niman Posted March 7, 2016 Report Share Posted March 7, 2016 (edited) Jiangxi Province Center for Disease Control and Prevention has released a partial sequence, Jiangxi.CHN/01/2016, from the first reported case infected in Venezuela. http://www.ncbi.nlm.nih.gov/nuccore/KU867812 The partial sequence exactly matches many of the prior sequences from the Americas, in contrast to sequences from the serum, urine,and saliva from this patient. However,all such sequences are closely related to each other and trace back to the 2013/2014 sequences from French Polynesia. Edited March 7, 2016 by niman Link to comment Share on other sites More sharing options...
niman Posted March 7, 2016 Author Report Share Posted March 7, 2016 LOCUS KU867812 564 bp RNA linear VRL 04-MAR-2016 DEFINITION Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds. ACCESSION KU867812 VERSION KU867812.1 GI:1002876769 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 564) AUTHORS Gong,T., Shi,Y., Zhou,J., Xiao,F., Liu,S.W., Li,J., Xu,G., Zhang,Y., Liu,X. and Xiong,Y. TITLE Detection and genetic analysis of Zika virus from the first imported case, China from Venezuela, February 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 564) AUTHORS Gong,T., Shi,Y., Zhou,J., Xiao,F., Liu,S.W., Li,J.X., Xu,G., Zhang,Y.N., Liu,X.Q. and Xiong,Y. TITLE Direct Submission JOURNAL Submitted (04-MAR-2016) Institute of Microbiology, Jiangxi Province Center for Disease Control and Prevention, Beijing East Road 555, Nanchang, Jiangxi 330029, China COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..564 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Jiangxi.CHN/01/2016" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="China" /collection_date="06-Feb-2016" /note="type: Asian" CDS <1..>564 /codon_start=2 /product="nonstructural protein 5" /protein_id="AMN91947.1" /db_xref="GI:1002876770" /translation="EAEEVLEMQDLWLLRRSEKVTNWLQSNGWDRLKRMAVSGDDCVV KPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHHFNKLHLKDGRSIV VPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRRDLRLMANAICSSV PVDWVPTGRTTWSIHGKGEWMTTEDMLV" ORIGIN 1 ggaggctgag gaagttctag agatgcaaga cttgtggctg ctgcggaggt cagagaaagt 61 gaccaactgg ttgcagagca acggatggga taggctcaaa cgaatggcag tcagtggaga 121 tgattgcgtt gtgaagccaa ttgatgatag gtttgcacat gccctcaggt tcttgaatga 181 tatgggaaaa gttaggaagg acacacaaga gtggaaaccc tcaactggat gggacaactg 241 ggaagaagtt ccgttttgct cccaccactt caacaagctc catctcaagg acgggaggtc 301 cattgtggtt ccctgccgcc accaagatga actgattggc cgggcccgcg tctctccagg 361 ggcgggatgg agcatccggg agactgcttg cctagcaaaa tcatatgcgc aaatgtggca 421 gctcctttat ttccacagaa gggacctccg actgatggcc aatgccattt gttcatctgt 481 gccagttgac tgggttccaa ctgggagaac tacctggtca atccatggaa agggagaatg 541 gatgaccact gaagacatgc ttgt Link to comment Share on other sites More sharing options...
niman Posted March 7, 2016 Author Report Share Posted March 7, 2016 Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU867812.1|Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds10181018100%0.0100%KU867812.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds10181018100%0.0100%KU729217.2Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds10181018100%0.0100%KU820897.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome10181018100%0.0100%KU497555.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome10181018100%0.0100%KU707826.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome10181018100%0.0100%KU527068.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds10181018100%0.0100%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome10181018100%0.0100%KU509998.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds10181018100%0.0100%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds10181018100%0.0100%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome10181018100%0.0100%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds10181018100%0.0100%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds10181018100%0.0100%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds10181018100%0.0100%KU365777.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds10181018100%0.0100%KJ776791.1Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds10121012100%0.099%KU761564.1Select seq gb|KU740184.1|Zika virus isolate GD01 polyprotein gene, complete cds10121012100%0.099%KU740184.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds10121012100%0.099%KU312312.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome10121012100%0.099%KU321639.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds10091009100%0.099%KU729218.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds10091009100%0.099%KU365778.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds10091009100%0.099%KF993678.1Select seq gb|KU820899.1|Zika virus isolate ZJ03 polyprotein gene, complete cds10001000100%0.099%KU820899.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome10001000100%0.099%KU681081.3Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome10001000100%0.099%KU744693.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds994994100%0.099%EU545988.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds982982100%0.099%JN860885.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome973973100%0.098%KU681082.3Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds95395395%0.099%KM851039.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds92892891%0.0100%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds92892891%0.0100%KM078970.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds92892891%0.0100%KM078961.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds92892891%0.0100%KM078936.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds92892891%0.0100%KM078933.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds92892891%0.0100%KM078930.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds92892891%0.0100%KM078929.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds92692695%0.098%KM851038.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds90190189%0.099%KU179098.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds901901100%0.095%HQ234499.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds89289287%0.0100%KJ873160.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds79179199%0.091%KU720415.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID79179199%0.091%LC002520.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds79179199%0.091%HQ234498.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome79179199%0.091%AY632535.2Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds78978977%0.0100%KJ873161.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds78778799%0.091%KF383118.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds78278299%0.091%KF383119.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds77377399%0.091%KF268949.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds76976999%0.090%KF383116.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds76476499%0.090%HQ234500.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds76476499%0.090%DQ859059.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds76276296%0.091%KF383121.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds76076099%0.090%HQ234501.1Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds75575595%0.091%AF013415.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds75175199%0.090%KF383117.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds75175199%0.090%KF268950.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds75175199%0.090%KF268948.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds71371399%0.088%KF383115.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds60160159%4e-168100%KU556802.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence55455496%5e-15482%KF383120.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds50250249%3e-138100%KU232300.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds49749749%1e-13699%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds49349349%2e-13599%KU232297.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds48248247%3e-13299%KU232298.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds48248247%3e-13299%KU232296.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds48248247%3e-132100%KU232295.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds48248247%3e-132100%KU232294.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds48248247%3e-13299%KU232293.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds48048047%1e-131100%KU232291.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds47947946%3e-131100%KU232288.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds47747747%1e-13099%KU232292.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds47547546%4e-130100%KU232289.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds47347346%1e-129100%KU232299.1 Link to comment Share on other sites More sharing options...
niman Posted March 7, 2016 Author Report Share Posted March 7, 2016 Sequence map updatedhttps://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en Link to comment Share on other sites More sharing options...
Recommended Posts
Please sign in to comment
You will be able to leave a comment after signing in
Sign In Now