|Yellow fever virus 17D YF-VAX Vero adapted Series B P11, complete genome84648464100%0.078%JN811142.1Select seq gb|AF094612.1|AF094612Yellow fever virus strain Trinidad 79A isolate 788379, complete genome83998399100%0.078%AF094612.1Select seq gb|JF912181.1|Yellow fever virus strain BeH413820, complete genome83768376100%0.078%JF912181.1Select seq gb|DQ322634.1|YFV replicon vector FMDV-2A-def, complete sequence8181829697%0.078%DQ322634.1Select seq gb|DQ322633.1|YFV replicon vector capsid-def, complete sequence8181829697%0.078%DQ322633.1Select seq gb|DQ322635.1|YFV replicon vector prME-def, complete sequence6506683781%0.078%DQ322635.1Select seq dbj|D14458.1|YFVCMENSYellow fever virus prM gene for precursor polyprotein, partial cds3146314634%0.080%D14458.1Select seq gb|AF052443.1|AF052443Yellow fever virus clone HONG7 polyprotein gene, partial cds2224222426%0.078%AF052443.1Select seq gb|GU951804.1|Yellow fever virus strain BeAn 131 polyprotein gene, partial cds2223222326%0.078%GU951804.1Select seq gb|AF052441.1|AF052441Yellow fever virus clone HONG5 polyprotein gene, partial cds2219221926%0.078%AF052441.1Select seq gb|AH005112.2|Yellow fever virus strain Y5 polyprotein and nonstructural protein NS2A mRNAs, partial cds2140250527%0.080%AH005112.2Select seq gb|AY960140.1|Yellow fever virus strain ArB28153 polyprotein gene, partial cds2127212717%0.086%AY960140.1Select seq gb|DQ322638.1|VEEV replicon vector YFV-C2, complete sequence2127212722%0.080%DQ322638.1Select seq gb|AF052440.1|AF052440Yellow fever virus clone HONG4 polyprotein gene, partial cds2122212222%0.080%AF052440.1Select seq gb|L06480.1|YFVCAPSIDMYellow fever virus capsid protein, M protein, and envelope protein mRNAs2122212222%0.080%L06480.1Select seq gb|DQ322642.1|VEEV replicon vector YFV-C3opt, complete sequence1936193622%0.078%DQ322642.1Select seq gb|DQ322640.1|VEEV replicon vector YFV-C3opt-NS2mut, complete sequence1936193622%0.078%DQ322640.1Select seq gb|U23578.1|YFU23578Yellow fever virus isolate SE7445/Uganda/1964/Human envelope protein (E) mRNA, partial cds1820182014%0.087%U23578.1Select seq gb|U23577.1|YFU23577Yellow fever virus isolate M-112/Sudan/1940/Human envelope protein (E) mRNA, partial cds1811181114%0.087%U23577.1Select seq gb|AY839636.1|Yellow fever virus strain ETH2777/Ethiopia61 envelope protein gene, partial cds1797179714%0.087%AY839636.1Select seq gb|DQ068260.1|Yellow fever virus strain SSUD03-01 envelope protein gene, partial cds1784178414%0.087%DQ068260.1Select seq gb|U23573.1|YFU23573Yellow fever virus isolate DaHB1504/C. African Republic/1985/Human envelope protein (E) mRNA, partial cds1784178414%0.087%U23573.1Select seq gb|DQ068264.1|Yellow fever virus strain SSUD03-05 envelope protein gene, partial cds1779177914%0.087%DQ068264.1Select seq gb|DQ068263.1|Yellow fever virus strain SSUD03-04 envelope protein gene, partial cds1779177914%0.087%DQ068263.1Select seq gb|DQ068262.1|Yellow fever virus strain SSUD03-03 envelope protein gene, partial cds1779177914%0.087%DQ068262.1Select seq gb|AY839634.1|Yellow fever virus strain HB1782/CAR86 envelope protein gene, partial cds1779177914%0.087%AY839634.1Select seq gb|U23569.1|YFU23569Yellow fever virus isolate 7914/Kenya/1993/Human envelope protein (E) mRNA, partial cds1766176614%0.086%U23569.1Select seq gb|U23575.1|YFU23575Yellow fever virus isolate KE93-477/Kenya/1993/Mosquito envelope protein (E) mRNA, partial cds1761176114%0.086%U23575.1Select seq gb|U23571.1|YFU23571Yellow fever virus isolate ArB8883/C. African Republic/1977/Human envelope protein (E) mRNA, partial cds1761176114%0.086%U23571.1Select seq gb|U23576.1|YFU23576Yellow fever virus isolate Kouma/Ethiopia/1961/Human envelope protein (E) mRNA, partial cds1755175514%0.086%U23576.1Select seq gb|AY960138.1|Yellow fever virus strain ArA 20628 polyprotein gene, partial cds1745174517%0.081%AY960138.1Select seq gb|AY960137.1|Yellow fever virus strain Ara29436 polyprotein gene, partial cds1703170317%0.081%AY960137.1Select seq gb|AY960139.1|Yellow fever virus strain Ara6734 polyprotein gene, partial cds1676167617%0.081%AY960139.1Select seq gb|DQ859058.1|Wesselsbron virus strain SAH-177 99871-2 polyprotein gene, complete cds1523203475%0.067%DQ859058.1Select seq gb|EU707555.1|Wesselsbron virus strain SAH177, complete genome1517202375%0.067%EU707555.1Select seq gb|GU073158.1|Yellow fever virus strain Senegal/Ko/ARDX/2000 envelope glycoprotein (E) gene, partial cds1514151414%0.082%GU073158.1Select seq gb|GU073145.1|Yellow fever virus strain Senegal/Ke/ArD149213/2000 envelope glycoprotein (E) gene, partial cds1514151414%0.082%GU073145.1Select seq gb|GU073144.1|Yellow fever virus strain Senegal/Ke/ArD149194/2000 envelope glycoprotein (E) gene, partial cds1514151414%0.082%GU073144.1Select seq gb|GU073136.1|Yellow fever virus strain Mali/Ba/HA872/1987 envelope glycoprotein (E) gene, partial cds1514151414%0.082%GU073136.1Select seq gb|GU073166.1|Yellow fever virus strain Senegal/Ko/HD117294/1995 envelope glycoprotein (E) gene, partial cds1510151014%0.082%GU073166.1Select seq gb|GU073143.1|Yellow fever virus strain Senegal/Ke/ArD149179/2000 envelope glycoprotein (E) gene, partial cds1510151014%0.082%GU073143.1Select seq gb|GU073152.1|Yellow fever virus strain Senegal/Ke/ArD156468/2001 envelope glycoprotein (E) gene, partial cds1501150114%0.082%GU073152.1Select seq gb|GU073141.1|Yellow fever virus strain Senegal/Ke/AnD26923/1978 envelope glycoprotein (E) gene, partial cds1501150114%0.082%GU073141.1Select seq gb|GU073137.1|Yellow fever virus strain Mali/Sa/ArA20267/1987 envelope glycoprotein (E) gene, partial cds1501150114%0.082%GU073137.1Select seq gb|GU073156.1|Yellow fever virus strain Senegal/Ke/ArD25112/1977 envelope glycoprotein (E) gene, partial cds1496149614%0.082%GU073156.1Select seq gb|GU073153.1|Yellow fever virus strain Senegal/Ke/ArD156583/2001 envelope glycoprotein (E) gene, partial cds1496149614%0.082%GU073153.1Select seq gb|GU073135.1|Yellow fever virus strain Gambia/MK/ArD27797/1979 envelope glycoprotein (E) gene, partial cds1492149214%0.082%GU073135.1Select seq gb|GU073163.1|Yellow fever virus strain Senegal/Ko/ArD114987/1995 envelope glycoprotein (E) gene, partial cds1483148314%0.082%GU073163.1Select seq gb|AY502949.1|Yellow fever virus strain Guinea/2000/human envelope protein (env) gene, partial cds1481148114%0.082%AY502949.1Select seq gb|GU073159.1|Yellow fever virus strain Senegal/Ko/ArD114891/1995 envelope glycoprotein (E) gene, partial cds1480148014%0.082%GU073159.1Select seq gb|GU073149.1|Yellow fever virus strain Senegal/Ke/ArD149815/2000 envelope glycoprotein (E) gene, partial cds1480148014%0.082%GU073149.1Select seq gb|GU073140.1|Yellow fever virus strain Senegal/Ka/HD122030/1996 envelope glycoprotein (E) gene, partial cds1480148014%0.082%GU073140.1Select seq gb|GU073161.1|Yellow fever virus strain Senegal/Ko/ArD114970/1995 envelope glycoprotein (E) gene, partial cds1478147814%0.082%GU073161.1Select seq gb|GU073148.1|Yellow fever virus strain Senegal/Ke/ArD149791/2000 envelope glycoprotein (E) gene, partial cds1478147814%0.082%GU073148.1Select seq gb|GU073142.1|Yellow fever virus strain Senegal/Ke/ArD121040/1996 envelope glycoprotein (E) gene, partial cds1472147214%0.082%GU073142.1Select seq gb|GU073146.1|Yellow fever virus strain Senegal/Ke/ArD149214/2000 envelope glycoprotein (E) gene, partial cds1469146914%0.082%GU073146.1Select seq gb|AY495561.1|Yellow fever virus isolate DNA-YF-4 protein E gene, partial cds1462146215%0.081%AY495561.1Select seq gb|GU073164.1|Yellow fever virus strain Senegal/Ko/ArD114988/1995 envelope glycoprotein (E) gene, partial cds1460146014%0.082%GU073164.1Select seq gb|GU073131.1|Yellow fever virus strain Cameroon/HD78359/1990 envelope glycoprotein (E) gene, partial cds1460146014%0.081%GU073131.1Select seq gb|AY359908.2|Yellow fever virus isolate DNA-YF-2 protein E gene, partial cds1460146015%0.081%AY359908.2Select seq gb|GU073157.1|Yellow fever virus strain Senegal/Ke/ArD99740/1993 envelope glycoprotein (E) gene, partial cds1458145814%0.082%GU073157.1Select seq gb|GU073147.1|Yellow fever virus strain Senegal/Ke/ArD149215/2000 envelope glycoprotein (E) gene, partial cds1454145414%0.082%GU073147.1Select seq gb|L02865.1|YFVENVAYellow fever virus wild-type envelope protein (env)1454145414%0.082%L02865.1Select seq gb|GU073160.1|Yellow fever virus strain Senegal/Ko/ArD114896/1995 envelope glycoprotein (E) gene, partial cds1452145214%0.082%GU073160.1Select seq gb|AY495571.1|Yellow fever virus vaccine flavimun experimental lot 3000131 protein E gene, partial cds1452145215%0.081%AY495571.1Select seq gb|AY495567.1|Yellow fever virus vaccine flavimun experimental lot 3000129 protein E gene, partial cds1452145215%0.081%AY495567.1Select seq gb|GU073130.1|Yellow fever virus strain CAR/Bo/ArB5656/1974 envelope glycoprotein (E) gene, partial cds1451145114%0.081%GU073130.1Select seq gb|AY359909.1|Yellow fever virus isolate DNA-YF-3 protein E gene, partial cds1451145115%0.081%AY359909.1Select seq gb|GU073139.1|Yellow fever virus strain Senegal/Ka/ArD122522/1996 envelope glycoprotein (E) gene, partial cds1449144914%0.082%GU073139.1Select seq gb|AY359907.1|Yellow fever virus isolate DNA-YF-1 protein E gene, partial cds1449144914%0.081%AY359907.1Select seq gb|GU073133.1|Yellow fever virus strain CotedIvoire/SS/ARM154/1995 envelope glycoprotein (E) gene, partial cds1445144514%0.082%GU073133.1Select seq gb|AY495558.1|Yellow fever virus isolate DNA-YF-1 protein E gene, partial cds1445144515%0.081%AY495558.1Select seq gb|AY839635.1|Yellow fever virus strain ArD76320/Senegal90 envelope protein gene, partial cds1445144514%0.082%AY839635.1Select seq gb|U23574.1|YFU23574Yellow fever virus isolate Dar1279/Senegal/1965/Human envelope protein (E) mRNA, partial cds1445144514%0.082%U23574.1Select seq gb|L02866.1|YFVENVBYellow fever virus envelope protein (env)1445144514%0.082%L02866.1Select seq gb|GU073150.1|Yellow fever virus strain Senegal/Ke/ArD149887/2000 envelope glycoprotein (E) gene, partial cds1443144314%0.082%GU073150.1Select seq gb|GU073162.1|Yellow fever virus strain Senegal/Ko/ArD114972/1995 envelope glycoprotein (E) gene, partial cds1442144214%0.082%GU073162.1Select seq gb|AY495569.1|Yellow fever virus vaccine flavimun experimental lot 3000130 protein E gene, partial cds1442144214%0.081%AY495569.1Select seq gb|AY495562.1|Yellow fever virus isolate DNA-YF-4 protein E gene, partial cds1442144215%0.081%AY495562.1Select seq gb|AY495566.1|Yellow fever virus isolate DNA-YF-7 protein E gene, partial cds1440144015%0.081%AY495566.1Select seq gb|AY495559.1|Yellow fever virus isolate DNA-YF-2 protein E gene, partial cds1440144014%0.081%AY495559.1Select seq gb|GU073132.1|Yellow fever virus strain CotedIvoire/De/ArA523/1996 envelope glycoprotein (E) gene, partial cds1436143614%0.082%GU073132.1Select seq gb|JN226796.1|Wesselsbron virus from South Africa, complete genome1422185475%0.066%JN226796.1Select seq gb|GU073165.1|Yellow fever virus strain Senegal/Ko/ArD114989/1995 envelope glycoprotein (E) gene, partial cds1418141814%0.082%GU073165.1Select seq gb|U23580.1|YFU23580Yellow fever virus isolate V-528A/Colombia/1979/Mosquito envelope protein (E) mRNA, partial cds1418141814%0.081%U23580.1Select seq gb|AY495573.1|Yellow fever virus reference stock RKI-17D-112/95 protein E gene, partial cds1416141614%0.081%AY495573.1Select seq gb|AY495570.1|Yellow fever virus vaccine flavimun experimental lot 3000130 protein E gene, partial cds1415141514%0.081%AY495570.1Select seq gb|AY495568.1|Yellow fever virus vaccine flavimun experimental lot 3000129 protein E gene, partial cds1411141114%0.081%AY495568.1Select seq gb|AY495572.1|Yellow fever virus vaccine flavimun experimental lot 3000131 protein E gene, partial cds1409140914%0.081%AY495572.1Select seq gb|U23570.1|YFU23570Yellow fever virus isolate AR350397/Brazil/1979/Mosquito envelope protein (E) mRNA, partial cds1409140914%0.081%U23570.1Select seq gb|U23568.1|YFU23568Yellow fever virus isolate 788379/Trinidad/1979/Mosquito envelope protein (E) mRNA, partial cds1406140614%0.081%U23568.1Select seq gb|GU073134.1|Yellow fever virus strain CotedIvoire/To/DakArAmt7/1973 envelope glycoprotein (E) gene, partial cds1402140213%0.082%GU073134.1Select seq gb|U23579.1|YFU23579Yellow fever virus isolate T790882/Trinidad/1979/Mosquito envelope protein (E) mRNA, partial cds1400140014%0.081%U23579.1Select seq gb|AY632543.1|Sepik virus polyprotein gene, complete cds1397178775%0.066%AY632543.1Select seq gb|DQ859063.1|Sepik virus strain 7148 polyprotein gene, complete cds1393178475%0.066%DQ859063.1Select seq gb|AY495574.1|Yellow fever virus reference stock RKI-17D-112/95 protein E gene, partial cds1393139314%0.081%AY495574.1Select seq gb|U23572.1|YFU23572Yellow fever virus isolate BA-55/Nigeria/1986/Human envelope protein (E) mRNA, partial cds1391139114%0.081%U23572.1Select seq gb|GU073151.1|Yellow fever virus strain Senegal/Ke/ArD156029/2001 envelope glycoprotein (E) gene, partial cds1382138213%0.082%GU073151.1Select seq gb|DQ837642.1|Sepik virus strain MK7148, complete genome1382177375%0.066%DQ837642.1Select seq gb|U23567.1|YFU23567Yellow fever virus isolate 56205/Nigeria/1991/Human envelope protein (E) mRNA, partial cds1382138214%0.081%U23567.1Select seq gb|U23566.1|YFU23566Yellow fever virus isolate 1914-81/Ecuador/1981/Human envelope protein (E) mRNA, partial cds1373137314%0.081%U23566.1Select seq gb|U23565.1|YFU23565Yellow fever virus isolate 1362/Peru/1977/Human envelope protein (E) mRNA, partial cds1373137314%0.081%U23565.1Select seq gb|GU073138.1|Yellow fever virus strain Mauritania/Ro/HD47471/1987 envelope glycoprotein (E) gene, partial cds1319131913%0.081%GU073138.1Select seq gb|U52422.1|YFU52422Yellow fever virus Uga48 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1279127911%0.084%U52422.1Select seq gb|U52392.1|YFU52392Yellow fever virus Car77(883) core, pre-membrane, membrane and envelope proteins mRNA, partial cds1267126711%0.083%U52392.1Select seq gb|DQ859067.1|Potiskum virus strain IBAN 10069 polyprotein gene, complete cds1191151463%0.066%DQ859067.1Select seq gb|AF369669.1|AF369669Yellow fever virus strain 14 FA polyprotein mRNA, partial cds115511556%0.098%AF369669.1Select seq gb|U52398.1|YFU52398Yellow fever virus Ecuador79 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1144114411%0.081%U52398.1Select seq gb|U52416.1|YFU52416Yellow fever virus Trinidad54 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1141114111%0.081%U52416.1Select seq gb|DQ859062.1|Saboya virus strain Dak AR D4600 polyprotein gene, complete cds1126121067%0.065%DQ859062.1Select seq gb|U52404.1|YFU52404Yellow fever virus Panama74 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1122112211%0.081%U52404.1Select seq gb|U52389.1|YFU52389Yellow fever virus Brazil35 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1117111711%0.081%U52389.1Select seq gb|U52403.1|YFU52403Yellow fever virus Nigeria46 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1108110811%0.080%U52403.1Select seq gb|U52410.1|YFU52410Yellow fever virus Peru95(153) core, pre-membrane, membrane and envelope proteins mRNA, partial cds1081108111%0.080%U52410.1Select seq gb|U52419.1|YFU52419Yellow fever virus Trinidad79 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1077107711%0.080%U52419.1Select seq gb|U52409.1|YFU52409Yellow fever virus Peru95(149) core, pre-membrane, membrane and envelope proteins mRNA, partial cds1068106811%0.080%U52409.1Select seq gb|U52413.1|YFU52413Yellow fever virus Senegal65 core, pre-membrane, membrane and envelope proteins mRNA, partial cds1059105911%0.080%U52413.1Select seq gb|AF162449.1|AF162449Yellow fever virus isolate PER 1 envelope protein gene, partial cds9179179%0.080%AF162449.1Select seq gb|AF312554.1|AF312554Yellow fever virus glycoprotein E gene, partial cds9139139%0.080%AF312554.1Select seq gb|AF162451.1|AF162451Yellow fever virus isolate PER 3 envelope protein gene, partial cds9139139%0.080%AF162451.1Select seq gb|AF162452.1|AF162452Yellow fever virus isolate PER 4 envelope protein gene, partial cds9089089%0.080%AF162452.1Select seq gb|AF162450.1|AF162450Yellow fever virus isolate PER 2 envelope protein gene, partial cds9049049%0.080%AF162450.1Select seq gb|AF013417.1|AF013417Yellow fever virus strain TN-96 NS5 protein (NS5) gene, partial cds87587510%0.079%AF013417.1Select seq gb|U52424.1|YFU52424Yellow fever virus Uga48 non-structural protein 4A mRNA, partial cds8078077%0.084%U52424.1Select seq gb|AF369673.1|AF369673Yellow fever virus strain HB 1504 polyprotein mRNA, partial cds7807806%0.086%AF369673.1Select seq gb|AF369697.1|AF369697Yellow fever virus strain LSF 4 polyprotein mRNA, partial cds7677676%0.085%AF369697.1Select seq gb|AF369692.1|AF369692Yellow fever virus strain M 90-5 polyprotein mRNA, partial cds7627626%0.085%AF369692.1Select seq gb|AF369696.1|AF369696Yellow fever virus strain Z 19039 polyprotein mRNA, partial cds7587586%0.085%AF369696.1Select seq gb|AF369695.1|AF369695Yellow fever virus strain SE 7445 polyprotein mRNA, partial cds7587586%0.085%AF369695.1Select seq gb|AF369676.1|AF369676Yellow fever virus strain BC 7914 polyprotein mRNA, partial cds7537536%0.085%AF369676.1Select seq gb|DQ859057.1|Bouboui virus strain DAK AR B490 polyprotein gene, complete cds749154752%0.067%DQ859057.1Select seq gb|AY839631.1|Yellow fever virus strain HB1782/CAR86 polyprotein gene, partial cds7497496%0.085%AY839631.1Select seq gb|AF369694.1|AF369694Yellow fever virus strain A 709-4-A2 polyprotein mRNA, partial cds7447446%0.085%AF369694.1Select seq gb|AF369675.1|AF369675Yellow fever virus strain Couma polyprotein mRNA, partial cds7447446%0.085%AF369675.1Select seq gb|JX012100.1|Yellow fever virus isolate Ethiopia1966a polyprotein gene, partial cds7427426%0.085%JX012100.1Select seq gb|DQ859066.1|Jugra virus strain P-9-314 polyprotein gene, complete cds740131753%0.066%DQ859066.1Select seq gb|AF369674.1|AF369674Yellow fever virus strain Serie 227 polyprotein mRNA, partial cds7407406%0.084%AF369674.1Select seq gb|AF369672.1|AF369672Yellow fever virus strain ArB 17239 polyprotein mRNA, partial cds7407406%0.084%AF369672.1Select seq gb|JX012103.1|Yellow fever virus isolate Ethiopia1966d polyprotein gene, partial cds7387386%0.085%JX012103.1Select seq gb|JX012097.1|Yellow fever virus isolate Sudan2003 polyprotein gene, partial cds7357356%0.085%JX012097.1Select seq gb|U52394.1|YFU52394Yellow fever virus Car77(883) non-structural protein 4A mRNA, partial cds7357357%0.081%U52394.1Select seq gb|AY839633.1|Yellow fever virus strain ETH2777/Ethiopia61 polyprotein gene, partial cds7287286%0.084%AY839633.1Select seq gb|JX012099.1|Yellow fever virus isolate Ethiopia1961d polyprotein gene, partial cds7207206%0.085%JX012099.1Select seq gb|U52397.1|YFU52397Yellow fever virus Car77(900) non-structural protein 4A mRNA, partial cds7177177%0.082%U52397.1Select seq gb|JX012098.1|Yellow fever virus isolate Ethiopia1961c polyprotein gene, partial cds7157156%0.085%JX012098.1Select seq gb|AY540464.1|Yellow fever virus strain BeAr513008 polyprotein gene, partial cds7137136%0.084%AY540464.1Select seq gb|AY540477.1|Yellow fever virus strain 1345 polyprotein gene, partial cds7087086%0.083%AY540477.1Select seq gb|AY540467.1|Yellow fever virus strain BeAr513292 polyprotein gene, partial cds7087086%0.083%AY540467.1Select seq gb|AY540449.1|Yellow fever virus strain BeH203410 polyprotein gene, partial cds7087086%0.083%AY540449.1Select seq gb|AY540475.1|Yellow fever virus strain V528A polyprotein gene, partial cds7047046%0.083%AY540475.1Select seq gb|AY540473.1|Yellow fever virus strain "Tennessee" polyprotein gene, partial cds7047046%0.083%AY540473.1Select seq gb|AY540472.1|Yellow fever virus strain BeAr544276 polyprotein gene, partial cds7047046%0.083%AY540472.1Select seq gb|AY540466.1|Yellow fever virus strain BeAr513060 polyprotein gene, partial cds7047046%0.083%AY540466.1Select seq gb|AY540465.1|Yellow fever virus strain BeH512772 polyprotein gene, partial cds7047046%0.083%AY540465.1Select seq gb|AY540459.1|Yellow fever virus strain BeAr424083 polyprotein gene, partial cds7047046%0.083%AY540459.1Select seq gb|AY540455.1|Yellow fever virus strain BeH385780 polyprotein gene, partial cds7047046%0.083%AY540455.1Select seq gb|AY540452.1|Yellow fever virus strain BeAr233436 polyprotein gene, partial cds7047046%0.083%AY540452.1Select seq gb|AY540476.1|Yellow fever virus strain INS347613 polyprotein gene, partial cds6996996%0.083%AY540476.1Select seq gb|AY540470.1|Yellow fever virus strain BeAr527547 polyprotein gene, partial cds6996996%0.083%AY540470.1Select seq gb|AY540447.1|Yellow fever virus strain BeAr142658 polyprotein gene, partial cds6996996%0.083%AY540447.1Select seq gb|AY540436.1|Yellow fever virus strain BeAr628124 polyprotein gene, partial cds6956956%0.083%AY540436.1Select seq gb|DQ872411.1|Yellow fever virus strain GML902621 polyprotein gene, partial cds6956956%0.083%DQ872411.1Select seq gb|AY540481.1|Yellow fever virus strain CAREC797984 polyprotein gene, partial cds6956956%0.083%AY540481.1Select seq gb|AY540463.1|Yellow fever virus strain BeAr512943 polyprotein gene, partial cds6956956%0.083%AY540463.1Select seq gb|AY540462.1|Yellow fever virus strain BeAn510268 polyprotein gene, partial cds6956956%0.083%AY540462.1Select seq gb|AY540454.1|Yellow fever virus strain BeAr350397 polyprotein gene, partial cds6956956%0.083%AY540454.1Select seq gb|AY540453.1|Yellow fever virus strain BeH233393 polyprotein gene, partial cds6956956%0.083%AY540453.1Select seq gb|AY540450.1|Yellow fever virus strain BeAr233164 polyprotein gene, partial cds6956956%0.083%AY540450.1Select seq gb|AY540444.1|Yellow fever virus strain BeH107714 polyprotein gene, partial cds6956956%0.083%AY540444.1Select seq gb|AY540485.1|Yellow fever virus strain CAREC891957 polyprotein gene, partial cds6906906%0.083%AY540485.1Select seq gb|AY540484.1|Yellow fever virus strain CAREC891954 polyprotein gene, partial cds6906906%0.083%AY540484.1Select seq gb|AY540483.1|Yellow fever virus strain CAREC890692 polyprotein gene, partial cds6906906%0.083%AY540483.1Select seq gb|AY540482.1|Yellow fever virus strain CAREC889920 polyprotein gene, partial cds6906906%0.083%AY540482.1Select seq gb|AY540480.1|Yellow fever virus strain Jimenez polyprotein gene, partial cds6906906%0.083%AY540480.1Select seq gb|AY540460.1|Yellow fever virus strain BeAr511437 polyprotein gene, partial cds6906906%0.083%AY540460.1Select seq gb|AY540441.1|Yellow fever virus strain BeAn23536 polyprotein gene, partial cds6906906%0.083%AY540441.1Select seq gb|DQ859056.1|Banzi virus strain SAH 336 polyprotein gene, complete cds688145563%0.066%DQ859056.1Select seq gb|AY437135.1|Yellow fever virus polyprotein gene, partial cds6886886%0.083%AY437135.1Select seq gb|AY540479.1|Yellow fever virus strain 614819 polyprotein gene, partial cds6866866%0.083%AY540479.1Select seq gb|AY540468.1|Yellow fever virus strain BeAr527785 polyprotein gene, partial cds6866866%0.083%AY540468.1Select seq gb|AY540458.1|Yellow fever virus strain BeH425381 polyprotein gene, partial cds6866866%0.083%AY540458.1Select seq gb|AY540443.1|Yellow fever virus strain BeAr44824 polyprotein gene, partial cds6866866%0.083%AY540443.1Select seq gb|AY540442.1|Yellow fever virus strain BeAr46299 polyprotein gene, partial cds6866866%0.083%AY540442.1Select seq gb|AY540488.1|Yellow fever virus strain PHO42H polyprotein gene, partial cds6816816%0.083%AY540488.1Select seq gb|AY540487.1|Yellow fever virus strain P128MC polyprotein gene, partial cds6816816%0.083%AY540487.1Select seq gb|AY540486.1|Yellow fever virus strain CAREC9515207 polyprotein gene, partial cds6816816%0.083%AY540486.1Select seq gb|AY540461.1|Yellow fever virus strain BeH511843 polyprotein gene, partial cds6816816%0.083%AY540461.1Select seq gb|AY540438.1|Yellow fever virus strain BeAN131 polyprotein gene, partial cds6816816%0.083%AY540438.1Select seq gb|FJ875520.1|Yellow fever virus strain SPAn289568 polyprotein gene, partial cds6776776%0.082%FJ875520.1Select seq gb|FJ875518.1|Yellow fever virus strain SPAn288183 polyprotein gene, partial cds6776776%0.082%FJ875518.1Select seq gb|AY540469.1|Yellow fever virus strain BeAr527198 polyprotein gene, partial cds6776776%0.082%AY540469.1Select seq gb|AY540440.1|Yellow fever virus strain BeAr189 polyprotein gene, partial cds6776776%0.082%AY540440.1Select seq gb|AY540439.1|Yellow fever virus strain BeAr162 polyprotein gene, partial cds6776776%0.082%AY540439.1Select seq gb|HM582843.1|Yellow fever virus strain BeH613582 polyprotein gene, partial cds6736736%0.083%HM582843.1Select seq gb|L40951.1|FVVNS5PBanzi virus nonstructural protein 5 (NS5) gene, partial cds67367323%0.067%L40951.1Select seq gb|FJ875517.1|Yellow fever virus strain SPH258595 polyprotein gene, partial cds6726726%0.082%FJ875517.1Select seq gb|EU303239.1|Yellow fever virus note H203410 nonstructural protein 5 (NS5) gene, partial cds6726727%0.079%EU303239.1Select seq gb|AY540456.1|Yellow fever virus strain BeH379501 polyprotein gene, partial cds6726726%0.082%AY540456.1Select seq gb|AY540437.1|Yellow fever virus strain BeH111 polyprotein gene, partial cds6726726%0.082%AY540437.1Select seq gb|HM582848.1|Yellow fever virus strain BeAr631464 polyprotein gene, partial cds6686686%0.083%HM582848.1Select seq gb|HM582839.1|Yellow fever virus strain TVP11646 polyprotein gene, partial cds6666666%0.083%HM582839.1Select seq gb|HM582845.1|Yellow fever virus strain BeAr527785 polyprotein gene, partial cds6616616%0.082%HM582845.1Select seq gb|AY540451.1|Yellow fever virus strain BeAn232869 polyprotein gene, partial cds6596596%0.082%AY540451.1Select seq gb|AY540434.1|Yellow fever virus strain OBS8026 polyprotein gene, partial cds6596596%0.082%AY540434.1Select seq gb|AY540490.1|Yellow fever virus strain 35708 polyprotein gene, partial cds6546546%0.082%AY540490.1Select seq gb|AY540474.1|Yellow fever virus strain INS382060 polyprotein gene, partial cds6546546%0.082%AY540474.1Select seq gb|AY161928.1|Yellow fever virus strain 1368 polyprotein gene, partial cds6526526%0.082%AY161928.1Select seq gb|HQ123568.1|Yellow fever virus strain PH71191 polyprotein gene, partial cds6506506%0.082%HQ123568.1Select seq gb|AY540445.1|Yellow fever virus strain BeAn142028 polyprotein gene, partial cds6456456%8e-18081%AY540445.1Select seq gb|AF369683.1|AF369683Yellow fever virus strain H117505 polyprotein mRNA, partial cds6456456%8e-18081%AF369683.1Select seq gb|AY540457.1|Yellow fever virus strain BeH413820 polyprotein gene, partial cds6416416%9e-17981%AY540457.1Select seq gb|AF369685.1|AF369685Yellow fever virus strain 56205 polyprotein mRNA, partial cds6416416%9e-17981%AF369685.1Select seq gb|AF369678.1|AF369678Yellow fever virus strain T. Adeoye polyprotein mRNA, partial cds6416416%9e-17981%AF369678.1Select seq gb|AY690831.1|Yellow fever virus strain SPU 160/03/23 polyprotein gene, partial cds6396395%3e-17885%AY690831.1Select seq gb|AY161951.1|Yellow fever virus strain OBS7904 polyprotein gene, partial cds6376376%1e-17781%AY161951.1Select seq gb|AY540433.1|Yellow fever virus strain OBS7937 polyprotein gene, partial cds6366366%4e-17781%AY540433.1Select seq gb|AY540431.1|Yellow fever virus strain OBS7687 polyprotein gene, partial cds6366366%4e-17781%AY540431.1Select seq gb|AF369682.1|AF369682Yellow fever virus strain H117491 polyprotein mRNA, partial cds6366366%4e-17781%AF369682.1Select seq gb|AF369680.1|AF369680Yellow fever virus strain M. Adejumo polyprotein mRNA, partial cds6366366%4e-17781%AF369680.1Select seq gb|AY161941.1|Yellow fever virus strain OBS2250 polyprotein gene, partial cds6326326%5e-17681%AY161941.1Select seq gb|AY161938.1|Yellow fever virus strain Cepa#2 polyprotein gene, partial cds6326326%5e-17681%AY161938.1Select seq gb|AY540432.1|Yellow fever virus strain OBS7549 polyprotein gene, partial cds6326326%5e-17681%AY540432.1Select seq gb|AF369681.1|AF369681Yellow fever virus strain A. Adeoye polyprotein mRNA, partial cds6326326%5e-17681%AF369681.1Select seq gb|AF369679.1|AF369679Yellow fever virus strain A. Jimo polyprotein mRNA, partial cds6326326%5e-17681%AF369679.1Select seq gb|KM388820.1|Yellow fever virus strain 3A polyprotein gene, partial cds6276276%2e-17481%KM388820.1Select seq gb|AY161948.1|Yellow fever virus strain 03535098 polyprotein gene, partial cds6276276%2e-17481%AY161948.1Select seq gb|AY161939.1|Yellow fever virus strain Cepa#1 polyprotein gene, partial cds6276276%2e-17481%AY161939.1Select seq gb|AY161934.1|Yellow fever virus strain ARVO544 polyprotein gene, partial cds6276276%2e-17481%AY161934.1Select seq gb|AY540478.1|Yellow fever virus strain OBS5041 polyprotein gene, partial cds6276276%2e-17481%AY540478.1Select seq gb|AF369684.1|AF369684Yellow fever virus strain BA 55 polyprotein mRNA, partial cds6276276%2e-17481%AF369684.1Select seq gb|AF369677.1|AF369677Yellow fever virus strain IB AR 45244 polyprotein mRNA, partial cds6276276%2e-17481%AF369677.1Select seq gb|DQ859065.1|Uganda S virus polyprotein gene, complete cds623145859%3e-17369%DQ859065.1Select seq gb|HM582846.1|Yellow fever virus strain 15094 polyprotein gene, partial cds6216216%9e-17381%HM582846.1Select seq gb|AY161933.1|Yellow fever virus strain 1914 polyprotein gene, partial cds6196196%3e-17281%AY161933.1Select seq gb|AY161932.1|Yellow fever virus strain 1899/81 polyprotein gene, partial cds6196196%3e-17281%AY161932.1Select seq gb|DQ872412.1|Yellow fever virus strain CAREC788379 polyprotein gene, partial cds6186186%1e-17180%DQ872412.1Select seq gb|AY161947.1|Yellow fever virus strain OBS6530 polyprotein gene, partial cds6186186%1e-17181%AY161947.1Select seq gb|AY161945.1|Yellow fever virus strain OBS2243 polyprotein gene, partial cds6186186%1e-17181%AY161945.1Select seq gb|AY161944.1|Yellow fever virus strain HEB4246 polyprotein gene, partial cds6186186%1e-17181%AY161944.1Select seq gb|AY161936.1|Yellow fever virus strain HEB4236(153) polyprotein gene, partial cds6186186%1e-17181%AY161936.1Select seq gb|AF369689.1|AF369689Yellow fever virus strain SH 1339 polyprotein mRNA, partial cds6186186%1e-17180%AF369689.1Select seq gb|AF369688.1|AF369688Yellow fever virus strain SH 1464 polyprotein mRNA, partial cds6186186%1e-17180%AF369688.1Select seq gb|KM388819.1|Yellow fever virus strain 1A polyprotein gene, partial cds6166165%4e-17182%KM388819.1Select seq gb|AY161930.1|Yellow fever virus strain 287/78 polyprotein gene, partial cds6166166%4e-17180%AY161930.1Select seq gb|AY161940.1|Yellow fever virus strain OBS2240 polyprotein gene, partial cds6146146%1e-17080%AY161940.1Select seq gb|AY161937.1|Yellow fever virus strain 149 polyprotein gene, partial cds6146146%1e-17080%AY161937.1Select seq gb|AY161935.1|Yellow fever virus strain HEB4224 polyprotein gene, partial cds6146146%1e-17080%AY161935.1Select seq gb|AY161931.1|Yellow fever virus strain R35740 polyprotein gene, partial cds6146146%1e-17080%AY161931.1Select seq gb|AY540446.1|Yellow fever virus strain BeH141816 polyprotein gene, partial cds6146146%1e-17080%AY540446.1Select seq gb|AF369671.1|AF369671Yellow fever virus strain SH 28580 polyprotein mRNA, partial cds6146146%1e-17080%AF369671.1Select seq gb|AF369670.1|AF369670Yellow fever virus strain HD 38564 polyprotein mRNA, partial cds6146146%1e-17080%AF369670.1Select seq gb|AY161943.1|Yellow fever virus strain HEB4245 polyprotein gene, partial cds6106106%2e-16980%AY161943.1Select seq gb|AY161927.1|Yellow fever virus strain 1362/77 polyprotein gene, partial cds6096096%6e-16980%AY161927.1Select seq gb|AF369690.1|AF369690Yellow fever virus strain Dar Ar 276 polyprotein mRNA, partial cds6096096%6e-16980%AF369690.1Select seq gb|AF369687.1|AF369687Yellow fever virus strain SH1446 polyprotein mRNA, partial cds6096096%6e-16980%AF369687.1Select seq gb|AY161929.1|Yellow fever virus strain 1371 polyprotein gene, partial cds6076076%2e-16880%AY161929.1Select seq gb|AY839632.1|Yellow fever virus strain ArD76320/Senegal90 polyprotein gene, partial cds6076076%2e-16880%AY839632.1Select seq gb|AY161950.1|Yellow fever virus strain IQT5591 polyprotein gene, partial cds6056056%7e-16880%AY161950.1Select seq gb|AY161942.1|Yellow fever virus strain HEB4240 polyprotein gene, partial cds6056056%7e-16880%AY161942.1Select seq gb|AF369691.1|AF369691Yellow fever virus strain ArD93388 polyprotein gene, partial cds6056056%7e-16880%AF369691.1Select seq gb|AF369686.1|AF369686Yellow fever virus strain Jose Cachatra polyprotein mRNA, partial cds6056056%7e-16880%AF369686.1Select seq gb|U52402.1|YFU52402Yellow fever virus Nigeria46 non-structural protein 4A mRNA, partial cds6056057%7e-16878%U52402.1Select seq gb|HM582844.1|Yellow fever virus strain FMD1240 polyprotein gene, partial cds6036036%2e-16781%HM582844.1Select seq gb|KM388823.1|Yellow fever virus strain 7A polyprotein gene, partial cds5985985%1e-16582%KM388823.1Select seq gb|HM582847.1|Yellow fever virus strain FVB0196 polyprotein gene, partial cds5985986%1e-16580%HM582847.1Select seq gb|AY161949.1|Yellow fever virus strain OBS6745 polyprotein gene, partial cds5965966%4e-16580%AY161949.1Select seq gb|U52415.1|YFU52415Yellow fever virus Senegal65 non-structural protein 4A mRNA, partial cds5895897%5e-16378%U52415.1
  14. LOCUS KX010995 10822 bp RNA linear VRL 08-MAY-2016 DEFINITION Yellow fever virus isolate CIC2, complete genome. ACCESSION KX010995 VERSION KX010995.1 GI:1024994385 KEYWORDS . SOURCE Yellow fever virus (YFV) ORGANISM Yellow fever virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus; Yellow fever virus group. REFERENCE 1 (bases 1 to 10822) AUTHORS Cui,S., Liang,Z., Li,J., Wang,Q., Chen,L., Li,X., Huo,D., Zheng,Y., Chen,Y., Zhang,L., Dou,X., Tian,L. and Sun,Y. TITLE Direct Submission JOURNAL Submitted (25-MAR-2016) Department of Infectious Disease and Endemic Disease Control, Beijing Center for Disease Prevetion and Control, 16 Hepingli Middle Street, Dongcheng District, Beijing 100013, China COMMENT ##Assembly-Data-START## Assembly Method :: samtools v. v1.2 Sequencing Technology :: IonTorrent ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10822 /organism="Yellow fever virus" /mol_type="genomic RNA" /isolate="CIC2" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:11089" /country="China" /collection_date="17-Mar-2016" /note="clinical-imported case 2" CDS 119..10357 /note="gp1" /codon_start=1 /product="polyprotein" /protein_id="ANC33490.1" /db_xref="GI:1024994386" /translation="MSGRKAQGRTLGVNMVRRGVRSLSNKIKQKTKQIGNRPGPSRGV QGFIFFFLFNILTGKKLTAHLKKLWRMLDPRQGLAVLRKVKRVVASLMRGLASRKRRS NEMAMVPLLLLGLLALSGGVTLVRKNRWLLLNVTAEDLGKTFSVGTGNCTTNILEAKY WCPDSMEYNCPNLSPREEPDDIDCWCYGVENVRVAYGRCDAVGRSKRSRRAIDLPTHE NHGLKTRQEKWMTGRMGERQLQKIERWLVRNPFFAVTALAIAYLVGNNTTQRVVIALL VLAVGPAYSAHCIGITDRDFIEGVHGGTWVSATLEQDKCVTVMAPDKPSLDISLQTVA IDGPAEARKVCYSAVLTHVKINDKCPSTGEAHLAEENDGDNACKRTYSDRGWGNGCGL FGKGSIVACAKFTCAKSMSLFEVDQTKIQYVIRAQLHVGAKQENWNTDIKTLKFDALS GSQEAEFTGYGKATLECQVQTAVDFGNSYIAEMEKDSWIVDRQWAQDLTLPWQSGSGG IWREMHHLVEFEPPHAATIRVLALGNQEGSLKTALTGAMRVTKDENDNNLYKLHGGHV SCRVKLSALTLKGTSYKMCTDKMSFVKNPTDTGHGTVVMQVKVPKGAPCKIPVIVADD LTAAVNKGILVTVNPIASTNDDEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGSSIG KLFTQTMKGAERLAVMGDAAWDFSSAGGFFTSVGKGIHTVFGSAFQGLFGGLSWITKV IMGAVLIWVGINTRNMTMSMSMILVGVIMMFLSLGVGADQGCAVNFGKRELKCGDGIF VFRDSDDWLTKYSYYPEDPVKLASIIKASHEEGKCGLNSVDSLXHEMWRSRADEINAI FEENEVDISVVVQDPKNIYQRGTHPFSRIRDGLQYGWKTWGKNLVFSPGRKNGSFIID GKSRKECPFSNRVWNSFQIEEFGMGVFTTRVFMDATFDYSVDCDGAILGAAVNGKKSA HGSPTFWMGSHEVNGTWMIHTLETLDYKECEWPLTHTIGTSVEESDMFMPRSIGGPVS SHNRIPGYKVQTNGPWMQVPLEVKREVCPGTSVVVDSNCDGRGKSTRSTTDSGKIIPE WCCRSCTMPPVSFHGSDGCWYPXEIRPMRTSDSHLVRSWVTAGEVHAVPFGLVSMMIA MEVVLRRRQGPKQMLVGGVVLLGAMLVGQVTVLDLVKFVVAVGLHFHEINNGGDAMYM ALIASFSIRPGLLMGFGLRTLWSPRERLVMAFGAAMVEIAXGGMMGGLWQYLNAVSLC VLTINAISSRKASNMILPLMALMTPMTMHEVRMATMLFCTVVIIGVLHQNSKDTSMQK TIPIVALTLTSYMGLTQPFLGLCAYMSTQVFGRRSIPVNEALAAAGLVGVLAGLAFQD MENFLGPMAVGGILMMLVSVAGRVDGLELRKLGEISWEEEAEISGSSSRYDVALSEQG EFKLLSEDKVPWDQIVMTSLALVGAAIHPFALLLVLGGWILHIKGARRSGDVLWDIPT PKVIEECEHLEDGIYGIFQSTFLGASQRGVGVAQGGVFHTMWHVTRGAFLLRNGKKLV PSWASVKEDLVAYGGSWKLDGRWDGEEEVQLIAAVPGKSVVNVQTKPSLFKVKNGGEI GAVALDYPSGTSGSPIVNRNGEVVGLYGNGILVGDNSFVSAISQTELKEESKEELQEI PTMLKKGMTTILDFHPGAGKTRRFLPQILAECARRRLRTLVLAPTRVVLSEMKEAFQG LDVKFHTQAFSAHGSGKEVIDAMCHATLTYRMLEPTRVVNWEVIIMDEXHFLDPASIA ARGWAAHRARAXESATILMTATPPGTSDEFPHSNGEIEDVQTDIPSEPWTTGHEWILA DKRPTAWFLPSIRAANVMAASLRKAGKNVVVLNRKTFEKEYPTIKQKKPDFILATDIA EMGANLCVERVLDCRTAYKPVLVDEGKKVAIKGPLRISASSAAQRRGRIGRNPNRDGD SYYYSEPTSEDNAHHVCWLEASMLLDNMEVXGGMVAPLYGIEGTKTPVSPGEMRLRDD QRRVFRELVRGCDLPVWLAWQVAKAGLKTNDRKWCFEGPEEHEILNDNGETVKCRSPG GAKRALRPRWCDERVSSDQSALADFIKFAEGRRGAAEMLVILTELPDFLAKKGGEAMD TISVFLHSEEGSRAYRNALSMMPEAMTIVMLFLLAGLLTSGAVIFFMSPKGMSRMSMA MGTMAGSGYLMFLGGVKPTHISYVMLIFFVLMVVIIPEPGQQRSIQDNQVAYLIIGIL TLLSVVAANELGMLEKTKEDFFGKRDIXTPSGAIPWSWPDLDLKPGAAWTVYVGIVTM LSPMLHHWIKVEYGNLSLSGIAQSASVLSFMDKGIPFMKMNISVVILLVSGWNSITVI PLLCGIGGAMLHWTLILPGIKAQQSKLAQKRVFHGVAKNPVVDGNPTADIEEAPEMPA LYEKKLALYLLLALSLMSVAMCRTPFSLAEGIVLSSAALGPLIEGNTSLLWNGPMAVS MTGVMRGNYYAFVGVMYNLWKMKTGRRGRASGKTLGEVWKRELNLLDKQQFEMYKRTD IIEVDRDMARRHLAEGKVDTGVAVSRGTAKLRWFHERGYVKLEGRVTDLGCGRGGWCY YAAAQKEVSGVKGYTLGRDGHEKPMNVQSLGWNIVTFKDKTDIHRLEPLKCETLLCDI GESSPSSATEGERTLRVLDTVEKWLACGVDNFCIKVLAPYMPDVIEKLELLQRRFGGT VIRNPLSRNSTHEMYYVSGARSNITFTVNQTSRLLMRRMRRPTGKVTLEADVILPIGT RSVETDKGPLDKDAIEERVERIKNEYATTWFYDNDNPYRTWHYCGSYVTKTSGSAASM INGVIKILTFPWDRIEEVTRMAMTDTTPFGQQRVFKEKVDTRAKDPPAGTRKIMKVVN RWLFRHLSREKNPRLCTKEEFIAKVRSHAAVGAFLEEQEQWKTANEAVLDPKFWEMVD AERKLHQQGRCQSCVYNMMGKREKKLSEFGKAKGSRAIWYMWLGARFLEFEALGFLNE DHWASRENSGGGVEGIGLQYLGYVIRDLSTKEGGGFYADDTAGWDTRITEADLDDEQE IMSYMSPEQRKLAWAIMEMTYKNKVVKVLRPAPGGKAFMDIISRRDQRGSXQVVTYAL NTITNLKVQLIRMAEAEMVINHQHVQECGENVLERLETWLAENGCDRLSRMAVSGDDC VVRPVDDRFGLALSHLNAMSKVRKDISEWQPSKGWTDWENVPFCSHHFHELVLKDGRK IVVPCRDQDELIGRGRVSPGNGWMIKETACLSKAYANMWSLMYFHKRDMRLLSFAVSS AVPTAWVPSGRTTWSVHGRGEWMTTEDMLDVWNRVWVLNNPHMTDKTTIKEWRDAPYL TKRQDKLCGSLIGMTNRATWASHIHLVIHRIRTLIGQEKFTDYLTVMDRYSVDADLQP GELI" ORIGIN 1 taaatccctg ggtgctaatt gaggtgcatt ggtctgcaaa tcgagttgct aggcaataaa 61 cacatttgga ttaattttaa tcgttcgttg agcgattagc agagaactga ccagagaaat 121 gtctggtcga aaagctcagg gtagaaccct gggcgtcaat atggtaagac gaggggttcg 181 ctccttgtca aacaaaataa aacaaaaaac aaaacagatt ggaaacagac ctggcccttc 241 aagaggtgtt caaggattta ttttcttctt tttgtttaac attctgactg ggaaaaagtt 301 gactgctcat ctaaaaaaac tctggaggat gcttgatcca aggcaggggc ttgctgtact 361 gcgaaaggtc aaaagagttg tagctagctt aatgagaggg ctggcttcca ggaaacgtag 421 atccaatgaa atggccatgg taccactcct gttactgggt ttgttggctc tatcaggagg 481 agtgaccctc gtcagaaaga acagatggtt gctcctgaat gtaactgctg aagacctggg 541 gaaaacgttt tcagtgggaa ctgggaattg caccacgaat attctggaag caaaatactg 601 gtgccccgac tcaatggaat acaattgccc caatctcagt ccaagagaag agccagatga 661 catagattgc tggtgttatg gagtggaaaa tgtcagagtg gcctatggaa gatgtgatgc 721 ggtagggcga tcaaaacgct ccaggagagc gattgatcta cccacacatg agaaccatgg 781 actaaagact cggcaggaga agtggatgac aggcagaatg ggtgagaggc agctccagaa 841 gattgaaaga tggctggtta ggaatccatt ttttgcggtc acagcattgg caatagccta 901 tctggtgggt aacaacacga cacaacgagt ggtcatagca ctactggttc tagcggttgg 961 tccagcgtac tctgcccatt gcatagggat aaccgacaga gatttcattg aaggtgtcca 1021 tgggggcact tgggtgtcag ccactctgga gcaggacaaa tgcgtgactg taatggcccc 1081 tgacaaacct tctctggaca tctcactaca aacagtggca atcgatggac cggctgaagc 1141 gaggaaggtt tgctacagtg cagtcctaac ccatgtgaag atcaatgaca aatgcccgag 1201 cactggtgag gcccaccttg cagaggaaaa tgatggtgac aatgcttgta aacggacata 1261 ttctgacaga ggctggggca atggctgtgg tctttttggg aaaggaagca tcgtggcttg 1321 tgccaagttt acatgtgcca aatctatgag tctctttgag gtggatcaga ccaaaatcca 1381 atatgtcatc agggcccagc tccatgtggg tgctaaacag gaaaactgga acacagacat 1441 aaaaacgctg aaatttgatg ctctttctgg ctcacaggag gctgaattca ctggttatgg 1501 aaargcaaca ctagagtgtc aggtccagac tgccgtggac tttgggaaca gctacatcgc 1561 agagatggaa aaagatagct ggatcgttga ccgccaatgg gcacaggact tgacactgcc 1621 atggcagagt gggagtggtg gcatatggag agaaatgcac caccttgttg agtttgagcc 1681 cccacatgct gccacaatta gggtgctggc cttgggcaat caagaaggct ccttgaagac 1741 cgctctcaca ggcgctatgc gcgtcaccaa ggatgagaat gacaacaact tgtacaaact 1801 gcacggtggt cacgtctcct gtagagtgaa actgtcagcc ctcactctca aaggaacatc 1861 ctacaagatg tgcacagaca aaatgtcatt tgtcaagaat ccaacggata cagggcatgg 1921 cacagttgtc atgcaagtaa aggtccccaa aggggcccca tgcaagattc ccgtgattgt 1981 ggcagatgac ctaacggcag cagtgaacaa aggcatcttg gtcactgtca atcctattgc 2041 atccacaaat gatgatgaag ttctgattga ggtcaatccc ccttttgggg atagctacat 2101 catagttggg actggagact cacgactgac ctatcagtgg cacaaagaag ggagttcaat 2161 aggaaaattg ttcacacaga caatgaaagg agctgaacgt cttgcagtga tgggtgatgc 2221 tgcttgggat tttagttctg ctggggggtt cttcacatct gtgggaaaag gaatccatac 2281 cgtgtttggc tcggccttcc aggggctgtt tggtggcttg agttggatca cgaaagtcat 2341 catgggagcc gtgctcatct gggtgggaat aaacacccgc aacatgacca tgtccatgtc 2401 catgatcttg gtaggtgtga tcatgatgtt tctttcacta ggagttgggg ctgaccaagg 2461 atgtgctgtt aactttggga aacgcgagct caaatgcgga gatggcatct ttgtgtttag 2521 agactctgat gactggctca caaagtactc atactatcct gaagaccctg tcaaattggc 2581 atccatcatt aaagcctccc acgaggaggg caaatgtgga ttgaattcag ttgattccct 2641 cgamcacgag atgtggagga gtagggcgga tgagatcaac gccatttttg aagaaaatga 2701 agtagacatc tcggtcgtcg tccaagaccc aaagaacatc taccaaagag ggacccaccc 2761 gttctcaagg atccgtgacg gattgcagta tggatggaag acctggggaa aaaaccttgt 2821 tttctcacca gggaggaaga acggcagctt catcattgac gggaagtcac gaaaggagtg 2881 ccccttctct aacagagtgt ggaactcatt ccagattgag gagtttggca tgggggtctt 2941 cacaacacga gtktttatgg acgcgacctt tgactattca gtggactgtg atggagccat 3001 cctgggtgca gcggtgaatg gaaagaagag tgcccatgga tcacccacat tttggatggg 3061 aagtcatgaa gtcaatggaa cgtggatgat acacactttg gaaactcttg attacaagga 3121 gtgtgaatgg ccactgacac acactattgg aacctcagta gaagaaagtg acatgttcat 3181 gccccggtcc attggaggtc cggtgagttc tcacaaccgc atcccgggtt acaaggtgca 3241 aaccaatggg ccatggatgc aagtccccct ggaagtaaaa agggaagtct gtccagggac 3301 aagcgtggtg gtggactcca actgtgatgg acgtggaaaa tcaacgagat caaccactga 3361 cagtgggaaa ataatcccgg aatggtgttg cagatcttgt actatgcctc cagtcagctt 3421 ccatggaagc gatggttgtt ggtatcctay ggagatcaga cccatgagaa catccgacag 3481 ccacctagtg agatcctggg tgactgcagg agaagttcat gcagtaccct ttggactggt 3541 gagcatgatg attgccatgg aggtggtgtt gcgcagaagg caaggaccaa aacaaatgct 3601 ggtaggagga gttgtgctgc ttggagcgat gttagtggga caagtcacag tcttagacct 3661 tgtgaagttt gttgtggcag tgggattgca cttccatgaa attaataacg gaggagatgc 3721 catgtacatg gcattgattg ccagcttttc catccggcca ggcctgctca tgggctttgg 3781 gctgcgcaca ctgtggagtc ctcgcgagcg acttgtaatg gcatttggag cagccatggt 3841 tgagattgcc ttmggtggaa tgatgggtgg gctttggcag tacttgaacg ccgtttcact 3901 gtgtgtgctc accataaatg caatctcatc aaggaaggcc tcaaatatga tcctccccct 3961 gatggcactc atgactccca tgacaatgca tgaggtgagg atggcgacga tgctgttctg 4021 cactgttgtc ataatagggg tgcttcatca gaattcaaaa gacacatcta tgcaaaagac 4081 cattcccatt gtagccctga cactgacctc atacatgggc ttgacccagc cctttctagg 4141 gctgtgtgca tacatgtcca cgcaggtgtt tggcagaagg agtatacctg tgaatgaagc 4201 cttggcagcg gctggcttgg tgggagtgct agcagggcta gccttccaag acatggaaaa 4261 ctttttgggt ccaatggcgg tgggggggat cctcatgatg ttagttagtg tggcagggag 4321 agttgatgga ctagagctca ggaaacttgg tgaaatctcc tgggaagaag aagctgaaat 4381 aagtggaagc tctagccgct atgatgtggc actcagtgag cagggtgaat ttaaactcct 4441 ctcagaggac aaagtgccct gggaccagat agtaatgaca tccctagccc tcgtgggagc 4501 agccatacat ccatttgccc tcttgctggt cttgggagga tggatcctgc acattaaagg 4561 tgctaggagg agtggggatg ttctttggga cattcctacg ccaaaggtga ttgaggaatg 4621 tgagcacctg gaggatggga tctatggcat atttcagtca accttccttg gagcctcgca 4681 gcgaggtgtt ggagtggcgc agggaggggt cttccacaca atgtggcatg tcactagggg 4741 ggcattcctc ttgaggaatg gaaagaaact ggttccgtct tgggcttctg tgaaggagga 4801 tctggtggct tatggtggtt cctggaaact agacgggaga tgggatggtg aggaggaagt 4861 ccaactcatc gctgctgtgc ctggaaaatc tgttgtcaac gttcaaacaa aaccaagctt 4921 gttcaaagtg aaaaatggtg gtgagattgg agcagttgct ctagactacc ccagtggaac 4981 ctcaggctcc cccattgtga accgaaatgg tgaagtggty gggctctatg gcaatggaat 5041 tctggtgggt gataactcct ttgtgtctgc catctcacaa actgaattga aggaagaatc 5101 caaagaagaa ctgcaagaaa taccaactat gctgaaaaaa ggaatgacca ccatccttga 5161 cttccaccct ggggcgggga aaacccgtag gttcctgcct caaatattgg cggagtgtgc 5221 cagaaggcgt ttgcgcactc tggtattagc acccaccagg gttgttttgt cagagatgaa 5281 agaagctttt caggggttgg atgtgaaatt ccacacacaa gctttctcag cccatgggag 5341 tgggaaggag gtcattgacg caatgtgcca tgcaaccctt acatatagaa tgctggaacc 5401 aacaagggta gtcaactggg aggtcattat tatggatgag gygcactttc tggatcctgc 5461 tagcatagca gcgagaggct gggcggctca tagagcaaga gcaartgaga gcgccaccat 5521 acttatgacc gccaccccac caggcaccag tgacgaattc cctcactcca atggtgagat 5581 tgaggacgtc cagactgaca tccccagcga gccatggacc acaggacatg aatggatctt 5641 ggcggacaag cgcccaactg catggttcct tccatcgatc agagcagcaa atgtcatggc 5701 agcctcgctg cggaaagcgg graaaaatgt ggtggtactg aataggaaaa cctttgaaaa 5761 ggagtacccc accattaagc agaagaaacc ggatttcatc cttgccaccg atatcgctga 5821 gatgggagca aacttgtgtg tggagagagt cttggactgc agaactgcct acaagcctgt 5881 cctggttgat gaagggaaga aggtggctat caaagggccg ctacgaatct cagcgtcatc 5941 ggccgctcag aggagaggac gcattggacg caatcccaac agagatggtg actcttacta 6001 ctactcagaa cctaccagtg aggacaatgc acaccatgtg tgctggctgg aggcttccat 6061 gctcctggat aacatggagg ttwgaggggg gatggttgct ccactttatg gcattgaggg 6121 aacaaagact cccgtctctc caggagaaat gaggctaaga gatgatcaga gaagggtctt 6181 tagagagttg gtgcgagggt gtgatttgcc agtgtggttg gcatggcaag tggcaaaagc 6241 cggcctgaag accaatgacc gcaaatggtg ttttgagggt cccgaagagc atgaaatact 6301 caatgacaat ggtgaaacag taaagtgtag atctccgggc ggagcaaaaa gagcattgag 6361 acctagatgg tgtgacgaga gagtttcctc agaccagagt gccttggctg acttcattaa 6421 gtttgcagaa ggtagaagag gggctgctga gatgcttgtg atcctcacgg agttgcccga 6481 cttcctggca aagaagggtg gggaagccat ggataccatc agtgtgttcc tacattctga 6541 agagggttca agagcgtaca gaaatgccct gtcaatgatg ccagaagcca tgaccattgt 6601 catgctcttc ctgcttgccg gactcttgac ctcaggagcg gtgattttct tcatgtcgcc 6661 aaaaggcatg agtagaatgt caatggcaat gggtaccatg gctggcagtg gatatctcat 6721 gtttctgggg ggagtaaaac caacccacat ctcttacgtc atgttaatat tctttgtcct 6781 catggtcgtc ataattcccg aaccaggaca gcagagatca atccaggata accaagttgc 6841 ctacctcata attgggatct tgacattgtt atcagttgtg gcagctaatg aactagggat 6901 gctggagaag accaaggaag atttttttgg aaagagagac atcamaacac cragtggggc 6961 aatcccatgg agttggcctg acctggatct gaaacctggg gcggcctgga cagtctatgt 7021 gggaatcgtg acgatgttgt ctcccatgtt acaccattgg ataaaagttg agtatggcaa 7081 tttgtcacta tcgggaatag cccaatctgc ctcagttctt tcatttatgg acaaaggaat 7141 tcccttcatg aaaatgaata tatctgtggt catacttttg gtcagtggct ggaattcaat 7201 cacagtgatc cctcttttgt gcggcattgg tggagccatg ctgcactgga cgctcatact 7261 tcctgggatt aaagcccagc aatcaaagct ggctcaaaaa agagtttttc atggagtggc 7321 aaaaaatcca gttgttgatg gcaatccaac tgctgacatt gaggaagccc cagaaatgcc 7381 agctttatat gaaaagaagc tggctcttta cctccttctg gccctaagcc tcatgtcagt 7441 tgccatgtgc agaacccctt tttccttagc ggaaggaata gtactgtcat ctgccgccct 7501 tggaccwctc attgagggga acactagtct gttgtggaat ggcccaatgg ccgtttccat 7561 gactggagtc atgcgtggca actactacgc ttttgtggga gtcatgtaca atctctggaa 7621 aatgaaaaca gggcgtagag ggagagcaag tggaaaaaca ttgggtgagg tctggaagcg 7681 tgaacttaac ttgctagaca aacaacaatt tgaaatgtac aaaagaacag acatcattga 7741 ggtggaccga gacatggcac gacgacactt ggcagaggga aaggtggaca cgggagtggc 7801 cgtgtcgaga gggactgcaa agctgagatg gttccacgag cgtggctatg tgaagctaga 7861 aggaagggtc accgatcttg ggtgtggacg tggaggctgg tgctactatg cagcagctca 7921 aaaagaagtt agtggtgtga aggggtatac ccttggcaga gatggccatg agaaacctat 7981 gaatgtccaa agcttgggat ggaatattgt gacttttaag gacaagactg atattcaccg 8041 actggagcca ctcaagtgtg aaactctcct ctgtgacatc ggagaatcgt ctccatcctc 8101 cgcaactgag ggtgagagga ccttaagagt tctggacaca gttgaaaagt ggttggcttg 8161 tggagtggat aacttttgca tcaaagttct ggcaccatac atgcccgatg tgatagagaa 8221 actggagctt cttcaaagaa gattcggtgg aaccgtcatc aggaatcctc tgtccagaaa 8281 ttctactcat gaaatgtact acgtttcagg agcaagaagt aacatcacat tcacagtcaa 8341 ccagacatca cgcctgctga tgcgaaggat gaggcggccc acaggcaaag ttaccttgga 8401 agctgatgtc attcttccga taggcacgcg cagtgtggaa actgataaag gcccattgga 8461 taaggatgct attgaggaaa gagttgagag aatcaagaat gaatatgcca ctacatggtt 8521 ctatgacaat gacaacccgt atagaacgtg gcattattgt ggctcctatg tgaccaaaac 8581 gtcaggaagt gcagccagca tgataaatgg agtcatcaaa atcttgactt ttccatggga 8641 caggatagaa gaagtcacaa gaatggcaat gactgacacc acaccttttg gacaacaaag 8701 agttttcaag gagaaagtag acacaagagc aaaagaccct cctgctggaa caaggaagat 8761 catgaaggtg gtgaatagat ggttgtttcg gcatctgtcc agggagaaga accccaggtt 8821 gtgcaccaaa gaagaattca ttgccaaagt acggagccat gcagcagtgg gggcttttct 8881 agaggaacaa gagcagtgga aaacggccaa tgaggcagtc cttgatccaa agttttggga 8941 aatggtcgat gcagaacgca aacttcatca gcaggggcga tgccaatcct gtgtgtacaa 9001 catgatggga aagagggaaa agaaactctc tgaatttgga aaggccaaag ggagccgtgc 9061 tatctggtac atgtggcttg gggcacggtt ccttgagttt gargctcttg ggtttttaaa 9121 tgaagatcac tgggcctccc gggagaactc ggggggagga gttgagggca taggactcca 9181 gtacttgggc tatgttatca gggacttgtc aaccaaagaa ggtggagggt tttatgcgga 9241 tgacacggca gggtgggaca cacgcatcac agaagctgac ctggatgacg agcaagagat 9301 catgagttac atgagccctg aacaaaggaa gctggcctgg gctataatgg aaatgacata 9361 caagaacaaa gtggttaagg tgctgaggcc agccccagga ggcaaggcct tcatggacat 9421 catcagccgg agagaccaaa gggggtcarr acaagtkgtg acatacgccc tcaacaccat 9481 aaccaatcta aaagtccagc tcataagaat ggctgaagct gaaatggtga tcaaccatca 9541 gcatgtgcag gagtgtggtg aaaatgtctt agagcggctt gaaacttggc ttgctgaaaa 9601 cggatgtgac agattgagcc gaatggctgt gagtggggat gattgtgttg tgagaccggt 9661 ggatgacaga tttggcctgg ccctttccca tcttaatgca atgtccaaag ttaggaagga 9721 catttcagaa tggcaaccct ccaaaggatg gacagattgg gaaaatgttc ctttctgctc 9781 tcaccacttc catgaactgg tgttgaaaga tgggaggaag atagtggtgc cttgcagaga 9841 ycaagatgaa ctgataggga gagggagagt gtccccagga aatggctgga tgatcaagga 9901 aacagcctgc ctcagcaaag cttacgcaaa catgtggtca ctgatgtact ttcacaagag 9961 ggacatgagg ctactttcat tcgctgtctc ctccgctgtt ccaacggcct gggtgcccag 10021 tggaaggaca acgtggtctg tccacggaag aggggagtgg atgacaactg aggacatgct 10081 agatgtctgg aacagggtgt gggtgttgaa taacccgcac atgacggaca aaacaaccat 10141 caaggagtgg agagatgctc cctacctcac aaagagacag gataagcttt gcgggtcact 10201 gataggaatg acaaacaggg ccacatgggc atctcacatc caccttgtga tccaccggat 10261 cagaactcta ataggtcaag agaagttcac agactacctc accgtcatgg acaggtattc 10321 tgttgatgcc gaccttcagc caggagagct tatctgagac attacaacat ggaaaaccgg 10381 gataaaaact acgggtggag aaccggactc cccacttgaa amatgtaaat arraaaccgg 10441 gatmaaaacw acgggyggag aaccggactc cccactgaat aggctataaa cgtcagccca 10501 ggatccaaaa atttgaatgg gtcttgccac cgctaagctg tgaggcggtg cgggctggga 10561 cagccgtttc ccgggcaacg acatgcctgg tttctgggac ttcccaaccc agagtaaaac 10621 gaaggagcct ccgccaccac cctcccacgg ggtgttggaa agatggggtc tagaggttag 10681 aggagaccct ccagggaaat tagtgggacc atattgacgc cagggaaaga ccggagtggt 10741 tctctgcttt tcctccaggg gtctgcgagc acagtttgct ctagaagaag cagacctttg 10801 gatgacaaaa cacaaaacca ct
  15. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX010994.1|Yellow fever virus isolate CIC1, complete genome1846518465100%0.0100%KX010994.1Select seq gb|AY968064.1|Yellow fever virus strain Angola71, complete genome1809018090100%0.099%AY968064.1Select seq gb|KX027336.1|Yellow fever virus isolate CIC4, complete genome1800618006100%0.099%KX027336.1Select seq gb|KX010995.1|Yellow fever virus isolate CIC2, complete genome1800618006100%0.099%KX010995.1Select seq gb|KX010996.1|Yellow fever virus isolate CIC3, complete genome1796217962100%0.099%KX010996.1Select seq gb|DQ235229.1|Yellow fever virus strain Couma, complete genome1140011400100%0.085%DQ235229.1Select seq gb|AY968065.1|Yellow fever virus strain Uganda48a, complete genome1137611376100%0.085%AY968065.1Select seq gb|JN620362.1|Yellow fever virus strain Uganda 2010, complete genome1135311353100%0.085%JN620362.1Select seq gb|JF912179.1|Yellow fever virus strain BeAR378600, complete genome87908790100%0.079%JF912179.1Select seq gb|AY603338.1|Yellow fever virus strain Ivory Coast 1999, complete genome87878787100%0.079%AY603338.1Select seq gb|JF912186.1|Yellow fever virus strain BeH526722, complete genome87638763100%0.079%JF912186.1Select seq gb|JX898868.1|Yellow fever virus isolate HD117294 from Senegal, complete genome87588758100%0.079%JX898868.1Select seq gb|JF912184.1|Yellow fever virus strain BeH463676, complete genome87518751100%0.079%JF912184.1Select seq gb|JF912185.1|Yellow fever virus strain BeAR513008, complete genome87448744100%0.079%JF912185.1Select seq gb|AY572535.1|Yellow fever virus strain Gambia 2001, complete genome87428742100%0.079%AY572535.1Select seq gb|JF912183.1|Yellow fever virus strain BeH423602, complete genome87408740100%0.079%JF912183.1Select seq gb|JX898873.1|Yellow fever virus isolate ArD149214 from Senegal, complete genome87258725100%0.079%JX898873.1Select seq gb|JX898874.1|Yellow fever virus isolate ArD149194 from Senegal, complete genome87228722100%0.079%JX898874.1Select seq gb|KM388817.1|Yellow fever virus strain 2A polyprotein gene, complete cds87208720100%0.079%KM388817.1Select seq gb|JX898870.1|Yellow fever virus isolate ArD121040 from Senegal, complete genome87208720100%0.079%JX898870.1Select seq gb|JX898875.1|Yellow fever virus isolate ArD149815 from Senegal, complete genome87168716100%0.079%JX898875.1Select seq gb|KM388816.1|Yellow fever virus strain 10A polyprotein gene, complete cds87028702100%0.079%KM388816.1Select seq gb|JF912187.1|Yellow fever virus strain BeH622205, complete genome87028702100%0.079%JF912187.1Select seq gb|JF912188.1|Yellow fever virus strain BeH622493, complete genome86988698100%0.079%JF912188.1Select seq gb|JX898880.1|Yellow fever virus isolate ArD181564 from Senegal, complete genome86918691100%0.079%JX898880.1Select seq gb|JX898877.1|Yellow fever virus isolate ArD181464 from Senegal, complete genome86898689100%0.079%JX898877.1Select seq gb|JX898878.1|Yellow fever virus isolate ArD181250 from Senegal, complete genome86888688100%0.079%JX898878.1Select seq gb|JF912189.1|Yellow fever virus strain BeAR646536, complete genome86718671100%0.079%JF912189.1Select seq gb|JF912180.1|Yellow fever virus strain BeH394880, complete genome86688668100%0.079%JF912180.1Select seq gb|JX898876.1|Yellow fever virus isolate ArD156468 from Senegal, complete genome86668666100%0.079%JX898876.1Select seq gb|HM582851.1|Yellow fever virus strain TVP11767 polyprotein gene, complete cds86668666100%0.079%HM582851.1Select seq gb|AY640589.1|Yellow fever virus strain ASIBI, complete genome86648664100%0.079%AY640589.1Select seq gb|KF769016.1|Yellow fever virus strain Asibi, complete genome86618661100%0.079%KF769016.1Select seq gb|JF912190.1|Yellow fever virus strain BeH655417, complete genome86578657100%0.079%JF912190.1Select seq gb|KM388815.1|Yellow fever virus strain 9A polyprotein gene, complete cds86488648100%0.079%KM388815.1Select seq gb|KM388814.1|Yellow fever virus strain 6A polyprotein gene, complete cds86488648100%0.079%KM388814.1Select seq gb|JX898869.1|Yellow fever virus isolate DakArAmt7 from Cote d'Ivoire, complete genome86468646100%0.079%JX898869.1Select seq gb|JF912182.1|Yellow fever virus strain BeH422973, complete genome86308630100%0.079%JF912182.1Select seq gb|KF907504.1|Yellow fever virus strain 88/1999, complete genome86088608100%0.079%KF907504.1Select seq gb|KM388818.1|Yellow fever virus strain 8A polyprotein gene, complete cds86038603100%0.079%KM388818.1Select seq gb|U21056.1|YFU21056Yellow fever virus French viscerotropic strain, complete genome86018601100%0.079%U21056.1Select seq gb|JX898872.1|Yellow fever virus isolate ArD114972 from Senegal, complete genome85818581100%0.079%JX898872.1Select seq gb|JX898871.1|Yellow fever virus isolate ArD114896 from Senegal, complete genome85748574100%0.079%JX898871.1Select seq gb|U21055.1|YFU21055Yellow fever virus French neurotropic strain, complete genome85618561100%0.079%U21055.1Select seq gb|DQ100292.1|Yellow fever virus strain 17DD-Brazil, complete genome85528552100%0.079%DQ100292.1Select seq gb|U54798.1|YFU54798Yellow fever virus strain 85-82H Ivory Coast, complete genome85408540100%0.079%U54798.1Select seq gb|U17066.1|YFU17066Yellow fever virus vaccine strain 17DD, complete genome85348534100%0.079%U17066.1Select seq gb|GQ379162.1|Yellow fever virus strain case #1, complete genome85338533100%0.079%GQ379162.1Select seq emb|X03700.1|Yellow fever virus complete genome, 17D vaccine strain85298529100%0.079%X03700.1Select seq gb|KF769015.1|Yellow fever virus strain 17D-204, complete genome85258525100%0.078%KF769015.1Select seq gb|JN811143.1|Yellow fever virus 17D YF-VAX Vero adapted Series C P11, complete genome85258525100%0.078%JN811143.1Select seq gb|JX503529.1|Yellow fever virus strain YF/Vaccine/USA/Sanofi-Pasteur-17D-204/UF795AA/YFVax, complete genome85258525100%0.078%JX503529.1Select seq gb|JN628279.1|Yellow fever virus strain 17D RKI, complete genome85258525100%0.078%JN628279.1Select seq gb|AF052444.1|AF052444Yellow fever virus clone HONG8 polyprotein gene, complete cds85258525100%0.078%AF052444.1Select seq gb|JX949181.1|Yellow fever virus strain 17D polyprotein gene, complete cds85208520100%0.078%JX949181.1Select seq gb|GQ379163.1|Yellow fever virus strain case #2, complete genome85208520100%0.078%GQ379163.1Select seq gb|FJ654700.1|Yellow fever virus 17D/Tiantan, complete genome85208520100%0.078%FJ654700.1Select seq gb|DQ118157.1|Yellow fever virus isolate YF-AVD2791-93F/04 from Spain, complete genome85208520100%0.078%DQ118157.1Select seq emb|X15062.1|Yellow fever virus genomic RNA85208520100%0.078%X15062.1Select seq gb|AF052446.1|AF052446Yellow fever virus clone HONG10 polyprotein gene, complete cds85208520100%0.078%AF052446.1Select seq gb|AF052439.1|AF052439Yellow fever virus clone HONG3 polyprotein gene, complete cds85208520100%0.078%AF052439.1Select seq gb|AF052437.1|AF052437Yellow fever virus clone HONG1 polyprotein gene, complete cds85208520100%0.078%AF052437.1Select seq gb|U17067.1|YFU17067Yellow fever virus vaccine strain 17D-213, complete genome85208520100%0.078%U17067.1Select seq gb|JN811141.1|Yellow fever virus 17D YF-VAX Vero adapted Series A P11, complete genome85168516100%0.078%JN811141.1Select seq gb|AF052445.1|AF052445Yellow fever virus clone HONG9 polyprotein gene, complete cds85168516100%0.078%AF052445.1Select seq gb|AF052438.1|AF052438Yellow fever virus clone HONG2 polyprotein gene, complete cds85168516100%0.078%AF052438.1Select seq gb|JN811142.1|Yellow fever virus 17D YF-VAX Vero adapted Series B P11, complete genome85118511100%0.078%JN811142.1Select seq gb|AF094612.1|AF094612Yellow fever virus strain Trinidad 79A isolate 788379, complete genome84778477100%0.078%AF094612.1Select seq gb|JF912181.1|Yellow fever virus strain BeH413820, complete genome84038403100%0.078%JF912181.1Select seq gb|DQ322634.1|YFV replicon vector FMDV-2A-def, complete sequence8228834397%0.079%DQ322634.1Select seq gb|DQ322633.1|YFV replicon vector capsid-def, complete sequence8228834397%0.079%DQ322633.1Select seq gb|DQ322635.1|YFV replicon vector prME-def, complete sequence6551688781%0.078%DQ322635.1Select seq dbj|D14458.1|YFVCMENSYellow fever virus prM gene for precursor polyprotein, partial cds3162316234%0.080%D14458.1Select seq gb|AF052443.1|AF052443Yellow fever virus clone HONG7 polyprotein gene, partial cds2250225026%0.078%AF052443.1Select seq gb|GU951804.1|Yellow fever virus strain BeAn 131 polyprotein gene, partial cds2246224626%0.079%GU951804.1Select seq gb|AF052441.1|AF052441Yellow fever virus clone HONG5 polyprotein gene, partial cds2246224626%0.078%AF052441.1Select seq gb|AH005112.2|Yellow fever virus strain Y5 polyprotein and nonstructural protein NS2A mRNAs, partial cds2138251627%0.080%AH005112.2Select seq gb|DQ322638.1|VEEV replicon vector YFV-C2, complete sequence2129212922%0.080%DQ322638.1Select seq gb|AF052440.1|AF052440Yellow fever virus clone HONG4 polyprotein gene, partial cds2125212522%0.080%AF052440.1Select seq gb|L06480.1|YFVCAPSIDMYellow fever virus capsid protein, M protein, and envelope protein mRNAs2125212522%0.080%L06480.1Select seq gb|AY960140.1|Yellow fever virus strain ArB28153 polyprotein gene, partial cds2098209817%0.086%AY960140.1Select seq gb|DQ322642.1|VEEV replicon vector YFV-C3opt, complete sequence1929192922%0.078%DQ322642.1Select seq gb|DQ322640.1|VEEV replicon vector YFV-C3opt-NS2mut, complete sequence1929192922%0.078%DQ322640.1Select seq gb|U23578.1|YFU23578Yellow fever virus isolate SE7445/Uganda/1964/Human envelope protein (E) mRNA, partial cds1810181014%0.087%U23578.1Select seq gb|U23577.1|YFU23577Yellow fever virus isolate M-112/Sudan/1940/Human envelope protein (E) mRNA, partial cds1801180114%0.087%U23577.1Select seq gb|AY839636.1|Yellow fever virus strain ETH2777/Ethiopia61 envelope protein gene, partial cds1786178614%0.087%AY839636.1Select seq gb|DQ068260.1|Yellow fever virus strain SSUD03-01 envelope protein gene, partial cds1773177314%0.087%DQ068260.1Select seq gb|DQ068264.1|Yellow fever virus strain SSUD03-05 envelope protein gene, partial cds1768176814%0.087%DQ068264.1Select seq gb|DQ068263.1|Yellow fever virus strain SSUD03-04 envelope protein gene, partial cds1768176814%0.087%DQ068263.1Select seq gb|DQ068262.1|Yellow fever virus strain SSUD03-03 envelope protein gene, partial cds1768176814%0.087%DQ068262.1Select seq gb|U23569.1|YFU23569Yellow fever virus isolate 7914/Kenya/1993/Human envelope protein (E) mRNA, partial cds1764176414%0.086%U23569.1Select seq gb|U23575.1|YFU23575Yellow fever virus isolate KE93-477/Kenya/1993/Mosquito envelope protein (E) mRNA, partial cds1759175914%0.086%U23575.1Select seq gb|U23573.1|YFU23573Yellow fever virus isolate DaHB1504/C. African Republic/1985/Human envelope protein (E) mRNA, partial cds1755175514%0.086%U23573.1Select seq gb|AY839634.1|Yellow fever virus strain HB1782/CAR86 envelope protein gene, partial cds1750175014%0.086%AY839634.1Select seq gb|U23576.1|YFU23576Yellow fever virus isolate Kouma/Ethiopia/1961/Human envelope protein (E) mRNA, partial cds1745174514%0.086%U23576.1Select seq gb|AY960138.1|Yellow fever virus strain ArA 20628 polyprotein gene, partial cds1743174317%0.081%AY960138.1Select seq gb|U23571.1|YFU23571Yellow fever virus isolate ArB8883/C. African Republic/1977/Human envelope protein (E) mRNA, partial cds1732173214%0.086%U23571.1Select seq gb|AY960137.1|Yellow fever virus strain Ara29436 polyprotein gene, partial cds1710171017%0.081%AY960137.1Select seq gb|AY960139.1|Yellow fever virus strain Ara6734 polyprotein gene, partial cds1680168017%0.081%AY960139.1
  16. LOCUS KX010994 10823 bp RNA linear VRL 08-MAY-2016 DEFINITION Yellow fever virus isolate CIC1, complete genome. ACCESSION KX010994 VERSION KX010994.1 GI:1024994369 KEYWORDS . SOURCE Yellow fever virus (YFV) ORGANISM Yellow fever virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus; Yellow fever virus group. REFERENCE 1 (bases 1 to 10823) AUTHORS Pan,Y., Cui,S., Huo,D., Lyu,Y., Li,J., Chen,L., Wang,Q., Tian,L., Dou,X., Li,X., Sun,Y., Lu,G., Du,Y., Li,S. and Li,X. TITLE Direct Submission JOURNAL Submitted (25-MAR-2016) Department of Infectious Disease and Endemic Disease Control, Beijing Center for Disease Prevetion and Control, 16 Hepingli Middle Street, Dongcheng District, Beijing 100013, China COMMENT ##Assembly-Data-START## Assembly Method :: samtools v. v1.2 Sequencing Technology :: IonTorrent ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10823 /organism="Yellow fever virus" /mol_type="genomic RNA" /isolate="CIC1" /isolation_source="blood" /host="Homo sapiens" /db_xref="taxon:11089" /country="China" /collection_date="11-Mar-2016" /note="clinical-imported case 1" CDS 121..10359 /note="gp1" /codon_start=1 /product="polyprotein" /protein_id="ANC33489.1" /db_xref="GI:1024994370" /translation="MSGRKAQGRTLGVNMVRRGVRSLSNKIKQKTKQIGNRPGPSRGV QGFIFFFLFNILTGKKLTAHLKKLWRMLDPRQGLAVLRKVKRVVASLMRGLSSRKRRS NEMAMFPLLLLGLLALSGGVTLVRKNRWLLLNVTAEDLGKTFSVGTGNCTTNILEAKY WCPDSMEYNCPNLSPREEPDDIDCWCYGVENVRVAYGRCDAVGRSKRSRRAIDLPTHE NHGLKTRQEKWMTGRMGERQLQKIERWLVRNPFFAVTALAIAYLVGNNTTQRVVIALL VLAVGPAYSAHCIGITDRDFIEGVHGGTWVSATLEQDKCVTVMAPDKPSLDISLQTVA IDGPAEARKVCYSAVLTHVKINDKCPSTGEAHLAEENDGDNACKRTYSDRGWGNGCGL FGKGSIVACAKFTCAKSMSLFEVDQTKIQYVIRAQLHVGAKQENWNTDIKTLKFDALS GSQEAEFTGYGKATLECQVQTAVDFGNSYIAEMEKDSWIVDRQWAQDLTLPWQSGSGG IWREMHHLVEFEPPHAATIRVLALGNQEGSLKTALTGAMRVTKDENDNNLYKLHGGHV SCRVKLSALTLKGTSYKMCTDKMSFVKNPTDTGHGTVVMQVKVPKGAPCKIPVIVADD LTAAVNKGILVTVNPIASTNDDEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGSSIG KLFTQTMKGAERLAVMGDAAWDFSSAGGFFTSVGKGIHTVFGSAFQGLFGGLSWITKV IMGAVLIWVGINTRNMTMSMSMILVGVIMMFLSLGVGADQGCAVNFGKRELKCGDGIF VFRDSDDWLTKYSYYPEDPVKLASIIKASHEEGKCGLNSVDSLEHEMWRSRADEINAI FEENEVDISVVVQDPKNIYQRGTHPFSRIRDGLQYGWKTWGKNLVFSPGRKNGSFIID GKSRKECPFSNRVWNSFQIEEFGMGVFTTRVFMDATFDYSVDCDGAILGAAVNGKKSA HGSPTFWMGSHEVNGTWMIHTLETLDYKECEWPLTHTIGTSVEESDMFMPRSIGGPVS SHNRIPGYKVQTNGPWMQVPLEVKREVCPGTSVVVDSNCDGRGKSTRSTTDSGKIIPE WCCRSCTMPPVSFHGSDGCWYPMEIRPMKTSDSHLVRSWVTAGEVHAVPFGLVSMMIA MEVVLRRRQGPKQMLVGGVVLLGAMLVGQVTVLDLVKFVVAVGLHFHEINNGGDAMYM ALIASFSIRPGLLMGFGLRTLWSPRERLVMAFGAAMVEIALGGMMGGLWQYLNAVSLC VLTINAISSRKASNMILPLMALMTPMTMHEVRMATMLFCTVVIIGVLHQNSKDTSMQK TIPIVALTLTSYMGLTQPFLGLCAYMSTQVFGRRSIPVNEALAAAGLVGVLAGLAFQD MENFLGPIAVGGILMMLVSVAGRVDGLELKKLGEISWEEEAEISGSSSRYDVALSEQG EFKLLSEDKVPWDQIVMTSLALVGAAIHPFALLLVLGGWILHIKGARRSGDVLWDIPT PKVIEECEHLEDGIYGIFQSTFLGASQRGVGVAQGGVFHTMWHVTRGAFLLRNGKKLV PSWASVKEDLVAYGGSWKLDGRWDGEEEVQLIAAVPGKSVVNVQTKPSLFRVKNGGEI GAVALDYPSGTSGSPIVNRNGEVVGLYGNGILVGDNSFVSAISQTELKEESKEELQEI PTMLKKGMTTILDFHPGAGKTRRFLPQILAECARRRLRTLVLAPTRVVLSEMKEAFQG LDVKFHTQAFSAHGSGKEVIDAMCHATLTYRMLEPTRVVNWEVIIMDEAHFLDPASIA ARGWAAHRARANESATILMTATPPGTSDEFPHSNGEIEDVQTDIPSEPWTTGHEWILA DKRPTAWFLPSIRAANVMAASLRKAGKNVVVLNRKTFEKEYPTIKQKKPDFILATDIA EMGANLCVERVLDCRTAYKPVLVDEGKKVAIKGPLRISASSAAQRRGRIGRNPNRDGD SYYYSEPTSEDNAHHVCWLEASMLLDNMEVRGGMVAPLYGIEGTKTPVSPGEMRLRDD QRRVFRELVRGCDLPVWLAWQVAKAGLKTNDRKWCFEGPEEHEILNDNGETVKCRSPG GAKRALRPRWCDERVSSDQSALADFIKFAEGRRGAAEMLVILTELPDFLAKKGGEAMD TISVFLHSEEGSRAYRNALSMMPEAMTIVMLFLLAGLLTSGAVIFFMSPKGMSRMSMA MGTMAGSGYLMFLGGVKPTHISYVMLIFFVLMVVIIPEPGQQRSIQDNQVAYLIIGIL TLLSVVAANELGMLEKTKEDFFGKRDITTPSGAIPWSWPDLDLKPGAAWTVYVGIVTM LSPMLHHWIKVEYGNLSLSGIAQSASVLSFMDKGIPFMKMNISVVILLVSGWNSITVI PLLCGIGGAMLHWTLILPGIKAQQSKLAQKRVFHGVAKNPVVDGNPTADIEEAPEMPA LYEKKLALYLLLALSLMSVAMCRTPFSLAEGIVLSSAALGPLIEGNTSLLWNGPMAVS MTGVMRGNYYAFVGVMYNLWKMKTERRGRASGKTLGEVWKRELNLLDKQQFEMYKRTD IIEVDRDMARRHLAEGKVDTGVAVSRGTAKLRWFHERGYVKLEGRVTDLGCGRGGWCY YAAAQKEVSGVKGYTLGRDGHEKPMNVQSLGWNIVTFKDKTDIHRLEPLKCETLLCDI GESSPSSATEGERTLRVLDTVEKWLACGVDNFCIKVLAPYMPDVIEKLELLQRRFGGT VIRNPLSRNSTHEMYYVSGARSNITFTVNQTSRLLMRRMRRPTGKVTLEADVILPIGT RSVETDKGPLDKDAIEERVERIKNEYATTWFYDNDNPYRTWHYCGSYVTKTSGSAASM INGVIKILTFPWDRIEEVTRMAMTDTTPFGQQRVFKEKVDTRAKDPPAGTRKIMKVVN RWLFRHLSREKNPRLCTKEEFIAKVRSHAAVGAFLEEQEQWKTANEAVQDPKFWEMVD AERKLHQQGRCQSCVYNMMGKREKKLSEFGKAKGSRAIWYMWLGARFLEFEALGFLNE DHWASRENSGGGVEGIGLQYLGYVIRDLSTKEGGGFYADDTAGWDTRITEADLDDEQE IMSYMSPEQRKLAWAIMEMTYKNKVVKVLRPAPGGKAFMDIISRRDQRGSGQVVTYAL NTITNLKVQLIRMAEAEMVINHQHVQECGENVLERLETWLAENGCDRLSRMAVSGDDC VVRPVDDRFGLALSHLNAMSKVRKDISEWQPSKGWTDWENVPFCSHHFHELVLKDGRK IVVPCRDQDELIGRGRVSPGNGWMIKETACLSKAYANMWSLMYFHKRDMRLLSFAVSS AVPTAWVPSGRTTWSVHGRGEWMTTEDMLDVWNRVWVLNNPHMTDKTTIKEWRDVPYL TKRQDKLCGSLIGMTNRATWASHIHLVIHRIRTLIGQEKFTDYLTVMDRYSVDADLQP GELI" ORIGIN 1 agtaaatccc tgggtgctaa ttgaggtgca ttggtctgca aatcgagttg ctaggcaata 61 aacacatttg gattaatttt aatcgttcgt tgagcgatta gcagagaact gaccagagaa 121 atgtctggtc gaaaagctca gggtagaacc ctgggcgtca atatggtaag acgaggggtt 181 cgctccttgt caaacaaaat aaaacaaaaa acaaaacaga ttggaaacag acctggccct 241 tcaagaggtg ttcaaggatt tattttcttc tttttgttta acattctgac tgggaaaaag 301 ttgactgctc atctaaaaaa actttggagg atgcttgatc caaggcaggg acttgctgta 361 ctgcgaaagg tcaaaagagt tgtagctagc ttaatgagag ggctgtcttc caggaaacgt 421 agatccaatg aaatggccat gtttccactc ctgttactgg gtttgttggc tctatcagga 481 ggagtgaccc tcgtcagaaa gaacagatgg ttgctcttga atgtaactgc tgaagacctg 541 gggaaaacgt tttcagtggg aactgggaat tgcaccacga atattctgga agcaaaatac 601 tggtgccccg actcaatgga gtacaattgt cccaatctca gtccaagaga agagccagat 661 gacatagatt gctggtgtta tggagtggaa aatgtcagag tggcctatgg aagatgtgat 721 gcggtagggc gatcaaaacg ctccaggaga gcgattgatc tacccacaca tgagaaccat 781 ggactaaaga ctcggcagga gaagtggatg acaggcagaa tgggtgagag gcagctccag 841 aagattgaaa gatggctggt taggaatcca ttttttgcgg tcacagcatt ggcaatagcc 901 tatctggtgg gtaacaacac gacacaacga gtggtcatag cactactggt tctagcggtt 961 ggtccagcgt actctgccca ttgcataggg ataaccgaca gagatttcat tgaaggtgtc 1021 catgggggca cttgggtgtc agccactctg gagcaggaca aatgcgtgac tgtaatggcc 1081 cctgacaaac cttctctgga catctcacta caaacagtgg caatcgatgg accggctgaa 1141 gcgaggaagg tttgctacag tgcagtccta acccatgtga agatcaatga caaatgcccg 1201 agcactggtg aggcccacct tgcagaggaa aatgatggtg acaatgcttg taaacggaca 1261 tattctgaca gaggctgggg caatggctgt ggtctttttg ggaaaggaag catcgtggct 1321 tgtgccaagt ttacatgtgc caaatctatg agtctctttg aggtggatca gaccaaaatt 1381 caatatgtca tcagggctca gctccatgtg ggtgccaaac aggaaaactg gaacacagac 1441 ataaaaacgc tgaaatttga tgctctttct ggctcacagg aggctgaatt cactggttat 1501 ggaaaagcaa cactggagtg tcaggtccag actgccgtgg actttgggaa cagctacatc 1561 gcagagatgg aaaaagatag ctggatcgtt gaccgccaat gggcacagga cttgacactg 1621 ccatggcaga gtgggagtgg tggcatatgg agagaaatgc accaccttgt tgagtttgag 1681 cccccacatg ctgccacaat tagggtgctg gccttgggca atcaagaagg ctccttgaag 1741 accgctctca caggcgctat gcgcgtcacc aaggatgaga atgacaacaa cttgtacaaa 1801 ctgcacggtg gtcacgtctc ctgtagagtg aaactgtcag ctctcactct caaaggaaca 1861 tcctacaaga tgtgtacaga caagatgtca tttgtcaaga atccaacgga tacagggcat 1921 ggcacagttg tcatgcaagt aaaggtcccc aaaggggccc catgcaagat tcccgtgatt 1981 gtggcagatg acctaacggc tgcggtgaac aaaggcatct tggtcactgt caatcctatt 2041 gcatccacaa atgatgatga agttctgatt gaggtcaatc ccccttttgg ggatagctac 2101 atcatagttg ggactggaga ttcacgactg acctatcagt ggcacaaaga agggagttca 2161 ataggaaaat tgtttacaca gacaatgaaa ggagctgaac gtcttgcagt gatgggtgat 2221 gctgcttggg attttagttc tgctgggggg ttcttcacat ctgtgggaaa aggaatccat 2281 accgtgtttg gctcggcctt ccaggggctg tttggtggct tgagttggat cacgaaagtc 2341 atcatgggag ccgtgctcat ctgggtggga ataaacaccc gcaacatgac catgtccatg 2401 tccatgatct tggtaggtgt gatcatgatg tttctttcac taggagttgg ggctgaccaa 2461 ggatgtgctg ttaactttgg gaaacgcgag ctcaaatgcg gagatggcat ctttgtgttt 2521 agagactctg atgactggct cacaaagtac tcatactatc ctgaagaccc tgtcaaattg 2581 gcatccatta ttaaagcctc ccacgaggag ggcaaatgtg gattgaattc agttgattcc 2641 ctcgaacacg agatgtggag gagtagggcg gatgagatca acgccatttt tgaagaaaat 2701 gaggtagaca tctcggtcgt cgtccaagac ccaaagaaca tctatcaaag agggacccac 2761 ccgttctcaa ggatccgtga cggattgcag tatggatgga agacctgggg aaaaaacctt 2821 gttttctcac cagggaggaa gaacggcagc ttcatcattg acgggaagtc acgaaaggag 2881 tgccccttct ctaacagagt gtggaactca ttccagattg aggagtttgg catgggggtc 2941 ttcacaacac gagtttttat ggacgcgacc tttgactatt cagtggactg tgatggagcc 3001 atcctgggtg cagcggtgaa tggaaagaag agtgcccatg gatcacccac attttggatg 3061 ggaagtcatg aagtcaatgg aacgtggatg atacacactc tggaaactct tgattacaag 3121 gagtgtgaat ggccactgac acacactatt ggaacctcag tagaagaaag tgacatgttc 3181 atgccccggt ccattggagg tccggtgagt tctcacaacc gcatcccggg ttacaaggtg 3241 caaactaatg ggccatggat gcaagtccct ctggaagtaa aaagggaagt ctgtccaggg 3301 acaagcgtgg tggtggactc caactgtgat ggacgtggaa aatcaacaag atcaaccact 3361 gacagtggga aaataatccc ggaatggtgt tgcagatcct gtaccatgcc tccagtcagc 3421 ttccatggaa gcgatggttg ttggtatcct atggagatca gacccatgaa aacatccgac 3481 agccacctag tgaggtcctg ggtgactgca ggagaagttc atgcagtacc ctttgggctg 3541 gtgagcatga tgattgccat ggaggtggtg ttgcgcagaa ggcaaggacc aaaacaaatg 3601 ctggtaggag gagttgtgct gcttggagcg atgttagtgg gacaagtcac agtcttagac 3661 cttgtgaagt ttgttgtggc agtgggattg cacttccatg agattaacaa cggaggagat 3721 gccatgtaca tggcattaat tgccagcttt tccatccggc caggcctgct catgggcttt 3781 gggctgcgca cactgtggag tcctcgggag cgacttgtaa tggcatttgg agcagccatg 3841 gttgagattg ccctaggtgg aatgatgggt gggctttggc agtacttgaa cgccgtttca 3901 ctgtgtgtgc tcaccataaa tgcaatctca tcaaggaagg cctcaaatat gatcctcccc 3961 ctgatggcac tcatgactcc catgacaatg catgaggtga ggatggcgac gatgctgttc 4021 tgcactgttg tcataatagg ggtgcttcat cagaattcaa aagacacatc tatgcaaaag 4081 accattccca ttgtagccct gacactgacc tcatacatgg gcttgaccca gccctttcta 4141 gggctgtgtg catacatgtc cacgcaggtg tttggcagaa ggagtatacc tgtgaatgaa 4201 gccttggcag cggctggctt ggtgggagtg ctagcagggc tagccttcca agacatggaa 4261 aactttttgg gtccaatagc ggtggggggg atcctcatga tgctagttag tgtggcaggg 4321 agagttgatg gactagagct caagaaactt ggtgaaatct cctgggaaga agaagctgaa 4381 ataagtggaa gctctagccg ctatgatgtg gcactcagtg agcagggtga atttaaactc 4441 ctctcagagg acaaagtgcc ctgggaccag atagtaatga catccctagc cctcgtggga 4501 gcagccatac atccatttgc cctcttgctg gtcctgggag gatggatcct gcacattaaa 4561 ggtgctagga ggagtgggga tgttctttgg gacattccta cgccaaaggt gattgaggaa 4621 tgtgagcacc tggaggatgg aatctatggc atattccagt caaccttcct tggagcctcg 4681 cagcgaggtg ttggagtggc gcagggaggg gtcttccaca caatgtggca tgtcactagg 4741 ggggcattcc tcttgaggaa tggaaagaaa ctggttccgt cttgggcttc tgtgaaggaa 4801 gatctggtgg cttatggtgg ttcctggaaa ctagacggga gatgggatgg tgaggaggaa 4861 gtccaactca tcgctgctgt gcctggaaaa tctgttgtca acgttcaaac aaaaccaagc 4921 ttgttcagag tgaaaaatgg tggtgagatt ggagcagttg ctctagacta ccccagtgga 4981 acctcaggct cccccattgt gaaccgaaat ggtgaagtgg ttgggctcta tggcaatgga 5041 attctggtgg gtgataactc ctttgtgtct gccatctcac aaactgaatt gaaggaagaa 5101 tccaaagaag aactgcaaga aataccaact atgctgaaga aaggaatgac caccatcctt 5161 gacttccacc ctggggcggg gaaaacccgt aggttcctgc ctcaaatatt ggcggagtgt 5221 gccagaaggc gtttgcgcac tctggtatta gcacccacca gggttgtttt gtcagagatg 5281 aaagaagctt ttcaggggtt ggatgtgaaa ttccacacac aagctttctc agcccatggg 5341 agtgggaagg aggtcattga tgcaatgtgc catgcaaccc ttacatatag aatgctggaa 5401 ccaacaaggg tagtcaactg ggaggtcatt atcatggatg aggcgcactt cctggaccct 5461 gctagcatag cagcgagagg ctgggcggct catagagcaa gagcaaatga gagcgccacc 5521 atacttatga ccgccacccc accaggcacc agtgacgagt tccctcactc caatggtgag 5581 attgaggacg tccagactga catccccagc gagccatgga ccacaggaca tgaatggatc 5641 ttggcggaca agcgcccaac tgcatggttc cttccatcga tcagagcagc aaatgtcatg 5701 gcagcctcgc tgcggaaagc ggggaaaaat gtggtggtgc tgaataggaa aacctttgaa 5761 aaggagtacc ccaccattaa gcagaagaaa ccggatttca tacttgccac cgatatcgct 5821 gagatgggag caaacctgtg tgtggagaga gtcttggact gcagaactgc ctacaagcct 5881 gtcctggttg atgaagggaa gaaggtggcc atcaaagggc cgctacgaat ctcagcgtca 5941 tcggccgctc agaggagagg acgcattgga cgcaatccca acagagatgg tgactcttac 6001 tactactcag aacctaccag tgaggacaat gcacaccatg tgtgctggct ggaggcttcc 6061 atgctcctgg ataacatgga ggttagaggg gggatggttg ctccacttta tggcattgag 6121 ggaacaaaga ctcccgtctc tccaggagaa atgaggctaa gagatgatca gagaagggtc 6181 tttagagagt tggtgcgagg gtgtgatttg ccagtgtggt tggcatggca agtggcaaaa 6241 gccggcctga agaccaatga ccgcaaatgg tgttttgagg gtcccgaaga gcatgaaata 6301 ctcaatgaca atggtgaaac agtaaagtgt agatctccgg gcggagcaaa aagagcattg 6361 agacctagat ggtgtgacga gagagtttcc tcagaccaga gtgccttggc tgacttcatt 6421 aagtttgcag aaggtagaag aggggctgct gagatgcttg tgatcctcac ggagttgccc 6481 gacttcctgg caaagaaggg tggggaagcc atggatacca tcagtgtgtt cctacattct 6541 gaagagggtt caagagcgta cagaaatgcc ctgtcaatga tgccagaagc catgaccatt 6601 gtcatgctct tcctgcttgc cggactcttg acctcaggag cggtgatttt cttcatgtcg 6661 ccaaaaggca tgagtagaat gtcaatggca atgggtacca tggctggcag tggatatctc 6721 atgtttctgg ggggagtaaa accaacccac atctcttacg tcatgttaat attctttgtc 6781 ctcatggtcg tcataattcc cgaaccagga cagcagagat caatccagga taaccaagtt 6841 gcctacctca taattgggat cttgacattg ttatcagttg tggcagctaa tgaactaggg 6901 atgctggaga agaccaagga agattttttt ggaaagagag acatcacaac accaagtggg 6961 gctatcccat ggagttggcc tgacctggat ctgaaacctg gggcagcctg gacagtctat 7021 gtgggaatcg tgacgatgtt gtctcccatg ttacatcatt ggataaaagt tgagtatggc 7081 aatttgtcac tatcgggaat agcccaatct gcctcagttc tttcatttat ggacaaagga 7141 attcccttca tgaaaatgaa catatctgtg gtcatacttt tggtcagtgg ctggaattca 7201 atcacagtga tccctctgtt gtgcggcatt ggtggagcca tgttgcactg gacgctcata 7261 cttcctggga ttaaagccca gcaatcaaag ctggctcaaa aaagagtttt tcatggagtg 7321 gcaaaaaatc cagttgttga tggcaatcca actgctgaca ttgaggaagc cccagaaatg 7381 ccagctttat atgaaaagaa gctggctctt tacctccttc tggccctaag cctcatgtca 7441 gttgccatgt gcagaacccc tttttcctta gcggaaggaa tagtactgtc atctgccgcc 7501 cttggacctc tcattgaggg gaacactagt ctgttgtgga atggcccaat ggccgtttcc 7561 atgactggag tcatgcgtgg caactactac gcttttgtgg gagtcatgta caatctctgg 7621 aaaatgaaaa cagagcgtag agggagagca agtggaaaaa cattgggtga ggtctggaag 7681 cgtgaactta acttgctaga caaacaacaa tttgaaatgt acaaaagaac agacatcatt 7741 gaggtggacc gagacatggc acgacgacac ttggcagagg gaaaggtgga cacgggagtg 7801 gccgtgtcga gagggactgc aaagctgaga tggttccacg agcgtggcta tgtgaagcta 7861 gaaggaaggg tcaccgatct tgggtgtgga cgtggaggct ggtgctacta tgcagcagct 7921 caaaaagaag ttagtggtgt gaaggggtat acccttggca gagatggcca tgagaaacct 7981 atgaatgtcc aaagcttggg atggaatatt gtgactttta aggacaagac tgatattcac 8041 cgactggagc cactcaagtg tgaaactctc ctctgtgaca tcggagaatc gtccccatcc 8101 tccgcaactg agggtgagag gaccttaaga gttctggaca cagttgaaaa gtggttggct 8161 tgtggagtgg ataacttttg catcaaagtt ctggcaccat acatgcccga tgtgatagag 8221 aaactggagc ttcttcaaag aagattcggt ggaaccgtca tcaggaatcc tctttccagg 8281 aattccactc atgaaatgta ctacgtgtca ggagcaagaa gtaacatcac attcacagtc 8341 aatcagacat cacgcctgct gatgcgaagg atgaggcggc ccacaggcaa agttaccttg 8401 gaagctgatg tcattcttcc gataggcacg cgcagtgtgg aaactgataa aggcccattg 8461 gataaggatg ctattgagga aagagttgag agaatcaaga atgaatatgc cactacatgg 8521 ttctatgaca atgacaaccc gtatagaacg tggcattatt gtggctccta tgtgaccaaa 8581 acgtcaggaa gtgcagccag catgataaat ggagtcatca aaatcttgac ttttccatgg 8641 gacaggatag aagaagtcac aagaatggca atgactgaca ccacaccttt tggacaacaa 8701 agagttttca aggagaaagt agacacaaga gcaaaagacc ctcctgctgg aacaaggaag 8761 atcatgaagg tggtgaatag atggttgttt cggcatctgt ccagggagaa gaaccctagg 8821 ttgtgcacca aagaagagtt cattgccaaa gtgcggagcc atgccgcagt gggggctttt 8881 ctagaggagc aagagcagtg gaaaacggcc aatgaggcag tccaggatcc aaagttttgg 8941 gagatggtcg atgcagaacg caaacttcat cagcaggggc gatgccagtc ctgtgtgtac 9001 aacatgatgg gaaagaggga aaagaaactc tctgaatttg gaaaggccaa agggagccgt 9061 gctatctggt acatgtggct tggggcacgg tttcttgagt ttgaggctct tgggttctta 9121 aatgaagatc actgggcctc ccgggagaac tcggggggag gagttgaggg cataggactc 9181 cagtacttgg gctatgttat cagggacttg tcaaccaaag aaggtggagg gttttatgcg 9241 gatgacacgg cagggtggga cacacgcatc acagaagctg acctggatga cgagcaagag 9301 atcatgagtt acatgagccc tgaacaaagg aagctggcct gggctataat ggaaatgaca 9361 tacaagaaca aagtggttaa ggtgctgagg ccagccccag gaggcaaggc cttcatggac 9421 atcatcagcc ggagagacca aagggggtca ggacaagttg tgacatacgc cctcaacacc 9481 ataaccaatc taaaagtcca gctcataaga atggctgaag ctgaaatggt gattaaccat 9541 cagcatgtgc aggagtgtgg tgaaaatgtc ttagagcggc tcgaaacttg gcttgctgaa 9601 aatggatgtg acagattgag ccgaatggct gtgagtggag atgattgtgt ggtgagaccg 9661 gtggatgaca gatttggcct ggccctttcc catctcaatg caatgtccaa agttaggaag 9721 gacatttcag aatggcaacc ctccaaagga tggacagatt gggaaaatgt tcctttctgc 9781 tcccaccact tccatgaact ggtgttgaaa gatgggagga agatagtggt gccttgcaga 9841 gatcaagatg aactgatagg gagagggaga gtgtccccag gaaatggctg gatgatcaag 9901 gaaacagcct gcctcagcaa agcttatgca aacatgtggt cactgatgta cttccacaag 9961 agggacatga ggctactttc atttgctgtc tcctccgctg ttccaacagc ctgggtgccc 10021 agtggaagga caacgtggtc tgtccacgga agaggggagt ggatgacaac tgaggacatg 10081 ctagatgtct ggaacagggt gtgggtgttg aataacccgc acatgacgga caaaacaacc 10141 atcaaggagt ggagagatgt tccctacctc acaaagagac aggataagct ttgcgggtca 10201 ctgataggaa tgacaaacag ggccacatgg gcatctcaca tccaccttgt gatccaccgg 10261 atcagaactc taataggtca agagaagttc acagactacc tcaccgtcat ggacaggtat 10321 tctgttgatg ccgaccttca gccaggagag cttatttgag acattacaac atggaaaacc 10381 gggataaaaa ctacgggtgg agaaccggac tccccacttg agaaatgtaa ataagaaacc 10441 gggataaaaa caacggatgg agaaccggac tccacactga ataggttata aacgtcagcc 10501 caggatccaa aatttgaatg ggtcttgcca ccgctaagct gtgaggcggt gcgggctggg 10561 acagccgttt cccgggcaac gacatgcctg gtttctggga cttcccaacc cggagtaaaa 10621 cgaaggagcc tccgccacca ccctcccacg gggtgttgga aagatggggt ctagaggtta 10681 gaggagaccc tccagggaaa ttagtgggac catattgacg ccagggaaag accggagtgg 10741 ttctctgctt ttcctccagg ggtctgcgag cacagtttgc tctagaagaa gcagaccttt 10801 ggatgacaaa acacaaaacc act
  17. Beijing CDC has released four full 2016 Yellow Fever Virus (YFV) sequences from infected travelers returning from Angola.
  18. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX010994.1|Yellow fever virus isolate CIC1, complete genome1846518465100%0.0100%KX010994.1Select seq gb|AY968064.1|Yellow fever virus strain Angola71, complete genome1809018090100%0.099%AY968064.1Select seq gb|KX027336.1|Yellow fever virus isolate CIC4, complete genome1800618006100%0.099%KX027336.1Select seq gb|KX010995.1|Yellow fever virus isolate CIC2, complete genome1800618006100%0.099%KX010995.1Select seq gb|KX010996.1|Yellow fever virus isolate CIC3, complete genome1796217962100%0.099%KX010996.1Select seq gb|DQ235229.1|Yellow fever virus strain Couma, complete genome1140011400100%0.085%DQ235229.1Select seq gb|AY968065.1|Yellow fever virus strain Uganda48a, complete genome1137611376100%0.085%AY968065.1Select seq gb|JN620362.1|Yellow fever virus strain Uganda 2010, complete genome1135311353100%0.085%JN620362.1Select seq gb|JF912179.1|Yellow fever virus strain BeAR378600, complete genome87908790100%0.079%JF912179.1Select seq gb|AY603338.1|Yellow fever virus strain Ivory Coast 1999, complete genome87878787100%0.079%AY603338.1Select seq gb|JF912186.1|Yellow fever virus strain BeH526722, complete genome87638763100%0.079%JF912186.1Select seq gb|JX898868.1|Yellow fever virus isolate HD117294 from Senegal, complete genome87588758100%0.079%JX898868.1Select seq gb|JF912184.1|Yellow fever virus strain BeH463676, complete genome87518751100%0.079%JF912184.1Select seq gb|JF912185.1|Yellow fever virus strain BeAR513008, complete genome87448744100%0.079%JF912185.1Select seq gb|AY572535.1|Yellow fever virus strain Gambia 2001, complete genome87428742100%0.079%AY572535.1Select seq gb|JF912183.1|Yellow fever virus strain BeH423602, complete genome87408740100%0.079%JF912183.1Select seq gb|JX898873.1|Yellow fever virus isolate ArD149214 from Senegal, complete genome87258725100%0.079%JX898873.1Select seq gb|JX898874.1|Yellow fever virus isolate ArD149194 from Senegal, complete genome87228722100%0.079%JX898874.1Select seq gb|KM388817.1|Yellow fever virus strain 2A polyprotein gene, complete cds87208720100%0.079%KM388817.1Select seq gb|JX898870.1|Yellow fever virus isolate ArD121040 from Senegal, complete genome87208720100%0.079%JX898870.1Select seq gb|JX898875.1|Yellow fever virus isolate ArD149815 from Senegal, complete genome87168716100%0.079%JX898875.1Select seq gb|KM388816.1|Yellow fever virus strain 10A polyprotein gene, complete cds87028702100%0.079%KM388816.1Select seq gb|JF912187.1|Yellow fever virus strain BeH622205, complete genome87028702100%0.079%JF912187.1Select seq gb|JF912188.1|Yellow fever virus strain BeH622493, complete genome86988698100%0.079%JF912188.1Select seq gb|JX898880.1|Yellow fever virus isolate ArD181564 from Senegal, complete genome86918691100%0.079%JX898880.1Select seq gb|JX898877.1|Yellow fever virus isolate ArD181464 from Senegal, complete genome86898689100%0.079%JX898877.1Select seq gb|JX898878.1|Yellow fever virus isolate ArD181250 from Senegal, complete genome86888688100%0.079%JX898878.1Select seq gb|JF912189.1|Yellow fever virus strain BeAR646536, complete genome86718671100%0.079%JF912189.1Select seq gb|JF912180.1|Yellow fever virus strain BeH394880, complete genome86688668100%0.079%JF912180.1Select seq gb|JX898876.1|Yellow fever virus isolate ArD156468 from Senegal, complete genome86668666100%0.079%JX898876.1Select seq gb|HM582851.1|Yellow fever virus strain TVP11767 polyprotein gene, complete cds86668666100%0.079%HM582851.1Select seq gb|AY640589.1|Yellow fever virus strain ASIBI, complete genome86648664100%0.079%AY640589.1Select seq gb|KF769016.1|Yellow fever virus strain Asibi, complete genome86618661100%0.079%KF769016.1Select seq gb|JF912190.1|Yellow fever virus strain BeH655417, complete genome86578657100%0.079%JF912190.1Select seq gb|KM388815.1|Yellow fever virus strain 9A polyprotein gene, complete cds86488648100%0.079%KM388815.1Select seq gb|KM388814.1|Yellow fever virus strain 6A polyprotein gene, complete cds86488648100%0.079%KM388814.1Select seq gb|JX898869.1|Yellow fever virus isolate DakArAmt7 from Cote d'Ivoire, complete genome86468646100%0.079%JX898869.1Select seq gb|JF912182.1|Yellow fever virus strain BeH422973, complete genome86308630100%0.079%JF912182.1Select seq gb|KF907504.1|Yellow fever virus strain 88/1999, complete genome86088608100%0.079%KF907504.1Select seq gb|KM388818.1|Yellow fever virus strain 8A polyprotein gene, complete cds86038603100%0.079%KM388818.1Select seq gb|U21056.1|YFU21056Yellow fever virus French viscerotropic strain, complete genome86018601100%0.079%U21056.1Select seq gb|JX898872.1|Yellow fever virus isolate ArD114972 from Senegal, complete genome85818581100%0.079%JX898872.1Select seq gb|JX898871.1|Yellow fever virus isolate ArD114896 from Senegal, complete genome85748574100%0.079%JX898871.1Select seq gb|U21055.1|YFU21055Yellow fever virus French neurotropic strain, complete genome85618561100%0.079%U21055.1Select seq gb|DQ100292.1|Yellow fever virus strain 17DD-Brazil, complete genome85528552100%0.079%DQ100292.1Select seq gb|U54798.1|YFU54798Yellow fever virus strain 85-82H Ivory Coast, complete genome85408540100%0.079%U54798.1Select seq gb|U17066.1|YFU17066Yellow fever virus vaccine strain 17DD, complete genome85348534100%0.079%U17066.1Select seq gb|GQ379162.1|Yellow fever virus strain case #1, complete genome85338533100%0.079%GQ379162.1Select seq emb|X03700.1|Yellow fever virus complete genome, 17D vaccine strain85298529100%0.079%X03700.1Select seq gb|KF769015.1|Yellow fever virus strain 17D-204, complete genome85258525100%0.078%KF769015.1Select seq gb|JN811143.1|Yellow fever virus 17D YF-VAX Vero adapted Series C P11, complete genome85258525100%0.078%JN811143.1Select seq gb|JX503529.1|Yellow fever virus strain YF/Vaccine/USA/Sanofi-Pasteur-17D-204/UF795AA/YFVax, complete genome85258525100%0.078%JX503529.1Select seq gb|JN628279.1|Yellow fever virus strain 17D RKI, complete genome85258525100%0.078%JN628279.1Select seq gb|AF052444.1|AF052444Yellow fever virus clone HONG8 polyprotein gene, complete cds85258525100%0.078%AF052444.1Select seq gb|JX949181.1|Yellow fever virus strain 17D polyprotein gene, complete cds85208520100%0.078%JX949181.1Select seq gb|GQ379163.1|Yellow fever virus strain case #2, complete genome85208520100%0.078%GQ379163.1Select seq gb|FJ654700.1|Yellow fever virus 17D/Tiantan, complete genome85208520100%0.078%FJ654700.1Select seq gb|DQ118157.1|Yellow fever virus isolate YF-AVD2791-93F/04 from Spain, complete genome85208520100%0.078%DQ118157.1Select seq emb|X15062.1|Yellow fever virus genomic RNA85208520100%0.078%X15062.1Select seq gb|AF052446.1|AF052446Yellow fever virus clone HONG10 polyprotein gene, complete cds85208520100%0.078%AF052446.1Select seq gb|AF052439.1|AF052439Yellow fever virus clone HONG3 polyprotein gene, complete cds85208520100%0.078%AF052439.1Select seq gb|AF052437.1|AF052437Yellow fever virus clone HONG1 polyprotein gene, complete cds85208520100%0.078%AF052437.1Select seq gb|U17067.1|YFU17067Yellow fever virus vaccine strain 17D-213, complete genome85208520100%0.078%U17067.1Select seq gb|JN811141.1|Yellow fever virus 17D YF-VAX Vero adapted Series A P11, complete genome85168516100%0.078%JN811141.1Select seq gb|AF052445.1|AF052445Yellow fever virus clone HONG9 polyprotein gene, complete cds85168516100%0.078%AF052445.1Select seq gb|AF052438.1|AF052438Yellow fever virus clone HONG2 polyprotein gene, complete cds85168516100%0.078%AF052438.1Select seq gb|JN811142.1|Yellow fever virus 17D YF-VAX Vero adapted Series B P11, complete genome85118511100%0.078%JN811142.1Select seq gb|AF094612.1|AF094612Yellow fever virus strain Trinidad 79A isolate 788379, complete genome84778477100%0.078%AF094612.1Select seq gb|JF912181.1|Yellow fever virus strain BeH413820, complete genome84038403100%0.078%JF912181.1Select seq gb|DQ322634.1|YFV replicon vector FMDV-2A-def, complete sequence8228834397%0.079%DQ322634.1Select seq gb|DQ322633.1|YFV replicon vector capsid-def, complete sequence8228834397%0.079%DQ322633.1Select seq gb|DQ322635.1|YFV replicon vector prME-def, complete sequence6551688781%0.078%DQ322635.1Select seq dbj|D14458.1|YFVCMENSYellow fever virus prM gene for precursor polyprotein, partial cds3162316234%0.080%D14458.1Select seq gb|AF052443.1|AF052443Yellow fever virus clone HONG7 polyprotein gene, partial cds2250225026%0.078%AF052443.1Select seq gb|GU951804.1|Yellow fever virus strain BeAn 131 polyprotein gene, partial cds2246224626%0.079%GU951804.1Select seq gb|AF052441.1|AF052441Yellow fever virus clone HONG5 polyprotein gene, partial cds2246224626%0.078%AF052441.1Select seq gb|AH005112.2|Yellow fever virus strain Y5 polyprotein and nonstructural protein NS2A mRNAs, partial cds2138251627%0.080%AH005112.2Select seq gb|DQ322638.1|VEEV replicon vector YFV-C2, complete sequence2129212922%0.080%DQ322638.1Select seq gb|AF052440.1|AF052440Yellow fever virus clone HONG4 polyprotein gene, partial cds2125212522%0.080%AF052440.1Select seq gb|L06480.1|YFVCAPSIDMYellow fever virus capsid protein, M protein, and envelope protein mRNAs2125212522%0.080%L06480.1Select seq gb|AY960140.1|Yellow fever virus strain ArB28153 polyprotein gene, partial cds2098209817%0.086%AY960140.1Select seq gb|DQ322642.1|VEEV replicon vector YFV-C3opt, complete sequence1929192922%0.078%DQ322642.1Select seq gb|DQ322640.1|VEEV replicon vector YFV-C3opt-NS2mut, complete sequence1929192922%0.078%DQ322640.1Select seq gb|U23578.1|YFU23578Yellow fever virus isolate SE7445/Uganda/1964/Human envelope protein (E) mRNA, partial cds1810181014%0.087%U23578.1Select seq gb|U23577.1|YFU23577Yellow fever virus isolate M-112/Sudan/1940/Human envelope protein (E) mRNA, partial cds1801180114%0.087%U23577.1Select seq gb|AY839636.1|Yellow fever virus strain ETH2777/Ethiopia61 envelope protein gene, partial cds1786178614%0.087%AY839636.1Select seq gb|DQ068260.1|Yellow fever virus strain SSUD03-01 envelope protein gene, partial cds1773177314%0.087%DQ068260.1Select seq gb|DQ068264.1|Yellow fever virus strain SSUD03-05 envelope protein gene, partial cds1768176814%0.087%DQ068264.1Select seq gb|DQ068263.1|Yellow fever virus strain SSUD03-04 envelope protein gene, partial cds1768176814%0.087%DQ068263.1Select seq gb|DQ068262.1|Yellow fever virus strain SSUD03-03 envelope protein gene, partial cds1768176814%0.087%DQ068262.1Select seq gb|U23569.1|YFU23569Yellow fever virus isolate 7914/Kenya/1993/Human envelope protein (E) mRNA, partial cds1764176414%0.086%U23569.1Select seq gb|U23575.1|YFU23575Yellow fever virus isolate KE93-477/Kenya/1993/Mosquito envelope protein (E) mRNA, partial cds1759175914%0.086%U23575.1Select seq gb|U23573.1|YFU23573Yellow fever virus isolate DaHB1504/C. African Republic/1985/Human envelope protein (E) mRNA, partial cds1755175514%0.086%U23573.1Select seq gb|AY839634.1|Yellow fever virus strain HB1782/CAR86 envelope protein gene, partial cds1750175014%0.086%AY839634.1Select seq gb|U23576.1|YFU23576Yellow fever virus isolate Kouma/Ethiopia/1961/Human envelope protein (E) mRNA, partial cds1745174514%0.086%U23576.1Select seq gb|AY960138.1|Yellow fever virus strain ArA 20628 polyprotein gene, partial cds1743174317%0.081%AY960138.1Select seq gb|U23571.1|YFU23571Yellow fever virus isolate ArB8883/C. African Republic/1977/Human envelope protein (E) mRNA, partial cds1732173214%0.086%U23571.1Select seq gb|AY960137.1|Yellow fever virus strain Ara29436 polyprotein gene, partial cds1710171017%0.081%AY960137.1Select seq gb|AY960139.1|Yellow fever virus strain Ara6734 polyprotein gene, partial cds1680168017%0.081%AY960139.1
  19. LOCUS KX010994 10823 bp RNA linear VRL 08-MAY-2016 DEFINITION Yellow fever virus isolate CIC1, complete genome. ACCESSION KX010994 VERSION KX010994.1 GI:1024994369 KEYWORDS . SOURCE Yellow fever virus (YFV) ORGANISM Yellow fever virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus; Yellow fever virus group. REFERENCE 1 (bases 1 to 10823) AUTHORS Pan,Y., Cui,S., Huo,D., Lyu,Y., Li,J., Chen,L., Wang,Q., Tian,L., Dou,X., Li,X., Sun,Y., Lu,G., Du,Y., Li,S. and Li,X. TITLE Direct Submission JOURNAL Submitted (25-MAR-2016) Department of Infectious Disease and Endemic Disease Control, Beijing Center for Disease Prevetion and Control, 16 Hepingli Middle Street, Dongcheng District, Beijing 100013, China COMMENT ##Assembly-Data-START## Assembly Method :: samtools v. v1.2 Sequencing Technology :: IonTorrent ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10823 /organism="Yellow fever virus" /mol_type="genomic RNA" /isolate="CIC1" /isolation_source="blood" /host="Homo sapiens" /db_xref="taxon:11089" /country="China" /collection_date="11-Mar-2016" /note="clinical-imported case 1"
  20. WHO adviceYellow fever can easily be prevented by immunization provided vaccination is administered at least 10 days before travel. WHO urges Members States especially those where the establishment of a local cycle of transmission is possible (i.e. where the competent vector is present) to strengthen the control of immunisation status of travellers to all potentially endemic areas. WHO does not recommend any travel or trade restriction to DRC based on the current information available.
  21. WHO risk assessmentDRC is located in a geographical area known to be at risk for YF transmission. Although cases are regularly reported, YF outbreaks in high population density areas are unusual. The confirmation of cases in Kinshasa and in other provinces highlights the risk of further spread of YF in DRC. Additional cases of local transmission are to be expected in the country due to the continuous importation of YF cases from Angola, the currently insufficient YF vaccination coverage, ecological factors and high vector density. Furthermore, there is a risk for the disease to spread to neighbouring countries because of heavy population movements in and out of DRC. It is, therefore, of paramount importance that national authorities in DRC implement adequate disease control and surveillance measures, especially reactive vaccination campaigns and cross border interventions, in order to avoid further spread of the disease. WHO continues to monitor the epidemiological situation and conduct risk assessment based on the latest available information.
  22. Public health responseIn response to the outbreak, a national coordination committee has been activated. This will include five sub-committees for reactive vaccination, surveillance and laboratory, vector control, social mobilization, and case management. Suspected cases of YF continue to be investigated on a daily basis. On 12 May, with the support of IP Dakar, national authorities set up a mobile laboratory in DRC to accelerate case confirmation. On 26 May, a reactive campaign vaccination began with a target of 1,983,597 people from 9 health zones in Kongo Central and 2 health zones in Kinshasa. The International Coordinating Group (ICG) on Vaccine Provision approved the vaccine request for DRC and released 2,200,000 doses of vaccines and operational fund for the campaign. WHO classified the outbreak as a Grade 2 Emergency in accordance with the Emergency Response Framework (ERF). WHO has deployed a multidisciplinary team in Kongo Central and in Kinshasa to provide technical support to national authorities. The WHO Country Office has finalized a plan to mobilize further technical and financial resources for the control of the outbreak.
  23. On 22 March 2016, the National IHR Focal Point of the Democratic Republic of Congo (DRC) notified WHO of cases of yellow fever (YF) in connection with an ongoing outbreak in Angola (see DON posted on 13 April 2016). As of 31 May, a total of 700 suspected cases, including 63 deaths, had been reported from all the provinces by the national surveillance system. Samples were collected from 689 cases and sent for laboratory confirmation to the National Institute of Biomedical Research (INRB) in Kinshasa and the Pasteur Institute (IP) in Dakar, Senegal. To date, a total of 52 cases have been laboratory-confirmed for YF. The 52 confirmed cases are from five provinces: Kongo Central (36 cases), Kinshasa (11 cases), Kwango (3 cases), Bas Uélé (1 case) and Tshuapa (1 case). The two cases from Bas Uélé and Tshuapa are sylvatic and not related to the outbreak in Angola. Two of the 52 confirmed cases were classified as autochthonous and were reported from the provinces of Kinshasa and Kongo Central. The remaining 46 confirmed cases were classified as imported from Angola and were detected in the provinces of Kongo Central (34 cases), Kinshasa (9 cases) and Kwango (3 cases).
  24. WHO adviceYellow fever can easily be prevented through immunization provided that vaccination is administered at least 10 days before travel. WHO, therefore, urges Members States especially those where the establishment of a local cycle of transmission is possible (i.e. where the competent vector is present) to strengthen the control of immunisation status of travellers to all potentially endemic areas. In the context of an ongoing YF outbreak in Angola, special attention should also be placed on travellers returning from Angola and other potentially endemic areas. If there are medical grounds for not getting vaccinated, this must be certified by the appropriate authorities. WHO does not recommend any restriction of travel and trade to Angola based on the current information available.
  25. WHO risk assessmentThe evolution of the epidemiological situation in Angola is concerning and needs to be closely monitored. Based on experiences from previous similar events, it is expected that additional cases will be reported. The reports of YF imported cases in China, DRC, and Kenya demonstrate the threat that this outbreak constitutes to the entire world. Viraemic patients travelling to areas where competent vectors and susceptible human populations are present pose a risk for the establishment of local cycles of transmission. There is an urgent need to continue strengthening the quality of the response in Angola and to enhance preparedness in neighbouring countries and in countries that have diaspora communities in Angola. WHO continues to monitor the epidemiological situation and conduct risk assessments based on the latest available information.
×
×
  • Create New...