niman Posted February 25, 2016 Report Share Posted February 25, 2016 Beijing National Institute for Viral Diseases Control and Prevention release partial sequence from Ganxian, Jiangxi ex-Venezuela case. Link to comment Share on other sites More sharing options...
niman Posted February 25, 2016 Author Report Share Posted February 25, 2016 LOCUS KU740199 1813 bp RNA linear VRL 22-FEB-2016 DEFINITION Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds. ACCESSION KU740199 VERSION KU740199.1 GI:998963116 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 1813) AUTHORS Wu,W., Zhao,X., Liu,L., Li,J., Qu,J., Zhang,S., Li,W., Liang,M. and Li,D. TITLE First imported case of Zika virus infection in China mainland, February 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 1813) AUTHORS Wu,W., Zhao,X., Liu,L., Li,J., Qu,J., Zhang,S., Li,W., Liang,M. and Li,D. TITLE Direct Submission JOURNAL Submitted (20-FEB-2016) Department of Viral Hemorrhagic Fever, National Institute for Viral Diseases Control and Prevention, Changbai Road 155, Beijing, Beijing 102206, China COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. 8.5.1 Sequencing Technology :: IonTorrent ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1813 /organism="Zika virus" /mol_type="genomic RNA" /isolate="VE_Ganxian2016" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="China" /collection_date="07-Feb-2016" /note="type: Asian" CDS <1..>1813 /note="contains nonstructural proteins" /codon_start=3 /product="polyprotein" /protein_id="AMK79467.1" /db_xref="GI:998963117" /translation="VLASCLLQTAISALEGDLMVLINGFALAWLAVRAMVVPRTDNIT LAILAALTPLARGTLLVAWRAGLATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLV DPINVVGLLLLTRSGKRSWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVS YVVSGKSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIIL KVVLMTICGMNPIAIPFAAGAWYVYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMT RRLLGSTQVGVGVMQEGVFHTMWHVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKL DAAWDGHSEVQLLAVPPGERARNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKC GRVIGLYGNGVVIKNGSYVSAITQGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKT RRVLPEIVREAIKTRLRTVILAPTRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVD LMCHATFTSRLLQPIRVPNYNLYIMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTA TPPGTRDAFPDSNSPIMDTEVEVPERAWSSGFDWVTE" mat_peptide <1..368 /product="NS2A" mat_peptide 369..800 /product="NS2B" mat_peptide 801..1811 /product="NS3" ORIGIN 1 tggtcttggc ctcgtgtctt ttgcaaactg cgatctccgc cttggaaggc gacctgatgg 61 ttctcatcaa tggttttgct ttggcctggt tggcagtacg agcgatggtt gttccacgca 121 ctgataacat caccttagca atcctggctg ctctgacacc actggcccgg ggcacactgc 181 ttgtggcgtg gagagcaggc cttgctactt gcggggggtt tatgctcctc tctctgaagg 241 gaaaaggcag tgtgaagaag aacttaccat ttgtcatggc cctgggacta accgctgtga 301 ggctggtcga ccccatcaac gtggtgggac tgctgttgct cacaaggagt gggaagcgga 361 gctggccccc tagcgaagta ctcacagctg ttggcctgat atgcgcattg gctggagggt 421 tcgccaaggc agatatagag atggctgggc ccatggccgc ggtcggtctg ctaattgtca 481 gttacgtggt ctcaggaaag agtgtggaca tgtacattga aagagcaggt gacatcacat 541 gggaaaaaga tgcggaagtc actggaaaca gtccccggct cgatgtggcg ctagatgaga 601 gtggtgattt ctccctggtg gaggatgacg gtccccccat gagagagatc atactcaagg 661 tggtcctgat gaccatctgt ggcatgaacc caatagccat accctttgca gctggagcgt 721 ggtacgtata cgtgaagact ggaaaaagga gtggtgctct atgggatgtg cctgctccca 781 aggaagtaaa aaagggggag accacagatg gagtgtacag agtaatgact cgcagactgc 841 taggttcaac acaagttgga gtgggagtta tgcaagaggg ggtctttcac actatgtggc 901 acgtcacaaa aggatccgcg ctgagaagcg gtgaagggag acttgatcca tactggggag 961 atgtcaagca ggatctggtg tcatactgtg gtccatggaa gctagatgcc gcctgggacg 1021 ggcacagcga ggtgcagctc ttggccgtgc cccccggaga gagagcgagg aacatccaga 1081 ctctgcccgg aatatttaag acaaaggatg gggacattgg agcggttgca ctggattacc 1141 cagcaggaac ttcaggatct ccaatcctag acaagtgtgg gagagtgata ggactttatg 1201 gcaatggggt cgtgatcaaa aatgggagtt atgttagtgc catcacccaa gggaggaggg 1261 aggaagagac tcctgttgag tgcttcgagc cttcgatgct gaagaagaag cagctaactg 1321 tcttagactt gcatcctgga gctgggaaaa ccaggagagt tcttcctgaa atagtccgtg 1381 aagccataaa aacaagactc cgtactgtga tcttggctcc aaccagggtt gtcgctgctg 1441 aaatggagga ggcccttaga gggcttccag tgcgttatat gacaacagca gtcaatgtca 1501 cccactctgg aacagaaatc gtcgacttaa tgtgccatgc caccttcact tcacgtctac 1561 tacagccaat tagagtcccc aactataatc tgtatattat ggatgaggcc cacttcacag 1621 atccctcaag tatagcagca agaggataca tttcaacaag ggttgagatg ggcgaggcgg 1681 ctgccatctt catgaccgcc acgccaccag gaacccgtga cgcatttccg gactccaact 1741 caccaattat ggacaccgaa gtggaagtcc cagagagagc ctggagctca ggctttgatt 1801 gggtgacaga gta // Link to comment Share on other sites More sharing options...
niman Posted February 25, 2016 Author Report Share Posted February 25, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds3229322999%0.099%KU365779.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds3223322399%0.099%KJ776791.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome32203220100%0.099%KU509998.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds3220322099%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds3220322099%0.099%KU501216.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds3220322099%0.099%KU365780.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds3220322099%0.099%KU365777.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome32203220100%0.099%KU321639.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome3214321499%0.099%KU501215.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds3214321499%0.099%KU312312.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds3211321199%0.099%KU365778.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds3205320599%0.099%KU647676.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds3124312499%0.098%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds3094309499%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds2998299899%0.097%EU545988.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds2895289599%0.095%HQ234499.1 Link to comment Share on other sites More sharing options...
niman Posted February 25, 2016 Author Report Share Posted February 25, 2016 Chinese scientists isolate two Zika virus strains from patients Source: Xinhua 2016-02-25 15:41:59 BEIJING, Feb. 25 (Xinhua) -- Chinese scientists have isolated two Zika virus strains, which will assist research into a possible vaccination and the transmission pattern of the virus.The two strains were isolated from blood and urine samples from two patients. The urine test was the first successful isolation from a sample such as that, according to the Academy of Military Medical Sciences and Guangzhou No. 8 People's Hospital.With five confirmed imported Zika virus cases and the weather beginning to warm up across the country, China is on high alert.The isolation can help scientists study the transmission pattern of the virus while provide a foundation for the invention of reagent and vaccine.Chinese scientists announced Monday they had decoded the gene sequence of the first imported Zika virus.http://news.xinhuanet.com/english/2016-02/25/c_135130588.htm Link to comment Share on other sites More sharing options...
Recommended Posts
Please sign in to comment
You will be able to leave a comment after signing in
Sign In Now