niman Posted July 8, 2015 Report Share Posted July 8, 2015 National Institute of Respiratory Diseases in Mexico City released 2014 D68 sequences which match acute flaccid paralysis (AFP) novel sub-clade. Link to comment Share on other sites More sharing options...
niman Posted July 8, 2015 Author Report Share Posted July 8, 2015 LOCUS KR081327 453 bp RNA linear VRL 18-APR-2015 DEFINITION Enterovirus D68 isolate MEX3080/14 viral protein 1 gene, partial cds. ACCESSION KR081327 VERSION KR081327.1 GI:806981400 KEYWORDS . SOURCE Enterovirus D68 (EV-D68) ORGANISM Enterovirus D68 Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; Picornaviridae; Enterovirus; Enterovirus D. REFERENCE 1 (bases 1 to 453) AUTHORS Vazquez-Perez,J.A., Moreno-Valencia,Y., Hernandez-Hernandez,V.A., Romero-Espinoza,J.I., Castillejo-Lopez,M., Hernandez,A., Ramirez-Gonzalez,J.E. and Diaz-Quinones,A. TITLE EV-D68 infection in children with asthma exacerbation and pneumonia in Mexico City during 2014 autumn JOURNAL Unpublished REFERENCE 2 (bases 1 to 453) AUTHORS Vazquez-Perez,J.A., Hernandez-Hernandez,V.A., Romero-Espinoza,J.I., Coronel-Tellez,R.H. and Moreno-Valencia,Y. TITLE Direct Submission JOURNAL Submitted (10-APR-2015) Virology and Mycology Research, National Institute of Respiratory Diseases, Calzada de Tlalpan 4502, Seccion XVI Tlalpan, Mexico City, Mexico D.F. 14080, Mexico COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..453 /organism="Enterovirus D68" /mol_type="genomic RNA" /isolate="MEX3080/14" /isolation_source="pediatric respiratory sample" /host="Homo sapiens" /db_xref="taxon:42789" /country="Mexico" /collection_date="Oct-2014" CDS <1..>453 /note="VP1" /codon_start=1 /product="viral protein 1" /protein_id="AKC32639.1" /db_xref="GI:806981401" /translation="GVSETLVENFLSRAALVSKRSFEYKDHTSSAAQADKNFFKWTIN TRSFVQLRRKLELFTYLRFDAEITILTTVAVNGSSNNTYVGLPDLTLQAMFVPTGALT PEKQDSFHWQSGSNASVFFKISDPPARITIPFMCINSAYSVFYDGFAGF" ORIGIN 1 ggtgtgtccg agactctagt ggagaatttt ctcagtagag cagctttggt atcaaagaga 61 agttttgaat acaaagatca tacttcgtct gcagcacaag cagacaagaa ctttttcaaa 121 tggacaatta acaccagatc ctttgtacag ttaagaagaa aattagaatt attcacatac 181 cttagatttg atgctgagat cactatactc acaactgtag cagtgaatgg tagtagtaat 241 aatacatacg tgggtcttcc tgacttgaca cttcaagcaa tgtttgtacc cactggtgct 301 cttaccccag aaaagcagga ctcattccac tggcaatcag gcagtaatgc tagtgtattc 361 tttaaaatct ctgacccccc agccagaata accatacctt ttatgtgcat taactcagca 421 tactcagttt tttatgatgg ctttgccgga ttt Link to comment Share on other sites More sharing options...
niman Posted July 8, 2015 Author Report Share Posted July 8, 2015 Phylogenetic analysis of 2014 AFP sequences Link to comment Share on other sites More sharing options...
Recommended Posts
Please sign in to comment
You will be able to leave a comment after signing in
Sign In Now