Everything posted by niman
-
Florida Zika Exports Increase To 18
October 6, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are no new travel related cases today. Please visit ourwebsite to see the full list of travel-related cases. There are no new non-travel related cases in Florida residents today. There is one additional non-Florida resident with exposure in Miami Beach. DOH continues door-to-door outreach and targeted testing in Palm Beach and Miami-Dade counties and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the identified area in Miami Beach in Miami-Dade County, see map below. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 721 Non-Travel Related Infections of Zika 141 Infections Involving Pregnant Women 103 Out of State Cases (not Florida Residents) 18 Undetermined 4 Total 987 The department is currently conducting 14 active investigations. The department has closed 26 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 8,819 people statewide. Florida currently has the capacity to test 6,032 people for active Zika virus and 7,254 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. Florida’s small case cluster is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted area in Miami-Dade County (see map below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 103. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 6,865 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. Miami Beach Map click image above to enlarge About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov. http://www.floridahealth.gov/newsroom/2016/10/100616-zika-update.html
-
Florida Zika Cases Increase To 987
- Florida Zika Cases Increase To 987
- Florida Zika Exports Increase To 18
- Florida Zika Exports Increase To 18
- Florida Zika Cases Increase To 987
- United States Microcephaly and FBDS Cases Increase To 27
Pregnant Women with Any Laboratory Evidence of Possible Zika Virus Infection US States and the District of Columbia* 837 *Includes aggregated data reported to the US Zika Pregnancy Registry as of September 29, 2016 US Territories** 1,638 **Includes aggregated data from the US territories reported to the US Zika Pregnancy Registry and data from Puerto Rico reported to the Zika Active Pregnancy Surveillance System as of September 29, 2016 http://www.cdc.gov/zika/geo/pregnancy-outcomes.html- CDC Zika Pregnancy Registry
Pregnant Women with Any Laboratory Evidence of Possible Zika Virus Infection US States and the District of Columbia* 837 *Includes aggregated data reported to the US Zika Pregnancy Registry as of September 29, 2016 US Territories** 1,638 **Includes aggregated data from the US territories reported to the US Zika Pregnancy Registry and data from Puerto Rico reported to the Zika Active Pregnancy Surveillance System as of September 29, 2016- Zika virus disease in the United States 2015-2016 - CDC
As of October 5, 2016 (5 am EST) Zika virus disease and Zika virus congenital infection are nationally notifiable conditions. This update from the CDC Arboviral Disease Branch includes provisional data reported to ArboNET for January 01, 2015 – October 5, 2016. US States Locally acquired mosquito-borne cases reported: 105 Travel-associated cases reported: 3,712 Laboratory acquired cases reported: 1 Total: 3,818 Sexually transmitted: 30 Guillain-Barré syndrome: 13 MAPS OF ZIKA IN THE US More US Territories Locally acquired cases reported: 24,118 Travel-associated cases reported: 83 Total: 24,201* Guillain-Barré syndrome: 39 *Sexually transmitted cases are not reported for US territories because with local transmission of Zika virus it is not possible to determine whether infection occurred due to mosquito-borne or sexual transmission. Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of October 5, 2016)§ States Travel-associated cases* No. (% of cases in states) (N=3,713) Locally acquired cases† No. (% of cases in states) (N=105) Alabama 27 (1) 0 (0) Arizona 36 (1) 0 (0) Arkansas 10 (<1) 0 (0) California 277 (7) 0 (0) Colorado 36 (1) 0 (0) Connecticut 58 (2) 0 (0) Delaware 15 (<1) 0 (0) District of Columbia 25 (1) 0 (0) Florida 707 (19) 105 (100) Georgia 86 (2) 0 (0) Hawaii 14 (<1) 0 (0) Idaho 3 (<1) 0 (0) Illinois 75 (2) 0 (0) Indiana 38 (1) 0 (0) Iowa 16 (<1) 0 (0) Kansas 15 (<1) 0 (0) Kentucky 24 (1) 0 (0) Louisiana 32 (1) 0 (0) Maine 11 (<1) 0 (0) Maryland 102 (3) 0 (0) Massachusetts 93 (3) 0 (0) Michigan 60 (2) 0 (0) Minnesota 47 (1) 0 (0) Mississippi 23 (1) 0 (0) Missouri 27 (1) 0 (0) Montana 7 (<1) 0 (0) Nebraska 11 (<1) 0 (0) Nevada 14 (<1) 0 (0) New Hampshire 10 (<1) 0 (0) New Jersey 133 (4) 0 (0) New Mexico 7 (<1) 0 (0) New York 837 (23) 0 (0) North Carolina 66 (2) 0 (0) North Dakota 2 (<1) 0 (0) Ohio 53 (1) 0 (0) Oklahoma 27 (1) 0 (0) Oregon 27 (1) 0 (0) Pennsylvania†† 132 (4) 0 (0) Rhode Island 32 (1) 0 (0) South Carolina 31 (1) 0 (0) South Dakota 2 (<1) 0 (0) Tennessee 52 (1) 0 (0) Texas 218 (6) 0 (0) Utah 15** (<1) 0 (0) Vermont 7 (<1) 0 (0) Virginia 86 (2) 0 (0) Washington 34 (1) 0 (0) West Virginia 11 (<1) 0 (0) Wisconsin 40 (1) 0 (0) Wyoming 2 (<1) 0 (0) Territories Travel-associated cases* No. (% of cases in territories) (N=83) Locally acquired cases† No. (% of cases in territories) (N=24,118) American Samoa 7 (8) 47 (<1) Puerto Rico 75 (90) 23,665*** (98) US Virgin Islands 1 (1) 406 (2) §Only includes cases meeting the probable or confirmed CSTE case definition and does not include asymptomatic infections unless the case is a pregnant woman with a complication of pregnancy *Travelers returning from affected areas, their sexual contacts, or infants infected in utero †Presumed local mosquito-borne transmission ††One additional case acquired through laboratory transmission **Includes one case with unknown route of person-to-person transmission. ***The Puerto Rico Department of Health is retroactively reporting cases, resulting in larger than normal increases in cases in recent weeks. Page last reviewed: October 6, 2016 Page last updated: October 6, 2016- New York Zika Cases Increase To 838
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ- Texas Issues Zika Alert
HEALTH ALERT Enhanced Zika Disease Surveillance in High-Risk Area October 3, 2016 Summary The Texas Department of State Health Services (DSHS) has long considered the southernmost areas of the state to be at greater risk of supporting local mosquito transmission of Zika virus. This is based upon historical experience with local transmission of dengue virus, which is related to the Zika virus and transmitted by the same type of mosquitoes. Local transmission of dengue is most commonly reported in Texas from August through December. As testing options and availability have expanded and knowledge of the disease epidemiology has improved, guidance to healthcare providers on appropriate Zika infection testing of patients has evolved. The goals of testing are to diagnose patients and, from a public health perspective, to define the temporal and spatial distribution of the disease burden. Enhanced Zika Surveillance DSHS is asking the healthcare community to assist in improving surveillance for locally transmitted Zika disease. Toward that end, DSHS is expanding the testing criteria for those with major signs/symptoms of Zika disease (fever, arthralgia, rash, and conjunctivitis), but who have no travel history to an area of local Zika transmission or sexual exposure to Zika virus: DSHS continues to recommend testing of male and female patients with no travel history or sexual exposure who have at least three of the four major signs/symptoms of Zika disease. DSHS continues to recommend testing of pregnant women who have traveled to areas of active Zika transmission, regardless of presence or absence of symptoms. The new recommendation is to test pregnant women residing in Cameron, Hidalgo, Starr, Webb, Willacy, or Zapata counties who are experiencing two or more of the major signs and symptoms of Zika disease and have no travel history or sexual exposure. Preconception counseling should be provided to patients contemplating having a baby. For full women's Zika prevention guidance, visit http://texaszika.org/healthcareprof.htm. The current comprehensive guidance on Zika testing can be found at http://texaszika.org/healthcareprof.htm. Background Capacity for Zika testing has increased, as it is no longer limited to U.S. Centers for Disease Control and Prevention (CDC) or state public health laboratories. Under Emergency Use Authorizations issued by the Food and Drug Administration, there are now a number of commercial laboratories that offer molecular assays for detection of Zika virus RNA, and some are also offering serology for Zika IgM. DSHS continues to recommend that healthcare providers consult with their local health department or DSHS Regional Office to facilitate appropriate test selection and submission of specimens. For More Information Texas-specific information and links to CDC resources: TexasZika.org.- Texas Issues Zika Alert
HEALTH ALERT Enhanced Zika Disease Surveillance in High-Risk Area October 3, 2016 Summary The Texas Department of State Health Services (DSHS) has long considered the southernmost areas of the state to be at greater risk of supporting local mosquito transmission of Zika virus. This is based upon historical experience with local transmission of dengue virus, which is related to the Zika virus and transmitted by the same type of mosquitoes. Local transmission of dengue is most commonly reported in Texas from August through December. As testing options and availability have expanded and knowledge of the disease epidemiology has improved, guidance to healthcare providers on appropriate Zika infection testing of patients has evolved. The goals of testing are to diagnose patients and, from a public health perspective, to define the temporal and spatial distribution of the disease burden. http://dshs.texas.gov/news/releases/2016/Zika-Health-Alert.aspx- Texas Zika Tally Page
Zika Virus – October 5, 2016. Texas has had 218 reported cases of Zika virus disease. All the cases were associated with travel to an area where Zika is being spread. This count includes 13 pregnant women, two infants infected before birth, and two people who had sexual contact with travelers. Texas Zika Cases by County: County Cases Angelina 1 Bell 6 Bexar 16 Brazos 3 Burnet 1 Cameron 2 Collin 5 Dallas 37 Denton 9 El Paso 3 Ellis 1 Fort Bend 7 Frio 1 Galveston 7 Gray 1 Grayson 1 Gregg 1 Hamilton 1 Harris 58 Jackson 1 Jefferson 2 Jones 1 Lee 1 Lubbock 1 Matagorda 1 Medina 1 Midland 1 Montgomery 1 Palo Pinto 1 Randall 1 Rusk 1 Tarrant 23 Travis 9 Upshur 1 Val Verde 1 Walker 1 Williamson 5 Webb 3 Wise 1 Total 218- New York City Zika Tally Page
Reported Cases of Zika in New York City as of 9/30/2016 [Español (PDF)] Positive NYC Residents Case Type Number of Cases Locally acquired mosquito-borne reported† 0 Travel-associated* 569 Sexually transmitted: 5 Guillain-Barre syndrome: 3 Infants with birth defects: 1 Laboratory acquired 0 Pending Verification of Travel 37 Total 606 Gender Number of Cases Female 432 Pregnant: 71 Male 174 Age Average Age (Range) 38 (1-78) Positive NYC Resident by Borough Number of Cases Bronx 208 Brooklyn 154 Manhattan 122 Queens 118 Staten Island 4 Unknown 0 Most Common Countries Visited Number of Cases Dominican Republic 293 Puerto Rico 58 Jamaica 54 Trinidad and Tobago 25 Guyana 20 Grenada 16 Saint Lucia 13 Mexico 11 Saint Vincent and the Grenadines 10 Colombia 10 Barbados 10 Honduras 7 Nicaragua 7 Guatemala 6 US Virgin Islands 6 Venezuela 6 †Presumed local mosquito-borne transmission *Travelers returning from affected areas, their sexual contacts, or infants infected in utero- New York Zika Cases Increase To 838
Number of cases reported County/Area Today Year to Date (9/23-10/03/16) Albany 0 4 Broome 0 3 Clinton 0 2 Columbia 0 1 Cortland 0 1 Delaware 0 1 Dutchess 1 6 Erie 0 4 Jefferson 0 2 Lewis 0 1 Monroe 0 16 Nassau 1 47 Niagara 0 1 Oneida 0 4 Onondaga 0 8 Ontario 0 3 Orange 0 7 Otsego 0 1 Putnam 0 1 Rockland 0 11 Saratoga 0 2 St Lawrence 0 1 Schenectady 0 1 Steuben 0 1 Suffolk 2 50 Tompkins 0 3 Wayne 0 2 Westchester 4 26 NYS (ex NYC) 8 210 NYC 7 603 NYS Total Confirmed 15 813 NYS Pregnant Registry 0 25 NYS Total 15 838- Full 2016 Venezuela Zika Sequence From Lactating Mother's Milk
Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 18520 18520 100% 0.0 99% KX702400.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 18502 18502 100% 0.0 99% KX247646.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 18493 18493 100% 0.0 99% KU820897.5 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 18493 18493 100% 0.0 99% KX087102.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 18456 18456 100% 0.0 99% KX198135.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 18447 18447 100% 0.0 99% KX156776.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 18442 18442 100% 0.0 99% KX156774.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 18438 18438 100% 0.0 99% KX156775.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 18415 18415 100% 0.0 99% KU647676.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 18411 18411 100% 0.0 99% KX548902.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 18397 18397 100% 0.0 99% KU922960.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 18393 18393 100% 0.0 99% KU922923.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 18384 18384 100% 0.0 99% KX447510.1 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 18379 18379 100% 0.0 99% KU991811.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 18375 18375 100% 0.0 99% KX447512.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 18375 18375 100% 0.0 99% KX369547.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 18375 18375 100% 0.0 99% KU509998.3 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 18370 18370 100% 0.0 99% KJ776791.2 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 18370 18370 100% 0.0 99% KX447509.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 18366 18366 100% 0.0 99% KX447515.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 18366 18366 100% 0.0 99% KX447513.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 18361 18361 100% 0.0 99% KX197205.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 18361 18361 100% 0.0 99% KX447511.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 18361 18361 100% 0.0 99% KX280026.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 18361 18361 100% 0.0 99% KU707826.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 18361 18361 100% 0.0 99% KU365779.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 18361 18361 100% 0.0 99% KU321639.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 18357 18357 100% 0.0 99% KX447514.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 18357 18357 100% 0.0 99% KX051563.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 18352 18352 100% 0.0 99% KX447516.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 18352 18352 100% 0.0 99% KU729218.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 18348 18348 100% 0.0 99% KX262887.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 18348 18348 100% 0.0 99% KX197192.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 18348 18348 100% 0.0 99% KU365780.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 18345 18345 99% 0.0 99% KU497555.1 Select seq gb|KX811222.1| Zika virus isolate Brazil_2015_MG, complete genome 18343 18343 100% 0.0 99% KX811222.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 18343 18343 100% 0.0 99% KU365777.1 Select seq gb|KX879604.1| Zika virus isolate SN089, complete genome 18339 18339 100% 0.0 99% KX879604.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 18339 18339 100% 0.0 99% KX694534.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 18339 18339 100% 0.0 99% KU758877.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 18339 18339 100% 0.0 99% KU926309.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 18334 18334 100% 0.0 99% KU940228.1 Select seq gb|KX879603.1| Zika virus isolate SN062, complete genome 18330 18330 100% 0.0 99% KX879603.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 18330 18330 100% 0.0 99% KX447517.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 18330 18330 100% 0.0 99% KU501217.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 18330 18330 100% 0.0 99% KU365778.1 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 18330 18330 100% 0.0 99% KU312312.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 18325 18325 100% 0.0 99% KU729217.2 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 18325 18325 100% 0.0 99% KU527068.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 18325 18325 100% 0.0 99% KU501216.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 18321 18321 100% 0.0 99% KX247632.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 18321 18321 100% 0.0 99% KU937936.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 18321 18321 100% 0.0 99% KU926310.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 18321 18321 100% 0.0 99% KU501215.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 18316 18316 100% 0.0 99% KX601168.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 18316 18316 100% 0.0 99% KX520666.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 18316 18316 100% 0.0 99% KX087101.2 Select seq gb|KX856011.1| Zika virus strain ZIKV/Aedes sp./MEX_I-44/2016, complete genome 18312 18312 100% 0.0 99% KX856011.1 Select seq gb|KX806557.1| Zika virus isolate TS17-2016, complete genome 18312 18312 100% 0.0 99% KX806557.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 18312 18312 100% 0.0 99% KX446951.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 18312 18312 100% 0.0 99% KX377337.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 18312 18312 100% 0.0 99% KU820898.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 18307 18307 100% 0.0 99% KX446950.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 18307 18307 100% 0.0 99% KU870645.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 18305 18305 100% 0.0 99% KX766028.1 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 18303 18303 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 18301 18301 100% 0.0 99% KU853012.1 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 18298 18298 100% 0.0 99% KX056898.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 18298 18298 100% 0.0 99% KU955590.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 18294 18294 100% 0.0 99% KU740184.2 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 18294 18294 100% 0.0 99% KU761564.1 Select seq gb|KX842449.1| Zika virus isolate ZIKV/Human/USA/2016/ZF10.UR-010 polyprotein gene, complete cds 18285 18285 100% 0.0 99% KX842449.1 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 18285 18285 100% 0.0 99% KX766029.1 Select seq gb|KX838905.1| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/ZM2-7719 polyprotein gene, complete cds 18280 18280 100% 0.0 99% KX838905.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 18280 18280 100% 0.0 99% KX673530.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 18280 18280 100% 0.0 99% KX117076.1 Select seq gb|KX838904.1| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/ZM1-7501 polyprotein gene, complete cds 18276 18276 100% 0.0 99% KX838904.1 Select seq gb|KX832731.1| Zika virus isolate ZIKV/Human/USA/2016/ZL2.SA-Hu0015 polyprotein gene, complete cds 18276 18276 100% 0.0 99% KX832731.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 18271 18271 100% 0.0 99% KX185891.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 18271 18271 100% 0.0 99% KU963796.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 18267 18267 100% 0.0 99% KX253996.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 18267 18267 100% 0.0 99% KU955589.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 18267 18267 100% 0.0 99% KU820899.2 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 18264 18264 100% 0.0 99% KX266255.1 Select seq gb|KX838906.1| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/ZM3-7729 polyprotein gene, complete cds 18262 18262 100% 0.0 99% KX838906.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 18262 18262 100% 0.0 99% KU866423.2 Select seq gb|KU940224.1| Zika virus isolate Bahia09, partial genome 18240 18240 99% 0.0 99% KU940224.1 Select seq gb|KU744693.1| Zika virus isolate VE_Ganxian, complete genome 18135 18135 100% 0.0 99% KU744693.1 Select seq gb|KX827309.1| Zika virus isolate ZKA-16-291 polyprotein gene, complete cds 18123 18123 100% 0.0 99% KX827309.1 Select seq gb|KX813683.1| Zika virus isolate ZKA-16-097 polyprotein gene, complete cds 18108 18108 100% 0.0 99% KX813683.1 Select seq gb|KU681081.3| Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome 18036 18036 100% 0.0 99% KU681081.3 Select seq gb|KX694532.1| Zika virus strain ZIKV/Homo sapiens/THA/PLCal_ZV/2013, complete genome 17928 17928 100% 0.0 99% KX694532.1 Select seq gb|KU955593.1| Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome 17730 17730 100% 0.0 98% KU955593.1 Select seq gb|JN860885.1| Zika virus isolate FSS13025 polyprotein gene, partial cds 17730 17730 99% 0.0 98% JN860885.1 Select seq gb|KF993678.1| Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds 17697 17697 98% 0.0 99% KF993678.1 Select seq gb|EU545988.1| Zika virus polyprotein gene, complete cds 17575 17575 100% 0.0 98% EU545988.1 Select seq gb|KU681082.3| Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome 17423 17423 100% 0.0 98% KU681082.3 Select seq gb|KX601167.1| Zika virus strain ZIKV/Aedes sp./MYS/P6-740/1966, complete genome 16422 16422 100% 0.0 95% KX601167.1 Select seq gb|HQ234499.1| Zika virus isolate P6-740 polyprotein gene, partial cds 16415 16415 99% 0.0 95% HQ234499.1 Select seq gb|KX694533.1| Zika virus strain ZIKV/Aedes aegypti/MYS/P6-740/1966, complete genome 16413 16413 100% 0.0 95% KX694533.1- Full 2016 Venezuela Zika Sequence From Lactating Mother's Milk
LOCUS KX893855 10808 bp cRNA linear VRL 01-OCT-2016 DEFINITION Zika virus strain Zika virus/Homo sapiens/VEN/UF-2/2016, complete genome. ACCESSION KX893855 VERSION KX893855.1 GI:1070310450 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10808) AUTHORS Blohm,G.M., Paniz Mondolfi,A.E., Puliam,J.R.C., Morris,J.G. Jr., White,S.K., Bonny,T.S., Loeb,J.C., Pacheco,C., Marquez,M. and Lednicky,J.A. TITLE Viable Zika virus in the serum of an asymptomatic breastfeeding Venezuelan infant in 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10808) AUTHORS Blohm,G.M., Paniz Mondolfi,A.E., Puliam,J.R.C., Morris,J.G. Jr., White,S.K., Bonny,T.S., Loeb,J.C., Pacheco,C., Marquez,M. and Lednicky,J.A. TITLE Direct Submission JOURNAL Submitted (24-SEP-2016) Environmental and Global Health, University of Florida - Gainesville, 1225 Center Drive, Room 4155, Gainesville, FL 32610, USA COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10808 /organism="Zika virus" /mol_type="viral cRNA" /strain="Zika virus/Homo sapiens/VEN/UF-2/2016" /isolation_source="serum" /host="Homo sapiens; symptomatic breast-feeding infant" /db_xref="taxon:64320" /country="Venezuela" /collection_date="25-Mar-2016" /collected_by="Alberto E. Paniz Mondolfi" /identified_by="Gabriela Blohm and John Lednicky" /note="from Barquisimeto City; passage details: LLC-MK2 cells, passage 1"- Full 2016 Venezuela Zika Sequence From Asymptomatic Breast Milk Fed Infant
Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 18520 18520 100% 0.0 99% KX702400.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 18502 18502 100% 0.0 99% KX247646.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 18493 18493 100% 0.0 99% KU820897.5 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 18493 18493 100% 0.0 99% KX087102.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 18456 18456 100% 0.0 99% KX198135.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 18447 18447 100% 0.0 99% KX156776.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 18442 18442 100% 0.0 99% KX156774.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 18438 18438 100% 0.0 99% KX156775.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 18415 18415 100% 0.0 99% KU647676.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 18411 18411 100% 0.0 99% KX548902.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 18397 18397 100% 0.0 99% KU922960.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 18393 18393 100% 0.0 99% KU922923.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 18384 18384 100% 0.0 99% KX447510.1 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 18379 18379 100% 0.0 99% KU991811.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 18375 18375 100% 0.0 99% KX447512.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 18375 18375 100% 0.0 99% KX369547.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 18375 18375 100% 0.0 99% KU509998.3 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 18370 18370 100% 0.0 99% KJ776791.2 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 18370 18370 100% 0.0 99% KX447509.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 18366 18366 100% 0.0 99% KX447515.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 18366 18366 100% 0.0 99% KX447513.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 18361 18361 100% 0.0 99% KX197205.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 18361 18361 100% 0.0 99% KX447511.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 18361 18361 100% 0.0 99% KX280026.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 18361 18361 100% 0.0 99% KU707826.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 18361 18361 100% 0.0 99% KU365779.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 18361 18361 100% 0.0 99% KU321639.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 18357 18357 100% 0.0 99% KX447514.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 18357 18357 100% 0.0 99% KX051563.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 18352 18352 100% 0.0 99% KX447516.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 18352 18352 100% 0.0 99% KU729218.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 18348 18348 100% 0.0 99% KX262887.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 18348 18348 100% 0.0 99% KX197192.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 18348 18348 100% 0.0 99% KU365780.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 18345 18345 99% 0.0 99% KU497555.1 Select seq gb|KX811222.1| Zika virus isolate Brazil_2015_MG, complete genome 18343 18343 100% 0.0 99% KX811222.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 18343 18343 100% 0.0 99% KU365777.1 Select seq gb|KX879604.1| Zika virus isolate SN089, complete genome 18339 18339 100% 0.0 99% KX879604.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 18339 18339 100% 0.0 99% KX694534.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 18339 18339 100% 0.0 99% KU758877.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 18339 18339 100% 0.0 99% KU926309.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 18334 18334 100% 0.0 99% KU940228.1 Select seq gb|KX879603.1| Zika virus isolate SN062, complete genome 18330 18330 100% 0.0 99% KX879603.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 18330 18330 100% 0.0 99% KX447517.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 18330 18330 100% 0.0 99% KU501217.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 18330 18330 100% 0.0 99% KU365778.1 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 18330 18330 100% 0.0 99% KU312312.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 18325 18325 100% 0.0 99% KU729217.2 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 18325 18325 100% 0.0 99% KU527068.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 18325 18325 100% 0.0 99% KU501216.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 18321 18321 100% 0.0 99% KX247632.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 18321 18321 100% 0.0 99% KU937936.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 18321 18321 100% 0.0 99% KU926310.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 18321 18321 100% 0.0 99% KU501215.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 18316 18316 100% 0.0 99% KX601168.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 18316 18316 100% 0.0 99% KX520666.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 18316 18316 100% 0.0 99% KX087101.2 Select seq gb|KX856011.1| Zika virus strain ZIKV/Aedes sp./MEX_I-44/2016, complete genome 18312 18312 100% 0.0 99% KX856011.1 Select seq gb|KX806557.1| Zika virus isolate TS17-2016, complete genome 18312 18312 100% 0.0 99% KX806557.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 18312 18312 100% 0.0 99% KX446951.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 18312 18312 100% 0.0 99% KX377337.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 18312 18312 100% 0.0 99% KU820898.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 18307 18307 100% 0.0 99% KX446950.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 18307 18307 100% 0.0 99% KU870645.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 18305 18305 100% 0.0 99% KX766028.1 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 18303 18303 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 18301 18301 100% 0.0 99% KU853012.1 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 18298 18298 100% 0.0 99% KX056898.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 18298 18298 100% 0.0 99% KU955590.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 18294 18294 100% 0.0 99% KU740184.2 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 18294 18294 100% 0.0 99% KU761564.1 Select seq gb|KX842449.1| Zika virus isolate ZIKV/Human/USA/2016/ZF10.UR-010 polyprotein gene, complete cds 18285 18285 100% 0.0 99% KX842449.1 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 18285 18285 100% 0.0 99% KX766029.1 Select seq gb|KX838905.1| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/ZM2-7719 polyprotein gene, complete cds 18280 18280 100% 0.0 99% KX838905.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 18280 18280 100% 0.0 99% KX673530.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 18280 18280 100% 0.0 99% KX117076.1 Select seq gb|KX838904.1| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/ZM1-7501 polyprotein gene, complete cds 18276 18276 100% 0.0 99% KX838904.1 Select seq gb|KX832731.1| Zika virus isolate ZIKV/Human/USA/2016/ZL2.SA-Hu0015 polyprotein gene, complete cds 18276 18276 100% 0.0 99% KX832731.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 18271 18271 100% 0.0 99% KX185891.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 18271 18271 100% 0.0 99% KU963796.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 18267 18267 100% 0.0 99% KX253996.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 18267 18267 100% 0.0 99% KU955589.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 18267 18267 100% 0.0 99% KU820899.2 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 18264 18264 100% 0.0 99% KX266255.1 Select seq gb|KX838906.1| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/ZM3-7729 polyprotein gene, complete cds 18262 18262 100% 0.0 99% KX838906.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 18262 18262 100% 0.0 99% KU866423.2 Select seq gb|KU940224.1| Zika virus isolate Bahia09, partial genome 18240 18240 99% 0.0 99% KU940224.1 Select seq gb|KU744693.1| Zika virus isolate VE_Ganxian, complete genome 18135 18135 100% 0.0 99% KU744693.1 Select seq gb|KX827309.1| Zika virus isolate ZKA-16-291 polyprotein gene, complete cds 18123 18123 100% 0.0 99% KX827309.1 Select seq gb|KX813683.1| Zika virus isolate ZKA-16-097 polyprotein gene, complete cds 18108 18108 100% 0.0 99% KX813683.1 Select seq gb|KU681081.3| Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome 18036 18036 100% 0.0 99% KU681081.3 Select seq gb|KX694532.1| Zika virus strain ZIKV/Homo sapiens/THA/PLCal_ZV/2013, complete genome 17928 17928 100% 0.0 99% KX694532.1 Select seq gb|KU955593.1| Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome 17730 17730 100% 0.0 98% KU955593.1 Select seq gb|JN860885.1| Zika virus isolate FSS13025 polyprotein gene, partial cds 17730 17730 99% 0.0 98% JN860885.1 Select seq gb|KF993678.1| Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds 17697 17697 98% 0.0 99% KF993678.1 Select seq gb|EU545988.1| Zika virus polyprotein gene, complete cds 17575 17575 100% 0.0 98% EU545988.1 Select seq gb|KU681082.3| Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome 17423 17423 100% 0.0 98% KU681082.3 Select seq gb|KX601167.1| Zika virus strain ZIKV/Aedes sp./MYS/P6-740/1966, complete genome 16422 16422 100% 0.0 95% KX601167.1 Select seq gb|HQ234499.1| Zika virus isolate P6-740 polyprotein gene, partial cds 16415 16415 99% 0.0 95% HQ234499.1 Select seq gb|KX694533.1| Zika virus strain ZIKV/Aedes aegypti/MYS/P6-740/1966, complete genome 16413 16413 100% 0.0 95% KX694533.1- United States Zika Cases In Week 39 Increase 193
TABLE I. Provisional cases of selected* infrequently reported notifiable diseases (<1,000 cases reported during the preceding year), United States, week ending October 1, 2016 (WEEK 39)† Disease Total cases reported for previous years Current week Cum 2016 5-year weekly average§ 2015 2014 2013 2012 2011 States reporting cases during current week (No.39) Anthrax - - 0 - - - - 1 Arboviral diseases ¶,**: Chikungunya virus †† - 90 2 896 NN NN NN NN Eastern equine encephalitis virus - 2 0 6 8 8 15 4 Jamestown Canyon virus §§ - 2 - 11 11 22 2 3 La Crosse virus §§ - 11 1 55 80 85 78 130 Powassan virus - 5 0 7 8 12 7 16 St. Louis encephalitis virus - 5 0 23 10 1 3 6 Western equine encephalitis virus - - - - - - - - Botulism, total 1 126 3 195 161 152 168 153 foodborne - 30 0 37 15 4 27 24 infant - 81 2 138 127 136 123 97 other(wound & unspecified) 1 15 0 20 19 12 18 32 FL (1 ) Brucellosis - 84 2 126 92 99 114 79 Chancroid - 11 0 11 - - 15 8 Cholera - 2 0 2 5 14 17 40 Cyclosporiasis ** 6 387 3 645 388 784 123 151 NY (1 ), NYC (3 ), VA (1 ), AK (1 ) Diphtheria - - - - 1 - 1 - Haemophilus influenzae, invasive disease (age <5 yrs) ¶¶: serotype b - 15 0 29 40 31 30 14 nontypeable serotype - 103 2 175 128 141 115 93 other serotype - 88 2 135 266 233 263 230 unknown serotype 2 149 3 167 39 34 37 48 OH (1 ), OK (1 ) Hansen's disease ** - 34 2 89 88 81 82 82 Hantavirus Infections **: Hantavirus infection (non-HPS) †† - 3 - 1 NN NN NN NN Hantavirus pulmonary syndrome (HPS) - 11 0 17 32 21 30 23 Hemolytic uremic syndrome, post-diarrheal ** 1 163 8 274 250 329 274 290 AR (1 ) Hepatitis B, virus infection perinatal 1 17 1 37 47 48 40 NP PA (1 ) Influenza-associated pediatric mortality **, *** - 79 0 130 141 160 52 118 Leptospirosis ** 1 33 1 40 38 NN NN NN OH (1 ) Listeriosis 3 457 23 766 769 735 727 870 NY (1 ), FL (1 ), ID (1 ) Measles ††† 1 53 1 188 667 187 55 220 AZ (1 ) Meningococcal disease, invasive §§§: serogroup ACWY - 66 2 120 123 142 161 257 serogroup B - 52 2 111 89 99 110 159 other serogroup - 12 0 21 25 17 20 20 unknown serogroup 2 134 4 120 196 298 260 323 NYC (1 ), FL (1 ) Novel influenza A virus infections ¶¶¶ - 21 0 6 3 21 313 14 Plague - - 0 13 10 4 4 3 Poliomyelitis, paralytic - - - - - 1 - - Polio virus infection, nonparalytic ** - - - - - - - - Psittacosis ** - 4 0 4 8 6 2 2 Q fever total **: 1 89 3 156 168 170 135 134 acute 1 75 2 122 132 137 113 110 TX (1 ) chronic - 14 0 34 36 33 22 24 Rabies, human - - 0 1 1 2 1 6 SARS CoV - - - - - - - - Smallpox - - - - - - - - Streptococcal toxic shock syndrome ** 1 182 3 335 259 224 194 168 RI (1 ) Syphilis, congenital **** - 299 9 492 458 348 322 360 Toxic shock syndrome (staphylococcal) ** - 21 1 64 59 71 65 78 Trichinellosis ** - 10 0 11 14 22 18 15 Tularemia 2 147 5 314 180 203 149 166 NE (1 ), WY (1 ) Typhoid fever 2 230 8 367 349 338 354 390 NY (1 ), NYC (1 ) Vancomycin-intermediate Staphylococcus aureus** - 77 4 183 212 248 134 82 Vancomycin-resistant Staphylococcus aureus ** - - - 1 - - 2 - Viral hemorrhagic Fevers ††††: Crimean-Congo hemorrhagic fever - - - - NP NP NP NP Ebola hemorrhagic fever - - - - 4 NP NP NP Guanarito hemorrhagic fever - - - - NP NP NP NP Junin hemorrhagic fever - - - - NP NP NP NP Lassa fever - - - - 1 NP NP NP Lujo virus - - - - NP NP NP NP Machupo hemorrhagic fever - - - - NP NP NP NP Marburg fever - - - - NP NP NP NP Sabia-associated hemorrhagic fever - - - - NP NP NP NP Yellow fever - - - - - - - - Zika ††,§§§§ Zika virus congenital infection NA NA NA NN NN NN NN NN Zika virus disease, non-congenital infection 3 3,746 - NN NN NN NN NN OH (1 ), GA (1 ), TX (1 ) [ Export This Table ] [ Next Part ] [ NNDSS Interactive Tables ] [ Mortality Interactive Tables ] -: No reported cases N: Not reportable. NA: Not Available NN: Not Nationally Notifiable. NP: Nationally notifiable but not published. Cum: Cumulative year-to-date counts. * Case counts for reporting year 2016 are provisional and subject to change. Data for years 2011 through 2014 are finalized. For further information on interpretation of these data, seehttp://wwwn.cdc.gov/nndss/document/ProvisionalNationaNotifiableDiseasesSurveillanceData20100927.pdf. † This table does not include cases from the U.S. territories. Three low incidence conditions, rubella, rubella congenital, and tetanus, are in Table II to facilitate case count verification with reporting jurisdictions. § Calculated by summing the incidence counts for the current week, the 2 weeks preceding the current week, and the 2 weeks following the current week, for a total of 5 preceding years. Additional information is available athttp://wwwn.cdc.gov/nndss/document/5yearweeklyaverage.pdf. ¶ Includes both neuroinvasive and nonneuroinvasive. Updated weekly reports from the Division of Vector-Borne Diseases, National Center for Emerging and Zoonotic Infectious Diseases (ArboNET Surveillance). Data for West Nile virus are available in Table II. ** Not reportable in all reporting jurisdictions. Data from states where the condition is not reportable are excluded from this table, except for the arboviral diseases and influenza-associated pediatric mortality. Reporting exceptions are available athttp://wwwn.cdc.gov/nndss/downloads.html. †† Office of Management and Budget approval of the NNDSS Revision #0920-0728 on January 21, 2016, authorized CDC to receive data for these conditions. CDC is in the process of soliciting data for these conditions (except Zika virus, congenital infection). CDC and the U.S. states are still modifying the technical infrastructure needed to collect and transmit data for Zika virus congenital infections. §§ Jamestown Canyon virus and Lacrosse virus have replaced California serogroup diseases. ¶¶ Data for Haemophilus influenzae (all ages, all serotypes) are available in Table II. *** Please refer to the MMWR publication for weekly updates to the footnote for this condition. ††† Please refer to the MMWR publication for weekly updates to the footnote for this condition. §§§ Data for meningococcal disease (all serogroups) are available in Table II. ¶¶¶ Please refer to the MMWR publication for weekly updates to the footnote for this condition. **** Updated weekly from reports to the Division of STD Prevention, National Center for HIV/AIDS, Viral Hepatitis, STD, and TB Prevention. †††† Please refer to the MMWR publication for weekly updates to the footnote for this condition. §§§§ All cases reported have occurred in travelers returning from affected areas, with their sexual contacts, or infants infected in utero. National Notifiable Diseases Surveillance System (NNDSS) MMWR web application provided by CDC WONDER, http://wonder.cdc.gov- United States Zika Cases In Week 39 Increase 193
Zika ††,§§§§ Zika virus congenital infection NA NA NA NN NN NN NN NN Zika virus disease, non-congenital infection 3 3,746 - NN NN NN NN NN OH (1 ), GA (1 ), TX (1 ) https://wonder.cdc.gov/mmwr/mmwr_2016.asp?mmwr_year=2016&mmwr_week=39&mmwr_table=1&request=Submit&mmwr_location=- Full 2016 Venezuela Zika Sequence From Asymptomatic Breast Milk Fed Infant
LOCUS KX893855 10808 bp cRNA linear VRL 01-OCT-2016 DEFINITION Zika virus strain Zika virus/Homo sapiens/VEN/UF-2/2016, complete genome. ACCESSION KX893855 VERSION KX893855.1 GI:1070310450 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10808) AUTHORS Blohm,G.M., Paniz Mondolfi,A.E., Puliam,J.R.C., Morris,J.G. Jr., White,S.K., Bonny,T.S., Loeb,J.C., Pacheco,C., Marquez,M. and Lednicky,J.A. TITLE Viable Zika virus in the serum of an asymptomatic breastfeeding Venezuelan infant in 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10808) AUTHORS Blohm,G.M., Paniz Mondolfi,A.E., Puliam,J.R.C., Morris,J.G. Jr., White,S.K., Bonny,T.S., Loeb,J.C., Pacheco,C., Marquez,M. and Lednicky,J.A. TITLE Direct Submission JOURNAL Submitted (24-SEP-2016) Environmental and Global Health, University of Florida - Gainesville, 1225 Center Drive, Room 4155, Gainesville, FL 32610, USA COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10808 /organism="Zika virus" /mol_type="viral cRNA" /strain="Zika virus/Homo sapiens/VEN/UF-2/2016" /isolation_source="serum" /host="Homo sapiens; symptomatic breast-feeding infant" /db_xref="taxon:64320" /country="Venezuela" /collection_date="25-Mar-2016" /collected_by="Alberto E. Paniz Mondolfi" /identified_by="Gabriela Blohm and John Lednicky" /note="from Barquisimeto City; passage details: LLC-MK2 cells, passage 1" 5'UTR 1..107 CDS 108..10379 /codon_start=1 /product="polyprotein" /protein_id="AOR87336.1" /db_xref="GI:1070310451" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKXAMEIIKKFKKDLAAMLRIINARKEKK RRGAETSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSPTASGRVIEEWCCRECTMPPLSFWAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" 3'UTR 10380..10808 ORIGIN 1 agttgttact gttgctgact cagactgcga cagttcgagt ttgaagcgaa agctagcaac 61 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa 121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga 181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca 241 ggatggtctt ggcgattcta gcctttttga gattcacggc aatcaagcca tcactgggtc 301 tcatcaatag atggggttca gtggggaaaa aagakgctat ggaaataata aagaagttca 361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag 421 gcgcagaaac tagtgtcgga attgttggcc tccttctgac cacagctatg gcagcggagg 481 tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct ggggaggcca 541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac 601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag 661 atgacgtcga ttgttggtgc aacacgacgt caacttgggt tgtgtacgga acctgccatc 721 acaaaaaagg tgaagcacgg agatctagaa gagccgtgac gctcccctcc cattccacta 781 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcacttga 841 ttagagtcga aaattggata ttcaggaacc ctggtttcgc tttagcagca gctgccatcg 901 cttggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga 961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta 1021 tgtcaggtgg gacttgggtt gatgtcgtct tggaacatgg aggttgtgtc accgtaatgg 1081 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg 1141 aggtaagatc ctactgctat gaggcatcaa tatcagacat ggcttcggac agccgctgcc 1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgty tgcaaaagaa 1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga 1321 catgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc 1381 tggagtaccg gataatgttg tcagttcatg gctcccagca cagtgggatg attgttaatg 1441 acacaggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa 1501 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag 1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggttcaca 1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac 1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg 1741 tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga gctctggagg 1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa 1861 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca 1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga 1981 cagatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact ctgaccccag 2041 ttgggaggtt gataaccgct aaccccgtaa tcactgaaag cactgagaac tctaagatga 2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga 2161 agatcaccca ccactggcac aggagtggca gcaccattgg aaaagcattt gaagccactg 2221 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg 2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat 2341 cattgtttgg aggaatgtcc tggttctcac aaattctcat tggaacgttg ctgatgtggt 2401 tgggtctgaa cacaaagaat ggatctattt cccttatgtg cttggcctta gggggagtgt 2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga 2521 aggagacgag atgtggtaca ggggtgttcg tctataacga cgttgaagcc tggagggaca 2581 ggtacaagta ccatcctgac tccccccgta gattggcagc agcagtcaag caagcctggg 2641 aagatggtat ctgcgggatc tcctctgttt caagaatgga aaacatcatg tggagatcag 2701 tagaagggga gctcaacgca atcctggaag agaatggagt tcaactgacg gtcgttgtgg 2761 gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct gtgaacgagc 2821 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt cagagcagca aagacaaata 2881 acagctttgt cgtggatggt gacacactga aagaatgccc actcaaacat agagcatgga 2941 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg 3001 ttagagaaga ttattcatta gagtgtgatc cagccgttat tggaacagct gttaagggaa 3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga 3121 ggctgaagag ggcccatctg atcgagatga aaacatgtga atggccaaag tcccacacat 3181 tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttta gctgggccac 3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg 3301 aagagcttga aattcggttt gaggaatgcc caggcactaa ggtccacgtg gaggaaacat 3361 gtggaacaag aggaccatct ctgagatcac ccactgcaag cggaagggtg atcgaggaat 3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttctg ggctaaagat ggctgttggt 3481 atggaatgga gataaggccc aggaaagaac cagaaagcaa cttagtaagg tcaatggtga 3541 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca 3601 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcaatgg 3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa 3721 tcttgatggg tgccaccttc gcggaaatga acactggagg agatgtagct catctggcgc 3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc cttcatcttc agagctaatt 3841 ggacaccccg tgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct 3901 ccgccttgga gggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa 3961 tacgagcgat ggttgttcca cgcactgaca acatcacctt ggcaatcctg gctgctctga 4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg 4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca 4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt 4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc 4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg 4321 ccgcggttgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca 4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc 4441 ggctcgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc 4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag 4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggtg 4621 cgctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt 4681 acagagtaat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag 4741 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag 4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat 4861 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg 4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca 4981 ttggagcggt tgcgctggat tacccagcag gaacttcagg atctccaatc ctagacaagt 5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg agttatgtta 5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga 5161 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga 5221 gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact gtgatcttag 5281 ctccaaccag ggttgtcgct gctgaaatgg aggaagccct tagagggctt ccagtgcgtt 5341 atatgacaac agcagtcaat gtcacccact ctggaacaga aatcgtcgac ttaatgtgcc 5401 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtata 5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcaa 5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc 5581 gtgacgcatt tccggactcc aactcaccaa ttatggacac cgaagtggaa gtcccagaga 5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg 5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg 5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt 5821 gggactttgt cgtgacaact gacatttcag agatgggcgc caactttaaa gctgaccgtg 5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattctgg 5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga 6001 atcccaataa acctggagat gagtatctgt atggaggtgg gtgcgcagag actgacgaag 6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc 6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca 6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg 6241 tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga agatggtgct 6301 ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag gtgtggacca 6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc 6421 atgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag 6481 tgatggaagc cctgggaaca ctgccaggac acatgacaga gagattccag gaagccattg 6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg 6601 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgt 6661 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg 6721 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg 6781 catgtgtcct cattgttgtg ttcctattgc tggtggtgct catacctgag ccagaaaagc 6841 aaagatctcc ccaggacaac caaatggcaa tcatcatcat ggtagcagta ggtcttctgg 6901 gcttgattac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc 6961 taatgggaag gagagaggag ggggcaacca taggattctc aatggacatt gacctgcggc 7021 cagcctcagc ttgggccatc tatgctgcct tgacaacttt cattacccca gccgtccaac 7081 atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg caagctggag 7141 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc 7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc 7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc 7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg 7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca 7441 tagcagtagc cgtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg 7501 gggccctgat cacagccgca acttccactt tgtgggaagg ctctccgaac aagtactgga 7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt 7621 ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag 7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct 7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca 7801 aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt 7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag 7921 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa 7981 aaggaggccc tggtcatgaa gaacccgtgt tggtgcaaag ctatgggtgg aatatagtcc 8041 gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt 8101 gtgacatagg tgagtcatca tctagtcctg aagtggaaga agcacggacg ctcagagtcc 8161 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt 8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag 8281 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag 8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg 8401 acgggcctag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg 8461 ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga 8521 tccgcagtga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg 8581 cttaccatgg aagctatgag gcccccacac aagggtcagc gtcctctcta ataaacgggg 8641 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga 8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc 8761 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag 8821 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc aacaaggtgc 8881 gtagcaatgc agcattaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg 8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga 9001 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg 9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc 9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag 9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc 9241 gcataccagg aggaaggatg tatgcagatg acactgctgg ctgggacacc cgcattagca 9301 ggtttgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg cacagggcct 9361 tggcattggc cataatcaag tacacatacc aaaacaaagt ggtaaaggtc cttagaccag 9421 ctgaaaaagg gaaaacagtt atggacatta tttcgagaca agaccaaagg gggagcggac 9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggaata 9541 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag 9601 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag 9661 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg 9721 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact 9781 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt 9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag 9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc 9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg 10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat 10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc 10141 acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg ggaaaaaggg 10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca 10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag tacatggact 10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctgga gtgctgtaag 10381 caccaatctt aatgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc 10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg 10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca 10561 cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg 10621 ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt agaggagacc 10681 ccccggaaaa cgcaaaacag catattgacg ctgggaaaga ccagagactc catgagtttc 10741 caccacgctg gccgccaggc acagatcgcc gaatagcggc ggccggtgtg gggaaatcca 10801 tgggtctt- Full 2016 Venezuela Zika Sequence From Asymptomatic Breast Milk Fed Infant
Viable Zika virus in the serum of an asymptomatic breastfeeding Venezuelan infant in 2016 Environmental and Global Health, University of Florida - Gainesville, 1225 Center Drive, Room 4155, Gainesville, FL 32610, USA- Florida Local Zika Cases Increase To 162
ACTIVE INVESTIGATIONS Information on Active Investigations When a local case of Zika virus is confirmed through laboratory testing, the department conducts a thorough investigation around the case to determine if additional people are infected. The department interviews and tests close contacts and community members around the case. Knowing if additional people are infected helps the department determine if there is a zone where mosquitoes are transmitting the virus. Not every case results in a designation of active transmission in an area. In some instances, a case of Zika is an isolated incident with no additional people infected. For more information on the department’s testing and investigation process, click here. paragraph break Current Number of Active Investigations: 14 Miami-Dade County: 10 open investigations Palm Beach: 2 open investigations Unknown: 2 open investigations *Note: Exposure occurred in Miami Beach and overseas in an area with widespread transmission of Zika. paragraph break Current Number of Closed Investigations: 26 Miami-Dade County: 20 closed investigations Palm Beach County: 4 closed investigation Broward County: 1 closed investigation Pinellas: 1 closed investigation paragraph break Sampling Activities For Active Investigations Miami Beach in Miami-Dade County Total # of Samples Collected Positive Negative Pending Results 1,051 59 992 0 paragraph break Palm Beach County – 2 Investigations Total # of Samples Collected Positive Negative Pending Results 3 0 3 0 paragraph break Miami-Dade Investigations Outside of Wynwood and Miami Beach – 9 Investigations Total # of Samples Collected Positive Negative Pending Results 26 1 0 25 paragraph break Wynwood Area in Miami-Dade County – Note: This investigation is closed, but the department is providing the sampling results below for reference. Total # of Samples Collected Positive Negative Pending Results 524 33 491 0 Data as of Oct. 5, 2016 - 3:39 PM ET http://www.floridahealth.gov/diseases-and-conditions/zika-virus/index.html?utm_source=flhealthIndex- Dominican Republic Zika Sequences Match Florida Sub-clade
- Florida Zika Exports Increase To 17
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ - Florida Zika Cases Increase To 987
Account
Navigation
Search
Configure browser push notifications
Chrome (Android)
- Tap the lock icon next to the address bar.
- Tap Permissions → Notifications.
- Adjust your preference.
Chrome (Desktop)
- Click the padlock icon in the address bar.
- Select Site settings.
- Find Notifications and adjust your preference.
Safari (iOS 16.4+)
- Ensure the site is installed via Add to Home Screen.
- Open Settings App → Notifications.
- Find your app name and adjust your preference.
Safari (macOS)
- Go to Safari → Preferences.
- Click the Websites tab.
- Select Notifications in the sidebar.
- Find this website and adjust your preference.
Edge (Android)
- Tap the lock icon next to the address bar.
- Tap Permissions.
- Find Notifications and adjust your preference.
Edge (Desktop)
- Click the padlock icon in the address bar.
- Click Permissions for this site.
- Find Notifications and adjust your preference.
Firefox (Android)
- Go to Settings → Site permissions.
- Tap Notifications.
- Find this site in the list and adjust your preference.
Firefox (Desktop)
- Open Firefox Settings.
- Search for Notifications.
- Find this site in the list and adjust your preference.