Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. As of Thursday, *September 8, 2016, VDH has reported 80 cases of Zika virus disease in Virginia residents to the CDC ( 8 in Northwest Region, 41 in Northern Region, 8 in Eastern Region, 13 in Central Region and 10 in Southwest Region). All Virginia cases are associated with travel to a Zika-affected area. CDC has issued a travel alert (Level 2-Practice Enhanced Precautions) for people traveling to regions and certain countries where Zika virus transmission is ongoing. http://www.vdh.virginia.gov/zika/zika-virus-update/
  2. As of Thursday, *September 8, 2016, VDH has reported 80 cases of Zika virus disease in Virginia residents to the CDC ( 8 in Northwest Region, 41 in Northern Region, 8 in Eastern Region, 13 in Central Region and 10 in Southwest Region). All Virginia cases are associated with travel to a Zika-affected area. CDC has issued a travel alert (Level 2-Practice Enhanced Precautions) for people traveling to regions and certain countries where Zika virus transmission is ongoing.
  3. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  4. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  5. TABLE I. Provisional cases of selected* infrequently reported notifiable diseases (<1,000 cases reported during the preceding year), United States, week ending September 3, 2016 (WEEK 35)† Disease Total cases reported for previous years Current week Cum 2016 5-year weekly average§ 2015 2014 2013 2012 2011 States reporting cases during current week (No.35) Anthrax - - 0 - - - - 1 Arboviral diseases ¶,**: Chikungunya virus †† - 69 4 896 NN NN NN NN Eastern equine encephalitis virus - 1 1 6 8 8 15 4 Jamestown Canyon virus §§ - 2 0 11 11 22 2 3 La Crosse virus §§ - 6 2 55 80 85 78 130 Powassan virus - 4 0 7 8 12 7 16 St. Louis encephalitis virus - 2 0 23 10 1 3 6 Western equine encephalitis virus - - - - - - - - Botulism, total - 116 3 195 161 152 168 153 foodborne - 26 0 37 15 4 27 24 infant - 76 2 138 127 136 123 97 other(wound & unspecified) - 14 0 20 19 12 18 32 Brucellosis - 76 3 126 92 99 114 79 Chancroid 1 9 0 11 - - 15 8 CA (1 ) Cholera - - 0 2 5 14 17 40 Cyclosporiasis ** 2 321 11 645 388 784 123 151 OH (1 ), TX (1 ) Diphtheria - - - - 1 - 1 - Haemophilus influenzae, invasive disease (age <5 yrs) ¶¶: serotype b - 11 1 29 40 31 30 14 nontypeable serotype - 96 2 175 128 141 115 93 other serotype - 79 1 135 266 233 263 230 unknown serotype 2 139 3 167 39 34 37 48 VA (1 ), GA (1 ) Hansen's disease ** - 29 1 89 88 81 82 82 Hantavirus Infections **: Hantavirus infection (non-HPS) †† - 2 0 1 NN NN NN NN Hantavirus pulmonary syndrome (HPS) - 10 0 17 32 21 30 23 Hemolytic uremic syndrome, post-diarrheal ** 4 141 8 274 250 329 274 290 MI (1 ), NE (1 ), OR (1 ), CA (1 ) Hepatitis B, virus infection perinatal 1 17 1 37 47 48 40 NP PA (1 ) Influenza-associated pediatric mortality **, *** - 79 1 130 141 160 52 118 Leptospirosis ** 1 24 1 40 38 NN NN NN FL (1 ) Listeriosis 14 391 24 766 769 735 727 870 NYC (1 ), PA (3 ), OH (3 ), MI (1 ), VA (2 ), SC (1 ), FL (3 ) Measles ††† - 51 3 188 667 187 55 220 Meningococcal disease, invasive §§§: serogroup ACWY - 60 2 120 123 142 161 257 serogroup B 1 49 1 111 89 99 110 159 NY (1 ) other serogroup - 12 0 21 25 17 20 20 unknown serogroup 3 129 3 120 196 298 260 323 FL (1 ), OR (2 ) Novel influenza A virus infections ¶¶¶ - 21 6 6 3 21 313 14 Plague - - 0 13 10 4 4 3 Poliomyelitis, paralytic - - - - - 1 - - Polio virus infection, nonparalytic ** - - - - - - - - Psittacosis ** - 3 0 4 8 6 2 2 Q fever total **: - 74 3 156 168 170 135 134 acute - 60 3 122 132 137 113 110 chronic - 14 1 34 36 33 22 24 Rabies, human - - 0 1 1 2 1 6 SARS CoV - - - - - - - - Smallpox - - - - - - - - Streptococcal toxic shock syndrome ** - 170 3 335 259 224 194 168 Syphilis, congenital **** - 244 7 492 458 348 322 360 Toxic shock syndrome (staphylococcal) ** - 19 1 64 59 71 65 78 Trichinellosis ** - 8 0 11 14 22 18 15 Tularemia 1 122 5 314 180 203 149 166 WY (1 ) Typhoid fever 4 195 10 367 349 338 354 390 MA (1 ), NYC (3 ) Vancomycin-intermediate Staphylococcus aureus ** 1 67 3 183 212 248 134 82 OH (1 ) Vancomycin-resistant Staphylococcus aureus ** - - - 1 - - 2 - Viral hemorrhagic Fevers ††††: Crimean-Congo hemorrhagic fever - - - - NP NP NP NP Ebola hemorrhagic fever - - - - 4 NP NP NP Guanarito hemorrhagic fever - - - - NP NP NP NP Junin hemorrhagic fever - - - - NP NP NP NP Lassa fever - - - - 1 NP NP NP Lujo virus - - - - NP NP NP NP Machupo hemorrhagic fever - - - - NP NP NP NP Marburg fever - - - - NP NP NP NP Sabia-associated hemorrhagic fever - - - - NP NP NP NP Yellow fever - - - - - - - - Zika ††,§§§§ Zika virus congenital infection NA NA NA NN NN NN NN NN Zika virus disease, non-congenital infection 4 2,900 - NN NN NN NN NN NYC (1 ), VA (1 ), MS (1 ), TX (1 ) [ Export This Table ] [ Next Part ] [ NNDSS Interactive Tables ] [ Mortality Interactive Tables ] -: No reported cases N: Not reportable. NA: Not Available NN: Not Nationally Notifiable. NP: Nationally notifiable but not published. Cum: Cumulative year-to-date counts. * Case counts for reporting years 2015 and 2016 are provisional and subject to change. Data for years 2011 through 2014 are finalized. For further information on interpretation of these data, seehttp://wwwn.cdc.gov/nndss/document/ProvisionalNationaNotifiableDiseasesSurveillanceData20100927.pdf. † This table does not include cases from the U.S. territories. Three low incidence conditions, rubella, rubella congenital, and tetanus, are in Table II to facilitate case count verification with reporting jurisdictions. § Calculated by summing the incidence counts for the current week, the 2 weeks preceding the current week, and the 2 weeks following the current week, for a total of 5 preceding years. Additional information is available athttp://wwwn.cdc.gov/nndss/document/5yearweeklyaverage.pdf. ¶ Includes both neuroinvasive and nonneuroinvasive. Updated weekly reports from the Division of Vector-Borne Diseases, National Center for Emerging and Zoonotic Infectious Diseases (ArboNET Surveillance). Data for West Nile virus are available in Table II. ** Not reportable in all reporting jurisdictions. Data from states where the condition is not reportable are excluded from this table, except for the arboviral diseases and influenza-associated pediatric mortality. Reporting exceptions are available athttp://wwwn.cdc.gov/nndss/downloads.html. †† Office of Management and Budget approval of the NNDSS Revision #0920-0728 on January 21, 2016, authorized CDC to receive data for these conditions. CDC is in the process of soliciting data for these conditions (except Zika virus, congenital infection). CDC and the U.S. states are still modifying the technical infrastructure needed to collect and transmit data for Zika virus congenital infections. §§ Jamestown Canyon virus and Lacrosse virus have replaced California serogroup diseases. ¶¶ Data for Haemophilus influenzae (all ages, all serotypes) are available in Table II. *** Please refer to the MMWR publication for weekly updates to the footnote for this condition. ††† Please refer to the MMWR publication for weekly updates to the footnote for this condition. §§§ Data for meningococcal disease (all serogroups) are available in Table II. ¶¶¶ Please refer to the MMWR publication for weekly updates to the footnote for this condition. **** Updated weekly from reports to the Division of STD Prevention, National Center for HIV/AIDS, Viral Hepatitis, STD, and TB Prevention. †††† Please refer to the MMWR publication for weekly updates to the footnote for this condition. §§§§ All cases reported have occurred in travelers returning from affected areas, with their sexual contacts, or infants infected in utero. National Notifiable Diseases Surveillance System (NNDSS) MMWR web application provided by CDC WONDER, http://wonder.cdc.gov
  6. Zika ††,§§§§ Zika virus congenital infection NA NA NA NN NN NN NN NN Zika virus disease, non-congenital infection 4 2,900 - NN NN NN NN NN NYC (1 ), VA (1 ), MS (1 ), TX (1 ) http://wonder.cdc.gov/mmwr/mmwr_2016.asp?mmwr_year=2016&mmwr_week=35&mmwr_table=1&request=Submit&mmwr_location=
  7. Baby born with Zika at Jackson Memorial Hospital 15 women have delivered at the hospital, tested positive for Zika By Paradise Afshar - Digital Editor Posted: 9:11 PM, September 07, 2016Updated: 9:11 PM, September 07, 2016 5 5 MIAMI-DADE COUNTY, Fla. - A baby has been born at Jackson Memorial Hospital with microcephaly, according to Dr. Christine Curry. In total 15 pregnant women who have delivered at the hospital have tested positive for Zika, Curry said. More Zika Virus Headlines South Florida doctors treat baby girl born with Zika virus Miami Beach Commission holds public meeting about aerial spraying to… Those women are being monitored by doctors at the hospital. "Zika is a thing. Zika is real, and while we don't understand it fully, that is not a reason to dismiss its impact," Curry said while addressing the public at the Miami Beach commission meeting on Wednesday. Last month a baby girl tested positive for the Zika virus is being treated by doctors in South Florida. The baby's mother contracted the Zika virus while traveling while pregnant off the coast of Venezuela. The baby has not been diagnosed with microcephaly, but doctors said the child is suffering from other Zika-related side effects. Healthcare workers continue to test expecting mothers for the virus.
  8. A baby has been born at Jackson Memorial Hospital with microcephaly, according to Dr. Christine Curry. http://www.local10.com/health/zika-virus/baby-born-with-zika-at-jackson-memorial-hospital
  9. Zika Clusters Cases notified on 7 Sep 2016 as at 4pm 8 E-week 35 (28 Aug - 3 Sep 2016) E-week 36 (4 Sep - 7 Sep 2016 at 4pm) 215 68 Number of reported Zika cases will be updated daily when cases are notified. Zika Clusters as of 7 Sep 2016 S/N Locality 1 Aljunied Cres (Blk 95,97,98,99,101,102,103,104,105,106,107,108,109,110,111,112) / Aljunied Rd / Circuit Rd (Blk 61,85) / Geylang East Ave 1 (Blk 126) / Geylang East Ctrl (Blk 1 22) / Lor 21A,23,25 Geylang / Paya Lebar Way (Blk 120,121,122,123) / Sims Dr (Blk 42A,43,44) / Sims Pl (Blk 52,53) (248 cases as of 7 Sep 2016, of which 175 cases with onset in the last 2 weeks) 2 Bedok Nth Ave 2 (Blk 514) / Bedok Nth Ave 3 (404,507) / Bedok Nth St 3 (Blk 525) (4 cases as of 7 Sep 2016, of which 3 cases with onset in the last 2 weeks) 3 Joo Seng Rd (Blk 17, 18, 21) (3 cases as of 7 Sep 2016, of which 3 cases with onset in the last 2 weeks) 4 Bishan St 12 (Blk 122, 123) (3 Cases as of 7 Sep 2016, of which 3 cases with onset in the last 2 weeks) 5 Elite Ter (2 Cases as of 7 Sep 2016, of which 2 cases with onset in the last 2 weeks) http://www.nea.gov.sg/public-health/vector-control/overview/zika-clusters
  10. Joint MOH-NEA statement (8 Sep 2016) Tags: News Highlights Joint MOH-NEA statement (8 September) 1. As of 12pm, 8 September, MOH has confirmed nine new cases of locally transmitted Zika virus infection in Singapore. Of these, Four cases are linked to the Aljunied Crescent/ Sims Drive/ Kallang Way/ Paya Lebar Way cluster; One case is linked to the Bishan Street 12 cluster; and One case is linked to the Elite Terrace cluster. 2. There is a potential new cluster involving two previously reported cases and a new case today. One of the previously unlinked cases in the cluster was reported on 7 September and his work address was verified today. They all work in the Ubi Crescent area. The other two cases have no known links to any existing cluster. Vector Control Update 3. NEA is continuing with vector control operations and outreach efforts in the cluster areas at Aljunied Crescent / Sims Drive / Paya Lebar Way / Kallang Way / Circuit Road / Geylang East Central / Geylang East Avenue 1; Bedok North Avenue 2 / Bedok North Avenue 3 / Bedok North Street 3; Joo Seng Road; Bishan Street 12 and Elite Terrace. As of 7 September 2016, a total of 166 breeding habitats have been found and destroyed in the cluster areas, of which 108 are from homes, and 58 from outdoor areas. 4. NEA will also be carrying out vector control operations and outreach efforts at Ubi Crescent. 5. Members of the public can obtain updated information on Zika and details on current clusters at NEA’s website: www.nea.gov.sg/zika andwww.nea.gov.sg/zika-clusters. 6. Aligned to our dengue control approach, NEA will continue to work with stakeholders and the community to reduce mosquito breeding, as vector control is key to reducing the transmission of Zika in the community. https://www.moh.gov.sg/content/moh_web/home/pressRoom/pressRoomItemRelease/2016/joint-moh-nea-statement--8-sep-2016-.html
  11. Carlos Garcia, who lives within the 1.5 mile Zika zone, spoke exclusively to NBC 6 about getting infected. He said last month he was convinced he had symptoms of the Zika virus. "I had a fever with no headache, no sore throat, just fever chills. And, then I had the rash," said Garcia. The 45-year-old had a rash on the back of his neck. He said there was another rash on his upper body. "I needed to know because you never know. So, doctors tell me I should avoid having children for 6 months to a year," said Garcia. Garcia showed NBC 6 a positive lab result from Aug. 24 that states the Zika virus was detected in his urine. http://www.nbcmiami.com/news/local/Miami-Beach-Man-Says-He-Contracted-Zika-Exclusive-392677681.html
  12. Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 18438 18438 100% 0.0 99% KX447509.1 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 18435 18435 100% 0.0 99% KJ776791.2 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 18435 18435 100% 0.0 99% KX447512.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 18435 18435 100% 0.0 99% KX369547.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 18429 18429 100% 0.0 99% KX447515.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 18426 18426 100% 0.0 99% KX447514.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 18426 18426 100% 0.0 99% KX447513.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 18420 18420 100% 0.0 99% KX447516.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 18420 18420 100% 0.0 99% KX447511.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 18417 18417 100% 0.0 99% KX447510.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 18402 18402 100% 0.0 99% KX185891.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 18402 18402 100% 0.0 99% KX117076.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 18402 18402 100% 0.0 99% KU963796.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 18399 18399 100% 0.0 99% KX253996.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 18399 18399 100% 0.0 99% KU955589.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 18399 18399 100% 0.0 99% KU820899.2 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 18395 18395 100% 0.0 99% KX266255.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 18393 18393 100% 0.0 99% KU866423.2 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 18390 18390 100% 0.0 99% KX447517.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 18390 18390 100% 0.0 99% KU509998.3 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 18372 18372 100% 0.0 99% KX280026.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 18372 18372 100% 0.0 99% KX051563.1 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 18366 18366 100% 0.0 99% KU991811.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 18366 18366 100% 0.0 99% KU321639.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 18357 18357 100% 0.0 99% KU729218.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 18357 18357 100% 0.0 99% KU707826.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 18357 18357 100% 0.0 99% KU365779.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 18354 18354 100% 0.0 99% KX262887.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 18354 18354 100% 0.0 99% KX197192.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 18345 18345 100% 0.0 99% KX694534.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 18345 18345 100% 0.0 99% KX198135.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 18345 18345 100% 0.0 99% KU926309.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 18345 18345 100% 0.0 99% KU501217.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 18345 18345 100% 0.0 99% KU365780.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 18339 18339 100% 0.0 99% KU940228.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 18339 18339 100% 0.0 99% KU647676.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 18339 18339 100% 0.0 99% KU501216.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 18339 18339 100% 0.0 99% KU365777.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 18336 18336 100% 0.0 99% KU758877.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 18336 18336 100% 0.0 99% KX247646.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 18336 18336 100% 0.0 99% KX156776.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 18332 18332 99% 0.0 99% KU497555.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 18330 18330 100% 0.0 99% KX156774.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 18330 18330 100% 0.0 99% KU729217.2 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 18330 18330 100% 0.0 99% KU527068.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 18327 18327 100% 0.0 99% KU820897.5 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 18327 18327 100% 0.0 99% KX247632.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 18327 18327 100% 0.0 99% KX156775.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 18327 18327 100% 0.0 99% KX087102.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 18327 18327 100% 0.0 99% KU365778.1 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 18327 18327 100% 0.0 99% KU312312.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 18321 18321 100% 0.0 99% KX520666.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 18321 18321 100% 0.0 99% KU922960.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 18318 18318 100% 0.0 99% KX548902.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 18318 18318 100% 0.0 99% KX446951.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 18318 18318 100% 0.0 99% KU937936.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 18318 18318 100% 0.0 99% KU926310.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 18318 18318 100% 0.0 99% KU922923.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 18318 18318 100% 0.0 99% KU501215.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 18312 18312 100% 0.0 99% KX601168.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 18312 18312 100% 0.0 99% KX446950.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 18312 18312 100% 0.0 99% KX087101.2 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 18312 18312 100% 0.0 99% KU870645.1 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 18309 18309 100% 0.0 99% KX702400.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 18309 18309 100% 0.0 99% KX377337.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 18309 18309 100% 0.0 99% KU820898.1 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 18309 18309 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 18307 18307 100% 0.0 99% KU853012.1 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 18303 18303 100% 0.0 99% KX056898.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 18303 18303 100% 0.0 99% KU955590.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 18301 18301 100% 0.0 99% KX766028.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 18300 18300 100% 0.0 99% KU740184.2 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 18300 18300 100% 0.0 99% KU761564.1 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 18291 18291 100% 0.0 99% KX766029.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 18285 18285 100% 0.0 99% KX673530.1 Select seq gb|KU940224.1| Zika virus isolate Bahia09, partial genome 18245 18245 99% 0.0 99% KU940224.1 Select seq gb|KU744693.1| Zika virus isolate VE_Ganxian, complete genome 18150 18150 100% 0.0 99% KU744693.1 Select seq gb|KU681081.3| Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome 18096 18096 100% 0.0 99% KU681081.3 Select seq gb|KX694532.1| Zika virus strain ZIKV/Homo sapiens/THA/PLCal_ZV/2013, complete genome 17966 17966 100% 0.0 99% KX694532.1 Select seq gb|KU955593.1| Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome 17798 17798 100% 0.0 98% KU955593.1 Select seq gb|JN860885.1| Zika virus isolate FSS13025 polyprotein gene, partial cds 17798 17798 99% 0.0 98% JN860885.1 Select seq gb|KF993678.1| Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds 17733 17733 98% 0.0 99% KF993678.1 Select seq gb|EU545988.1| Zika virus polyprotein gene, complete cds 17643 17643 100% 0.0 98% EU545988.1 Select seq gb|KU681082.3| Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome 17488 17488 100% 0.0 98% KU681082.3 Select seq gb|KX601167.1| Zika virus strain ZIKV/Aedes sp./MYS/P6-740/1966, complete genome 16482 16482 100% 0.0 96% KX601167.1 Select seq gb|HQ234499.1| Zika virus isolate P6-740 polyprotein gene, partial cds 16475 16475 99% 0.0 96% HQ234499.1 Select seq gb|KX694533.1| Zika virus strain ZIKV/Aedes aegypti/MYS/P6-740/1966, complete genome 16473 16473 100% 0.0 96% KX694533.1 Select seq gb|KX377336.1| Zika virus strain P6-740, complete genome 16469 16469 100% 0.0 96% KX377336.1 Select seq gb|KX447518.1| Zika virus isolate 1_0117_PF polyprotein gene, partial cds 16253 16253 88% 0.0 99% KX447518.1
  13. LOCUS KX806557 10807 bp RNA linear VRL 01-SEP-2016 DEFINITION Zika virus isolate TS17-2016, complete genome. ACCESSION KX806557 VERSION KX806557.1 GI:1061361605 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10807) AUTHORS Pyke,A.T., Moore,P.R., Warrilow,D., Huang,B. and van den Hurk,A.F. TITLE Isolation of Zika virus from a viremic patient from Australia with travel to Tonga, 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10807) AUTHORS Pyke,A.T., Moore,P.R., Warrilow,D., Huang,B. and van den Hurk,A.F. TITLE Direct Submission JOURNAL Submitted (31-AUG-2016) Public Health Virology, Queensland Health Forensic and Scientific Services, 39 Kessels Road, Coopers Plains, QLD 4108, Australia COMMENT ##Assembly-Data-START## Assembly Method :: Geneious v. 8 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10807 /organism="Zika virus" /mol_type="genomic RNA" /isolate="TS17-2016" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Australia" /collection_date="Feb-2016" /note="patient had traveled to Tonga; passage history: 1X passsage suckling mouse brain: 4X passages C6/36 Aedes albopictus cells; genotype: Asian" CDS 108..10379 /codon_start=1 /product="polyprotein" /protein_id="AOI20067.1" /db_xref="GI:1061361606" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTNVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWMFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPMLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVASCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRSMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 acctgttgat ctgtgtgaat cagactgcga cagttcgagt ttgaagcgaa agctagcaac 61 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa 121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga 181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca 241 ggatggtctt ggcgattcta gcctttttga gattcacggc aatcaagcca tcactgggtc 301 tcatcaatag atggggttca gtggggaaaa aagaggctat ggaaataata aagaagttca 361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag 421 gcgcagatac taatgtcgga attgttggcc tcctgctgac cacagctatg gcagcggagg 481 tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct ggggaggcca 541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac 601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag 661 atgacgtcga ttgttggtgc aacacgacgt caacttgggt tgtgtacgga acctgccatc 721 acaaaaaagg tgaagcacgg agatctagaa gagctgtgac gctcccctcc cattccacta 781 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcacttga 841 ttagagtcga aaactggatg ttcaggaacc ctggcttcgc gttagcagca gctgccatcg 901 cttggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga 961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta 1021 tgtcaggtgg gacttgggtt gatgttgtct tggaacatgg aggttgtgtc accgtaatgg 1081 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg 1141 aggtaagatc ctactgctat gaggcatcaa tatcggacat ggcttcggac agccgctgcc 1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtc tgcaaaagaa 1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga 1321 catgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc 1381 tggagtaccg gataatgctg tcagttcatg gctcccagca cagtgggatg atcgttaatg 1441 acacaggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa 1501 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag 1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggttcaca 1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac 1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg 1741 tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga gctctggagg 1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa 1861 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca 1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga 1981 cagatggacc ttgcaaggtc ccagctcaga tggcggtgga catgcaaact ctgaccccag 2041 ttgggaggtt gataaccgct aaccccgtaa tcactgaaag cactgagaac tctaagatga 2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga 2161 agatcaccca ccactggcac aggagtggca gcaccattgg aaaagcattt gaagccactg 2221 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg 2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat 2341 cattgtttgg aggaatgtcc tggttctcac aaattctcat tggaacgttg ctgatgtggt 2401 tgggtctgaa cacaaagaat ggatctattt cccttatgtg cttggcctta gggggagtgt 2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga 2521 aggagacgag atgcggtaca ggggtgttcg tctataacga cgttgaagcc tggagggaca 2581 ggtacaagta ccatcctgac tccccccgta gattggcagc agcagtcaag caagcctggg 2641 aagatggtat ctgtgggatc tcctctgttt caagaatgga aaacatcatg tggagatcag 2701 tagaagggga gctcaacgca atcctggaag agaatggagt tcaactgacg gtcgttgtgg 2761 gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct gtgaacgagc 2821 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt cagagcagca aagacaaata 2881 acagctttgt cgtggatggt gacacactga aggaatgccc actcaaacat agagcatgga 2941 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg 3001 ttagagaaga ttattcatta gagtgtgatc cagccgttat tggaacagct gttaagggaa 3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga 3121 ggctgaagag ggcccatctg atcgagatga aaacatgtga atggccaaag tcccacacat 3181 tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttta gctgggccac 3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg 3301 aagagcttga aattcggttt gaggaatgcc caggcaccaa ggtccacgtg gaggaaacat 3361 gtggaacaag aggaccatct ctgagatcaa ccactgcaag cggaagggtg atcgaggaat 3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttccg ggctaaagat ggctgttggt 3481 atggaatgga gataaggccc aggaaagaac cagaaagtaa cttagtaagg tcaatggtga 3541 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca 3601 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcaatgg 3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa 3721 ttttgatggg tgccaccttc gcggaaatga acactggagg agatgtagct catctggcgc 3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc tttcatcttc agagctaatt 3841 ggacaccccg tgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct 3901 ccgccttgga aggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa 3961 tacgagcgat ggttgttcca cgcactgata acatcacctt ggcaatcctg gctgctctga 4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg 4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca 4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt 4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc 4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg 4321 ccgcggtcgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca 4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc 4441 ggctcgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc 4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag 4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggtg 4621 ctctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt 4681 acagagtgat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag 4741 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag 4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat 4861 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg 4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca 4981 ttggagcggt tgcgctggat tacccagcag gaacttcagg atctccaatc ctagacaagt 5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg agttatgtta 5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga 5161 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga 5221 gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact gtgatcttag 5281 ctccaaccag ggttgtcgct gctgaaatgg aggaagccct tagagggctt ccagtgcgtt 5341 atatgacaac agcagtcaat gtcacccact ctggaacaga aatcgtcgac ttaatgtgcc 5401 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtata 5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcaa 5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc 5581 gtgacgcatt tccggactcc aactcaccaa ttatggacac cgaagtggaa gtcccagaga 5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg 5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg 5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt 5821 gggactttgt cgtgacaact gacatttcag agatgggcgc caactttaaa gctgaccgtg 5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattctgg 5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga 6001 atcccaacaa acctggagat gagtatctgt atggaggtgg gtgcgcagag actgacgaag 6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc 6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca 6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg 6241 tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga agatggtgct 6301 ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag gtgtggacca 6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc 6421 acgcggccct gaagtcattc aaagagtttg ccgctgggaa aagaggagcg gcttttggag 6481 tgatggaagc cttgggaaca ctgccaggac acatgacaga gagattccag gaagccattg 6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg 6601 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgc 6661 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg 6721 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg 6781 catgtgtcct cattgttgtg ttcctattgc tggtggtgct catacctgag ccagaaaagc 6841 aaagatctcc ccaggacaac caaatggcaa tcatcatcat ggtagcagta ggtcttctgg 6901 gcttgattac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc 6961 taatgggaag gagagaggag ggggcaacca taggattctc aatggatatt gacctgcggc 7021 cagcctcagc ttgggccatc tacgctgcct tgacaacttt cattacccca gccgtccaac 7081 atgcagtgac cacttcgtac aacaactact ccttaatggc gatggccacg caagctggag 7141 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc 7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc 7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc 7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg 7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca 7441 tagcagtagc cgtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg 7501 gggccctgat cacagctgca acttccactt tgtgggaagg ctctccgaac aagtactgga 7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt 7621 ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag 7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct 7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca 7801 aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt 7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag 7921 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa 7981 aaggaggccc tggtcatgaa gaacccatgt tggtgcaaag ctatgggtgg aacatagtcc 8041 gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt 8101 gtgacatagg tgagtcatca tctagtcctg aagtggaaga agcacggacg ctcagagtcc 8161 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt 8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag 8281 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag 8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg 8401 acgggcccag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg 8461 ctgtggcaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga 8521 tccgcagtga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg 8581 cttaccatgg aagctatgag gcccccacac aagggtcagc gtcctctcta ataaacgggg 8641 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga 8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc 8761 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag 8821 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc aacaaggttc 8881 gtagcaatgc agcattaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg 8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga 9001 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg 9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc 9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag 9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc 9241 gcataccagg aggaaggatg tatgcagatg acactgctgg ctgggacacc cgcatcagca 9301 ggtttgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg cacagggcct 9361 tggcattggc cataatcaag tacacatacc agaacaaagt ggtaaaggtc cttagaccag 9421 ctgaaaaagg gaagacagtt atggacatta tttcgagaca agaccaaagg gggagcggac 9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggagta 9541 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag 9601 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggcg gtcagtggag 9661 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg 9721 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact 9781 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt 9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag 9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc 9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg 10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat 10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc 10141 acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg ggaaaaaggg 10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca 10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag tacatggact 10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctgga gtgctgtaag 10381 caccaatctt agtgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc 10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg 10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca 10561 cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg 10621 ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt agaggagacc 10681 ccccggaaaa cgcaaaacag catattgacg ctgggaaaga ccagagactc catgagtttc 10741 caccacgctg gccgccaggc acagatcgcc gaatagcggc ggccggtgtg gggaaatcca 10801 tgggtct
  14. Australia Public Health Virology has release full 2016 Zika sequence, TS17-2016, from Australia ex-Toga sequence, which is related to Samoa sequences isolated from China travelers,
  15. September 7, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are 19 new travel related cases today including 11 in Miami-Dade, four in Broward, one in Brevard, one in Monroe, one in Pasco and one in St. Johns. Please visit ourwebsite to see the full list of travel-related cases. There are no new non-travel related cases today. DOH continues door-to-door outreach and targeted testing in Pinellas, Palm Beach and Miami-Dade counties and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the small identified areas in Wynwood and Miami Beach in Miami-Dade County, see maps below. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 596 Non-Travel Related Infections of Zika 56 Infections Involving Pregnant Women 80 The department is currently conducting 14 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 6,089 people statewide. Florida currently has the capacity to test 5,589 people for active Zika virus and 6,392 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. Florida’s small case cluster is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted area in Miami-Dade County (see map below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 80. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 5,613 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. State of Florida Miami-Dade County About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  16. Infection Type Infection Count Travel-Related Infections of Zika 596 Non-Travel Related Infections of Zika 56 Infections Involving Pregnant Women 80 http://www.floridahealth.gov/newsroom/2016/09/090716-zika-update.html
  17. Zika causality statement 7 September 2016 Zika virus infection: update on the evidence for a causal link to congenital brain abnormalities and Guillain-Barré syndrome1 Update of WHO Statement published on 31 March 2016 Since 2013, an unexpected rise in the number of reported cases of the neurological disorder Guillain-Barré syndrome2 (GBS) in French Polynesia, Brazil and other countries in the Americas led specialists to infer a link with an ongoing outbreak of Zika virus infection. Reports of unexpected increases in cases of microcephaly in north-eastern Brazil also led to the suggestion of a link to Zika virus infection in late 2015. On 1 December 2015, PAHO/WHO published an alert regarding the implications for public health of the detection of neurological syndromes and congenital malformations in the context of epidemic transmission of Zika virus in Brazil. On 1 February 2016, the World Health Organization (WHO) declared that the clusters of cases of microcephaly and neurological disorders occurring in areas with Zika virus transmission constituted a public health emergency of international concern. Methodology In February 2016, WHO and partners3 developed a causality framework that defined questions about the relationship between Zika virus infection and each of two clinical outcomes: congenital brain abnormalities including microcephaly and GBS, according to 10 dimensions of causality4. In late February 2016, WHO commissioned systematic reviews of the scientific literature to determine whether the currently available evidence was sufficient to establish a causal link between Zika virus infection and each of the two potential complications. A team of researchers3 conducted the systematic review of literature and selected studies available up to 30 May and synthesized the evidence in the structured causality framework4. The team5 also assessed the quality of the evidence. WHO convened a multidisciplinary panel of experts to assess the methods and interpret the results of the systematic review. Finally, selected, non-systematically identified, studies up to 29 July 2016 were added to the systematic review. Conclusions The panel of experts5 concluded: The most likely explanation of available evidence from outbreaks of Zika virus infection and clusters of microcephaly is that Zika virus infection during pregnancy is a cause of congenital brain abnormalities including microcephaly; The most likely explanation of available evidence from outbreaks of Zika virus infection and Guillain-Barré syndrome is that Zika virus infection is a trigger of GBS. The expert panel recognizes that Zika virus alone may not be sufficient to cause either congenital brain abnormalities or GBS. It is not known whether these effects depend on as yet uncharacterized co-factors being present. Nor is it known whether dengue virus plays a part; dengue virus is carried by the same species of mosquito and has circulated in many countries during the same period. Recommendations The panel agreed that there is sufficient evidence to recommend increasing: public health actions to reduce the risk of the effects of Zika virus infection in pregnancy, and to provide appropriate care and support (for women who have been exposed; public health actions to reduce exposure to Zika virus infection for all people; public health actions to provide appropriate clinical care and rehabilitation and continuing care for all those with long term neurological conditions, such as acute clinical services and rehabilitation; surveillance and research into diagnostics, vaccines, treatments and vector control. Key findings of the reviews Microcephaly and other brain abnormalities before or present at birth The systematic review team found 72 studies that directly addressed one or more specific questions about links between Zika virus and congenital brain abnormalities including microcephaly. Laboratory studies have shown that Zika virus can cross the placenta and replicate in human brain cells. Both population- and individual-level studies have demonstrated a temporal association between Zika virus exposure and microcephaly incidence. Clinical reports have shown the presence of Zika virus infection in pregnant women prior to the detection of fetal brain malformations. In these women other congenital infections and dengue virus infection had been excluded. Epidemiological studies have suggested a marked increase in the risk of brain abnormalities in fetuses and newborns when a woman acquires Zika virus infection during pregnancy, particularly when infection occurs during the first trimester. The exact magnitude of the association is not known yet, however one study from French Polynesia and on-going studies in Brazil (to be published) suggest that the risk of fetal brain abnormalities is likely to be many times greater for pregnant women with Zika virus infection than for those without. Guillain-Barré syndrome The systematic review team found 36 studies that directly addressed one or more specific questions about links between Zika virus and GBS. A temporal association between clinical symptoms of Zika virus infection and the onset of GBS was demonstrated in population- and individual-level studies in several countries. The most detailed evidence came from studies of the 2013-14 outbreak in French Polynesia, in which around one in 4000 people with Zika virus infection were estimated to have developed GBS. A study comparing hospitalised patients with and without GBS found that the odds of having recent Zika virus infection were more than 30 times higher in the patients with Guillain-Barré syndrome. Several other infections that can trigger GBS were excluded, though many of the patients also had antibody reactivity to dengue viruses. The number of cases of GBS fell as the Zika virus outbreak ended. Limitations of the evidence Publication bias may be occurring with researchers only offering studies with positive findings to journals. At this early stage of discovery of a new cause of disease, strong findings in favour of causation are more likely to be published than weak or contradictory findings. The systematic review process could not prevent publication bias but reduced the risk that only positive reports in favour of causation would be evaluated. There were methodological limitations in many studies reviewed. Uncertainties around the accuracy of diagnostic tests for Zika virus made interpretation of many studies problematic. Some studies have only reported preliminary findings and important gaps remain in both surveillance and research evidence. So far, epidemiological studies to calculate the strength of the associations with Zika virus infection have only been completed in French Polynesia, and have either not been completed or not conducted in other affected countries. Current evidence does not show which specific environmental and host factors interact with Zika virus to increase the risk of an affected pregnancy or of GBS or whether there are specific factors that also have an effect in certain places. The systematic review did not find studies that could determine whether or not Zika virus causes specific brain abnormalities not found with other congenital infections. Some characteristics of the cases of GBS differed from typical patterns described following other infections. Surveillance data have shown increased incidence rates of microcephaly or of GBS in some but not all countries that have experienced large outbreaks of Zika virus infection. Implications for research Research questions to be addressed: Research to define the biological mechanisms of causality and to further the development of vaccines, treatments and better vector control methods. Cohort studies of the populations currently at risk are needed to determine both absolute and relative risks of a Zika-affected pregnancy, the role of co-factors and effect modifiers, and to determine whether there is a specific congenital Zika virus syndrome. The group is also working on methods to produce a living systematic review of the Zika causality framework that will incorporate new evidence as it becomes available – to combine rigour with timeliness for causality research. Next steps The use of the causality framework enables identification of areas where evidence quality needs to be improved and where more research is needed to address specific questions about the effects of Zika virus infection. The systematic review will be updated regularly to incorporate the rapidly expanding body of evidence about the causal relationships between Zika virus infection and congenital brain abnormalities, and Guillain-Barré syndrome, and other potentially associated conditions. Situation report 31 March 2016 Footnotes 1This statement is a standalone document that summarizes the position of WHO based on advice from an expert panel. Alongside this statement, a full manuscript and tables of evidence have been submitted to PlosMed. Please see the below related links. 2Guillain-Barré syndrome is an immune mediated neurological condition that usually occurs within a month of certain viral or bacterial infections. These infections can trigger the immunological pathways that end in the pattern of paralysis that is typical of GBS. In other words, a particular virus or bacteria does not cause GBS directly, but trigger mechanisms that result in the syndrome. 3Institute of Social and Preventive Medicine, University of Bern, Switzerland 4Bradford Hill, in 1965, proposed a list of nine aspects that could help decide whether causation is the most likely explanation for an association between and exposure and an outcome. The list has been modified over time and the systematic review team considered 10 aspects (referred to in this document as dimensions of causality): temporality (cause precedes effect); biological plausibility (and coherence with current biological knowledge of the proposed biological mechanisms); strength of association (measured as risk ratio, rate ratio, or odds ratio in cohort or case-control studies); consistency of associations across different study types, populations and times; exclusion of alternative explanations; dose-response relationship (biological gradient); cessation (reversal of an effect by experimental removal of, or observed decline in, the exposure); experimental evidence (from animal studies); analogous cause-and-effect relationships found in other diseases; and specificity of the effect. 5Expert panel members pdf, 263kb Full manuscript and tables of evidence, submitted to PlosMed http://www.who.int/emergencies/zika-virus/causality/en/
  18. Seven new Zika cases in South Florida Alan Gomez, USA TODAY9:18 p.m. EDT September 6, 2016 MIAMI — Florida health officials are investigating whether mosquitoes carrying Zika are spreading even farther in South Florida as the number of locally acquired cases continue to climb. The Florida Department of Health confirmed on Tuesday that six more people contracted the virus in the tourist hot spot of Miami Beach. Over the past month, 40 people have contracted Zika from mosquitoes in Miami Beach and a second South Florida location - the Wynwood art district just north of downtown Miami. Those two areas have become the focus of health officials, mosquito control efforts and travel warnings for pregnant women from the federal Centers for Disease Control and Prevention. Now, the department says someone has contracted the virus outside those two zones. The department said the new case was identified in Miami-Dade County, but would not specify where until officials can test relatives, close contacts and neighbors of the person to determine if it's an active outbreak or just an isolated case. "One case does not mean ongoing active transmission is taking place," the department said. "If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified." USA TODAY Fla. finds Zika virus in U.S. mosquito for first time The new cases came as Congress returned to Washington and tried to agree on emergency funding to help Florida and other states fight back against the fast-spreading virus. Senate Majority Leader Mitch McConnell, R-Ky., and House Speaker Paul Ryan, R-Wisc., said on Tuesday that Democrats have twice rejected a bill that would dedicate $1.1 billion in federal funds to help research and prevention efforts. Rep. Nancy Pelosi, D-Calif., and other Democratic leaders say the bills advanced by the GOP have included "poison pills" including cuts to health care, Planned Parenthood and blocking a ban on displaying the Confederate flag at U.S. military cemeteries. USA TODAY Bill to provide $1.1 billion Zika funding dies in Senate vote As that battle rages in Washington, Miami-Dade County announced that it will conduct aerial mosquito spraying over the affected portion of Miami Beach. Similar efforts in Wynwood drew widespread opposition from residents concerned about the chemicals dropping down on them. But Miami-Dade Country Mayor Carlos Gimenez said on Tuesday that the CDC and various state officials signed off on the decision to spray on Miami Beach. "Although we had concerns about spraying in Miami Beach due to its unique topography, high-rise buildings and construction sites, we have received reassurances . . . that this is the right and safe thing to do at this time," Gimenez said in a statement. The news of Zika continuing to spread on Miami Beach comes after state officials recently trapped the first mosquitoes in the U.S. to contain the Zika virus. The Florida Department of Agriculture and Consumer Services caught three mosquitoes in the 1.5-square mile area where humans have been contracting the virus. To date, Florida has confirmed 577 cases of people who contracted Zika while traveling abroad. The virus has been identified in 80 pregnant women who contracted the virus abroad. http://www.usatoday.com/story/news/2016/09/06/seven-new-zika-cases-south-florida/89928314/
  19. Singapore Zika cases hit 283; potential new cluster Elite Terrace Posted 07 Sep 2016 19:03 Updated 07 Sep 2016 19:07 SINGAPORE: Eight new cases of locally transmitted Zika were confirmed on Wednesday (Sep 7), bringing the total number of confirmed cases in Singapore to 283. Authorities added that there is a potential new cluster in the Elite Terrace area, involving a previously reported case and a new case today. In a joint statement, the Ministry of Health (MOH) and National Environment Agency (NEA) added that, of the eight new cases, two are linked to the Aljunied Crescent / Sims Drive / Kallang Way / Paya Lebar Way cluster, and one is linked to the Bishan Street 12 cluster. The other four cases have no known links to any existing cluster. - CNA/nc http://www.channelnewsasia.com/news/singapore/singapore-zika-cases-hit-283-potential-new-cluster-elite-terrace/3108596.html?utm_source=twitterfeed&utm_medium=twitter
  20. Zika Clusters Cases notified on 6 Sep 2016 as at 3pm 17 E-week 35 (28 Aug - 3 Sep 2016) E-week 36 (4 Sep - 6 Sep 2016 at 3pm) 215 60
  21. Zika Clusters as of 6 Sep 2016 S/N Locality 1 Aljunied Cres (Blk 95,97,98,99,101,102,103,104,105,106,107,108,109,110,111,112) / Aljunied Rd / Circuit Rd (Blk 61,85) / Geylang East Ave 1 (Blk 126) / Geylang East Ctrl (Blk 1 22) / Lor 21A,23,25 Geylang / Paya Lebar Way (Blk 120,121,122,123) / Sims Dr (Blk 42A,43,44) / Sims Pl (Blk 52,53) (246 cases as of 6 Sep 2016, of which 158 cases with onset in the last 2 weeks) 2 Bedok Nth Ave 2 (Blk 514) / Bedok Nth Ave 3 (404,507) / Bedok Nth St 3 (Blk 525) (4 cases as of 6 Sep 2016, of which 3 cases with onset in the last 2 weeks) 3 Joo Seng Rd (Blk 17, 18, 21) (3 cases as of 6 Sep 2016, of which 3 cases with onset in the last 2 weeks) 4 Bishan St 12 (Blk 122, 123) (2 Cases as of 6 Sep 2016, of which 2 cases with onset in the last 2 weeks) http://www.nea.gov.sg/public-health/vector-control/overview/zika-clusters
  22. Joint MOH-NEA statement (7 Sep 2016) Tags: News Highlights Joint MOH-NEA statement (7 September) 1. As of 12pm, 7 September, MOH has confirmed eight new cases of locally transmitted Zika virus infection in Singapore. Of these, two cases are linked to the Aljunied Crescent/ Sims Drive/ Kallang Way/ Paya Lebar Way cluster, and one case is linked to the Bishan Street 12 cluster. 2. There is a potential new cluster involving one previously reported case and a new case today. They both live in the Elite Terrace area. The other four cases have no known links to any existing cluster. Vector Control Update 3. NEA is continuing with vector control operations and outreach efforts in the cluster areas at Aljunied Crescent/ Sims Drive/ Paya Lebar Way/ Kallang Way/ Circuit Road/ Geylang East Central/ Geylang East Avenue 1, Bedok North Avenue, Joo Seng Road, and Bishan Street 12. As of 6 September 2016, a total of 150 breeding habitats have been found and destroyed in the cluster areas, of which 99 are from homes, and 51 from outdoor areas. 4. NEA will also be carrying out vector control operations and outreach efforts at Elite Terrace. 5. From 7 September 2016, members of the public can obtain updated information on Zika and details on current clusters at NEA’s website:www.nea.gov.sg/zika and www.nea.gov.sg/zika-clusters. 6. Aligned to our dengue control approach, NEA will continue to work with stakeholders and the community to reduce mosquito breeding, as vector control is key to reducing the transmission of Zika in the community. https://www.moh.gov.sg/content/moh_web/home/pressRoom/pressRoomItemRelease/2016/joint-moh-nea-statement--7-sep-2016-.html
  23. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  24. Last Update: Daily (5 pm EST) Total Human Cases Related to International Travel: 24 Locally Acquired Mosquito Borne Cases: 0 http://doh.dc.gov/publication/zika-virus-information

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.