Jump to content
  • Posts

    • Descriptions Align Segment-ID Name Score E-Value Identity EPI1176518 A/chicken/Israel/881/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1159825 A/Cygnus atratus/Hubei/HF-1/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI1159809 A/Anser cygnoides/Hubei/FW44/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1692/1704 (99%) EPI1159817 A/Cygnus atratus/Hubei/2Z2-O/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3077.6 0.000000e+00 1690/1702 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1021106 A/mute swan/Czech Republic/1296-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1006681 A/common teal/Korea/W549/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI1006680 A/common teal/Korea/W547/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI931207 A/turkey/Germany-BB/R234ff/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI869936 A/chicken/Kalmykia/2661/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI858836 A/duck/India/10CA01/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI836614 A/common tern /Uvs-Nuur Lake/26/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI836606 A/grey heron /Uvs-Nuur Lake/20/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823756 A/black-headed gull/Tyva/41/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823748 A/wild duck/Tyva/35/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI823460 A/great crested grebe/Tyva/34/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774394 A/Bar-headed Goose/Qinghai/BTY17-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774386 A/Bar-headed Goose/Qinghai/BTY17-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774310 A/Bar-headed Goose/Qinghai/BTY12-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774242 A/Bar-headed Goose/Qinghai/BTY8-LU/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774234 A/Bar-headed Goose/Qinghai/BTY8-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774121 A/Bar-headed Goose/Qinghai/BTY1-LV/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI774113 A/Bar-headed Goose/Qinghai/BTY1-B/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%) EPI773757 A/great crested grebe/Uvs-Nuur Lake/341/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1176519 A/chicken/Israel/1048/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1169147 A/chicken/Rostov-on-Don/1321/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1006705 A/common teal/Korea/W555/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1006704 A/common teal/Korea/W550/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI1006703 A/common teal/Korea/W548/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI959413 A/Eurasian Wigeon/Netherlands/4/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954607 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI954575 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI942943 A/chicken/Wales/000023/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774475 A/Brown-headed Gull/Qinghai/ZTO5-K/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774458 A/Brown-headed Gull/Qinghai/ZTO4-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774450 A/Brown-headed Gull/Qinghai/ZTO3-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774402 A/Bar-headed Goose/Qinghai/BTY18-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774378 A/Bar-headed Goose/Qinghai/BTY16-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774326 A/Bar-headed Goose/Qinghai/BTY13-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774318 A/Bar-headed Goose/Qinghai/BTY13-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774302 A/Bar-headed Goose/Qinghai/BTY12-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774277 A/Bar-headed Goose/Qinghai/BTY10-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774267 A/Bar-headed Goose/Qinghai/BTY10-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774259 A/Bar-headed Goose/Qinghai/BTY9-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774251 A/Bar-headed Goose/Qinghai/BTY9-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774226 A/Bar-headed Goose/Qinghai/BTY7-LU2/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774218 A/Bar-headed Goose/Qinghai/BTY7-LU1/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774210 A/Bar-headed Goose/Qinghai/BTY7-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774201 A/Bar-headed Goose/Qinghai/BTY6-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774193 A/Bar-headed Goose/Qinghai/BTY6-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774185 A/Bar-headed Goose/Qinghai/BTY5-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774176 A/Bar-headed Goose/Qinghai/BTY4-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774168 A/Bar-headed Goose/Qinghai/BTY4-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774159 A/Bar-headed Goose/Qinghai/BTY3-LU/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI774150 A/Bar-headed Goose/Qinghai/BTY3-B/2016 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%) EPI978865 A/mute swan/Germany-TH/R1126/2017 (A/H5N8) segment 4 (HA) 3068.4 0.000000e+00 1689/1704 (99%) EPI869924 A/domestic goose/Poland/33/2016 (A/H5N8) segment 4 (HA) 3066.6 0.000000e+00 1689/1704 (99%) EPI869687 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 4 (HA) 3066.6 0.000000e+00 1689/1704 (99%) EPI1176527 A/turkey/Israel/1076/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1045611 A/chicken/Rostov-on-Don/44/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032524 A/Mulard_duck/Hungary/60369/2016 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032508 A/Goose/Hungary/17985/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%) EPI1032492 A/Goose/Hungary/17051/2017 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
    • LOCUS MF166575 1717 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/chicken/Israel/881/2016(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds. ACCESSION MF166575 VERSION MF166575.1 KEYWORDS . SOURCE Influenza A virus (A/chicken/Israel/881/2016(H5N8)) ORGANISM Influenza A virus (A/chicken/Israel/881/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1717) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1717) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (28-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1717 /organism="Influenza A virus (A/chicken/Israel/881/2016(H5N8))" /mol_type="viral cRNA" /strain="A/chicken/Israel/881/2016" /serotype="H5N8" /host="chicken" /db_xref="taxon:2005432" /segment="4" /country="Israel" /collection_date="07-Dec-2016" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45891.1" /translation="MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGSLNDYEELKHLLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGTPSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAEEQTNLYKNPTTYISVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSEVEYGHCNTKCQTPVGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSDGSLQCRVC V" sig_peptide 1..48 /gene="HA" ORIGIN 1 atggagaaaa tagtgcttct tcttgcaata gttagccttg ttaaaagtga tcagatttgc 61 attggttacc atgcaaacaa ctcgacagag caagttgaca cgataatgga aaagaacgtc 121 actgttacac atgcccaaga catactggaa aaaacacaca acgggaagct ctgcgatcta 181 aatggggtga aacctctgat tttaaaggat tgtagtgtag ctggatggct cctcggaaac 241 ccaatgtgcg acgaattcat cagagtgccg gaatggtctt acatagtgga gagggctaac 301 ccagctaatg acctctgtta cccagggagc ctcaatgact atgaagaact gaaacacctg 361 ttgagcagaa taaatcattt tgagaagatt ctgatcatcc ccaagagctc ttggcccaat 421 catgaaacat cattaggggt gagcgcagct tgtccatacc agggaacgcc ctcctttttc 481 agaaatgtgg tatggcttat caaaaagaac gatgcatatc caacaataaa gataagctac 541 aataatacca atcgggaaga tctcttgata ctgtggggga ttcatcattc caacaatgca 601 gaagagcaga caaatctcta taaaaaccca accacctata tttcagttgg aacatcaaca 661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtaaacgg gcaacgtgga 721 agaatggact tcttctggac aattttaaaa ccgaatgatg caatccattt cgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt 841 atgaaaagtg aagtggaata tggccactgc aacaccaaat gtcaaacccc agtaggagcg 901 ataaactcta gtatgccatt ccacaatata catcctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaagtt ggtccttgcg actgggctca gaaatagtcc tctaagagaa 1021 aagagaagaa aaagagggct gtttggggct atagcaggtt ttatagaggg gggatggcag 1081 ggaatggttg atggttggta tgggtaccac catagcaatg agcaggggag tgggtacgct 1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcgatc 1201 attgacaaaa tgaacactca atttgaggca gttggaaggg agtttaataa cttagaaagg 1261 aggatagaga atttgaacaa gaaaatggaa gacggattcc tagatgtctg gacctataat 1321 gctgaacttc tagttctcat ggaaaacgag aggactctag atttccatga ctcaaatgtc 1381 aagaaccttt acgacaaagt cagactgcag cttagggata atgcaaagga gctgggtaac 1441 ggttgtttcg agttctatca caaatgtgat aatgaatgta tggaaagtgt gagaaatggg 1501 acgtatgact accctcagta ttcagaagaa gcaagattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat ggtggctggt ctatctttat ggatgtgctc cgatgggtcg 1681 ttacagtgca gagtttgcgt ttaaatttgt gagatca
    • Descriptions Align Segment-ID Name Score E-Value Identity EPI1176529 A/grey goose/Israel/986/2016 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1629/1629 (100%) EPI1176519 A/chicken/Israel/1048/2016 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1626/1629 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1622/1629 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1622/1629 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1622/1629 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1622/1629 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1621/1629 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1621/1629 (99%) EPI823756 A/black-headed gull/Tyva/41/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1621/1629 (99%) EPI823748 A/wild duck/Tyva/35/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1621/1629 (99%) EPI823460 A/great crested grebe/Tyva/34/2016 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1621/1629 (99%) EPI1021106 A/mute swan/Czech Republic/1296-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI978865 A/mute swan/Germany-TH/R1126/2017 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI931207 A/turkey/Germany-BB/R234ff/2017 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI869936 A/chicken/Kalmykia/2661/2016 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1620/1629 (99%) EPI773757 A/great crested grebe/Uvs-Nuur Lake/341/2016 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1621/1630 (99%) EPI1169147 A/chicken/Rostov-on-Don/1321/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI1021132 A/goose/Czech Republic/1954-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI964917 A/chicken/Czech Republic/206-17_2/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI887468 A/chicken/Czech Republic/206-17_2/2017(H5N8) (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI859207 A/domestic_turkey/Hungary/53433/2016 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1619/1629 (99%) EPI1176527 A/turkey/Israel/1076/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032524 A/Mulard_duck/Hungary/60369/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032508 A/Goose/Hungary/17985/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032492 A/Goose/Hungary/17051/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032484 A/Goose/Hungary/15729/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1032476 A/Goose/Hungary/17261/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1021135 A/quail/Czech Republic/2063-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI978863 A/grey heron/Germany-TH/R1125/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI962066 A/Turkey/Hungary/53136/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI962046 A/Duck/Hungary/54738/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI959539 A/Mute swan/Hungary/6276/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI959531 A/Mute swan/Hungary/6092/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI954655 A/Duck/Hungary/984/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI954639 A/Harris Hawk/Hungary/120/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI952782 A/mallard duck/Korea/WA137/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI952639 A/chicken/Korea/H903/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI930838 A/mute swan/Czech Republic/54-17_2/2017 (H5N8) (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI919636 A/chicken/Czech Republic/585-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI891670 A/greylag goose/Croatia/33/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI881901 A/mute swan/Croatia/15/2017 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI869929 A/mute swan/Poland/108/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI866978 A/duck/Hungary/60441/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI861572 A/mute swan/Croatia/78/2016 (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1618/1629 (99%) EPI869924 A/domestic goose/Poland/33/2016 (A/H5N8) segment 4 (HA) 2946.5 0.000000e+00 1614/1624 (99%) EPI1021086 A/mute swan/Czech Republic/54-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2944.7 0.000000e+00 1617/1629 (99%) EPI869926 A/domestic goose/Poland/72/2016 (A/H5N8) segment 4 (HA) 2944.7 0.000000e+00 1617/1629 (99%) EPI1176530 A/peregrine falcon/Israel/1086/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1169885 A/chicken/Republic of Macedonia/466/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1159809 A/Anser cygnoides/Hubei/FW44/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1605/1611 (99%) EPI1081894 A/turkey/Czech Republic/38-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1032548 A/Goose/Hungary/64909/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1032540 A/Goose/Hungary/63743/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1032516 A/Goose/Hungary/59763/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1032500 A/Goose/Hungary/17580/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021139 A/mallard/Czech Republic/2641-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021126 A/mute swan/Czech Republic/1691-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021125 A/mallard/Czech Republic/1690-17_2/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021103 A/mallard/Czech Republic/1219-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021098 A/mute swan/Czech Republic/1155-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021097 A/mute swan/Czech Republic/1060-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021088 A/mallard/Czech Republic/136-17_2/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1021087 A/goose/Czech Republic/136-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019534 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI987882 A/chicken/Republic of Macedonia/AR1167-L02131/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI969265 A/chicken/Czech Republic/2644-17_1/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI961484 A/mute swan/Czech Republic/581-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI961475 A/mute swan/Czech Republic/499-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%) EPI959555 A/Pheasant/Hungary/7685/2017 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1617/1629 (99%)
    • LOCUS MF166581 1629 bp cRNA linear VRL 01-FEB-2018 DEFINITION Influenza A virus (A/grey goose/Israel/986/2016(H5N8)) segment 4 hemagglutinin (HA) gene, partial cds. ACCESSION MF166581 VERSION MF166581.1 KEYWORDS . SOURCE Influenza A virus (A/grey goose/Israel/986/2016(H5N8)) ORGANISM Influenza A virus (A/grey goose/Israel/986/2016(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1629) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Highly pathogenic avian influenza A virus H5N8 isolated in Israel JOURNAL Unpublished REFERENCE 2 (bases 1 to 1629) AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A. TITLE Direct Submission JOURNAL Submitted (29-MAY-2017) Division of Avian Diseases, Kimron Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. DNASTAR Lasergene 8 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1629 /organism="Influenza A virus (A/grey goose/Israel/986/2016(H5N8))" /mol_type="viral cRNA" /strain="A/grey goose/Israel/986/2016" /serotype="H5N8" /host="grey goose" /db_xref="taxon:2005436" /segment="4" /country="Israel" /collection_date="12-Dec-2016" /note="passage details: E1" gene <1..1611 /gene="HA" CDS <1..1611 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ASA45897.1" /translation="VDTIMEKNVTVTHAQDILEKTHNGKLCDLNGVKPLILKDCSVAG WLLGNPMCDEFIRVPEWSYIVERANPANDLCYPGSLNDYEELKHLLSRINHFEKILII PKSSWPNHETSLGVSAACPYQGTPSFFRNVVWLIKKNDAYPTIKISYNNTNREDLLIL WGIHHSNNAEEQTNLYKNPTTYISVGTSTLNQRLVPKIATRSQVNGQRGRMDFFWTIL KPNDAIHFESNGNFIAPEYAYKIVKKGDSTIMKSEVEYGHCNTKCQTPVGAINSSMPF HNIHPLTIGECPKYVKSNKLVLATGLRNSPLREKRRKRGLFGAIAGFIEGGWQGMVDG WYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIE NLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNG CFEFYHKCDNECMESVRNGTYDYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVA SSLALAIMVAGLSLWMCSNGSLQCRICI" mat_peptide <1..942 /gene="HA" /product="HA1" mat_peptide 943..1608 /gene="HA" /product="HA2" ORIGIN 1 gttgacacga taatggaaaa gaacgtcact gttacacatg cccaagacat actggaaaaa 61 acacacaacg ggaagctctg cgatctaaat ggggtgaaac ctctgatttt aaaggattgt 121 agtgtagctg gatggctcct cggaaaccca atgtgcgacg aattcatcag agtgccggaa 181 tggtcttaca tagtggagag ggctaacccc gctaatgacc tctgttaccc agggagcctc 241 aatgactatg aagaactgaa acacctgttg agcagaataa atcattttga gaagattctg 301 atcatcccca agagttcttg gcccaatcat gaaacatcat taggggtgag cgcagcttgt 361 ccataccagg gaacgccctc ctttttcaga aatgtggtat ggcttatcaa aaagaacgat 421 gcatacccaa caataaagat aagctacaat aataccaatc gggaagatct cttgatactg 481 tgggggattc atcattccaa caatgcagaa gagcagacaa atctctataa aaacccaacc 541 acctatattt cggttggaac atcaacatta aaccagagat tggtaccaaa aatagctact 601 agatcccaag taaacgggca acgtggaaga atggacttct tctggacaat tttaaaaccg 661 aatgatgcaa tccacttcga gagtaatgga aatttcattg ctccagaata tgcatacaaa 721 attgtcaaga aaggggactc aacaattatg aaaagtgaag tggaatatgg ccactgcaac 781 accaaatgtc aaaccccagt aggagcgata aactctagta tgccattcca caatatacat 841 cctctcacca tcggggaatg ccccaaatac gtgaagtcaa acaagttggt ccttgcgact 901 gggctcagaa atagtcctct aagagaaaag agaagaaaaa gagggctgtt tggggctata 961 gcaggtttta tagagggagg atggcaggga atggttgatg gttggtatgg gtaccaccat 1021 agcaatgagc aggggagtgg gtacgctgca gacaaagaat ccacccaaaa agcaatagat 1081 ggagttacca ataaggtcaa ctcgatcatt gacaaaatga acactcaatt tgaggcagtt 1141 ggaagggagt ttaataactt agaaaggagg atagagaatt tgaacaagaa aatggaagac 1201 ggattcctag atgtctggac ctataatgct gaacttctag ttctcatgga aaacgagagg 1261 actctagatt tccatgactc aaatgtcaag aacctttacg acaaagtcag actgcagctt 1321 agggataatg caaaggagct gggtaacggt tgtttcgagt tctatcacaa atgtgataat 1381 gaatgtatgg aaagtgtgag aaatgggacg tatgactacc ctcagtattc agaagaagca 1441 agattaaaaa gagaagaaat aagcggagtg aaattagaat caataggaac ttaccaaata 1501 ctgtcaattt attcaacagt ggcgagttcc ctagcactgg caatcatggt ggctggtcta 1561 tctttatgga tgtgctccaa tgggtcgtta cagtgcagaa tttgcattta aatttgggag 1621 ctcagattg
    • Descriptions Align Segment-ID Name Score E-Value Identity EPI1176524 A/cormorant/Israel/1035/2016 (A/H5N8) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%) EPI1176517 A/turkey/Israel/1045/2016 (A/H5N8) segment 4 (HA) 3120.1 0.000000e+00 1700/1705 (99%) EPI1176528 A/great egret/Israel/1084/2016 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1699/1705 (99%) EPI1176525 A/great egret/Israel/1088/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1698/1706 (99%) EPI1019630 A/Eur_Wig/NL-Wormer/16016143-002/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI1019614 A/Eur_Wig/NL-Walterswald/16015923-003/2016 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI1007675 A/peacock/Belgium/1017/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI954607 A/turkey/Italy/17VIR1452-22/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI954575 A/turkey/Italy/17VIR576-11/2017 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%) EPI869687 A/decoy_duck/France/161104e/2016 (A/H5N8) segment 4 (HA) 3099.8 0.000000e+00 1696/1705 (99%) EPI1176526 A/turkey/Israel/184/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%) EPI1045611 A/chicken/Rostov-on-Don/44/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019638 A/Eur_Wig/NL-Zoeterwoude/16015702-010/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019582 A/Eur_Wig/NL-Leidschendam/16015697-007/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019550 A/Eur_Wig/NL-Gouda/16015824-001/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019534 A/Eur_Wig/NL-Enumatil-Groningen/16015704-001/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019526 A/Eur_Wig/NL-Drieborg (Dollard)/16015513-001/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019518 A/Eur_Wig/NL-De Waal (Texel)/16014891-004/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019510 A/Eur_Wig/NL-De Waal (Texel)/16014891-003/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI943320 A/pochard_duck/England/SA12_157809/2016 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI909444 A/mute swan/Krasnodar/25/2017 (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%) EPI1019718 A/M_Swan/NL-Roggebotsluis/16014462-019/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019678 A/Grey_Go/NL-Groot-Ammers/16015901-012/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019646 A/Eur_Wig/NL-Zwolle/16015820-002/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019622 A/Eur_Wig/NL-West Graftdijk/16015746-003/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019606 A/Eur_Wig/NL-Vianen/16015917-006/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019590 A/Eur_Wig/NL-Reeuwijk/16015903-003/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019430 A/Ch/NL-Rhenen/16016141-006/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019406 A/Ch/NL-Boven Leeuwen/16016151-006-010/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1019398 A/Ch/NL-Abbega/X16015736/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1007667 A/chicken/Belgium/807/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI959413 A/Eurasian Wigeon/Netherlands/4/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI954877 A/Mallard/Hungary/1574a/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI954861 A/Mallard/Hungary/1574b/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI954559 A/swan/Italy/17VIR537-2/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI942943 A/chicken/Wales/000023/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI922508 A/chicken/Germany-NI/R11406/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI909436 A/goose/Krasnodar/3144/2017 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI859650 A/wild duck/Germany-BW/R8455/2016 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1695/1705 (99%) EPI1169201 A/chicken/Rostov-on-Don/1598/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019766 A/T_Dk/NL-Almeerder Zand/16014341-003/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019478 A/Dk/NL-Kamperveen/16016104-001-005/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1019438 A/Ch/NL-Zoeterwoude/16016484-021-025/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI990794 A/greylag goose/Germany-NI/AR1395-L02144/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI969347 A/turkey/Germany-BB/R377ff/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI969254 A/Tufted Duck/Switzerland/V237/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI954813 A/Greylag_goose/Hungary/320/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI954583 A/chicken/Italy/17VIR653-12/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909452 A/wild duck/Tatarstan/3059/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909428 A/turkey/Rostov-on-Don/11/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909404 A/chicken/Voronezh/18/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909396 A/long-eared owl/Voronezh/16/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909388 A/Ural owl/Voronezh/14/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI909380 A/long-eared owl/Voronezh/15/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI888088 A/wigeon/Italy/17VIR57-3/2017 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI869940 A/herring gull/Poland/84/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI869931 A/turkey/Poland/83/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI868848 A/turkey/England/052131/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI861011 A/turkey/Germany-SH/R8595/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI860509 A/tufted duck/Germany-SH/R8444/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI860401 A/tufted_duck/Germany/AR8459-L01988/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI859653 A/tufted_duck/Germany/AR8444-L01986/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI859212 A/tufted_duck/Germany-SH/R8446/2016 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%) EPI1023562 A/Eurasian_Wigeon/Netherlands/11/2016 (A/H5N8) segment 4 (HA) 3085.0 0.000000e+00 1691/1701 (99%) EPI1040223 A/chicken/Italy/17VIR3078/2017 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1693/1705 (99%) EPI909364 A/tufted duck/Denmark/17740-1/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1693/1705 (99%) EPI869930 A/turkey/Poland/78/2016 (A/H5N8) segment 4 (HA) 3083.2 0.000000e+00 1693/1705 (99%) EPI1019878 A/Teal/NL-Ferwert/16015273-013/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019870 A/T_Dk/NL-Zuidoost Beemster/16014148-009/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019862 A/T_Dk/NL-Zuidoost Beemster/16014148-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019790 A/T_Dk/NL-Rotterdam/16014155-001/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019782 A/T_Dk/NL-Roggebotsluis/16014462-015/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019774 A/T_Dk/NL-Monnickendam/16013865-006-008/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019758 A/Sea_eagle/NL-Assen/16015398-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019750 A/P_falcon/NL-Vrouwenpolder (Zeeland)/16015510-001/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019734 A/Mal/NL-IJsselmuiden/16015448-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019726 A/Magpie/NL-Volendam/16014331-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019710 A/L-bl-ba-gull/NL-Sovon/16014324-014/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019702 A/Gull10/NL-Marker Wadden/16014466-014/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019670 A/Gr_bk_bd_gull/NL-Slootdorp/16014102-005/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019558 A/Eur_Wig/NL-Greonterp/16015653-001/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019542 A/Eur_Wig/NL-Ferwert/16015273-002/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019446 A/Crow/NL-Oostwoud/16015372-004/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI1019382 A/Buzzard/NL-Durgerdam/16015100-004/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI990802 A/greylag goose/Germany-NI/AR703-L02138/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI990770 A/eurasian wigeon/Germany-NI/AR249-L02143/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI954783 A/Common_tern/Hungary/8187/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI916604 A/bronze turkey/Czech Republic/1414-17/2017 (H5N8) (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI909420 A/chicken/Voronezh/20/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI909412 A/chicken/Voronezh/19/2017 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI864746 A/mute swan/Croatia/85/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI863865 A/Common Goldeneye/Sweden/SVA161117KU0322/SZ0002165/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI861568 A/mute swan/Croatia/70/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI861224 A/chicken/Germany-SH/R8758/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI860519 A/goose/Hungary/55128/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI860393 A/tufted_duck/Germany/AR8444-L01987/2016 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%) EPI907346 A/domestic duck/Germany-BB/R681ff/2017 (A/H5N8) segment 4 (HA) 3077.6 0.000000e+00 1691/1703 (99%) EPI1040225 A/turkey/Italy/17VIR5878-3/2017 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1032549 A/Mulard_duck/Hungary/59163/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%) EPI1032532 A/Mulard_duck/Hungary/62902/2016 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
×