Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. Apache Cochise Coconino Gila Graham Greenlee La Paz Maricopa Mohave Navajo Pima Pinal Santa Cruz Yavapai Yuma Unknown Total Confirmed 0 3 0 0 0 0 0 18 0 0 3 1 0 0 1 0 26 Probable 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 3 0 0 0 0 0 18 0 0 3 1 0 0 1 0 26 http://www.azdhs.gov/documents/preparedness/epidemiology-disease-control/mosquito-borne/zika/2016-stats.pdf
  2. Arizona's First Zika Case Recorded in Traveler, read the news release Travel-associated Zika cases confirmed in Arizona: 26
  3. niman replied to niman's topic in Arizona
    Arizona's First Zika Case Recorded in Traveler, read the news release Travel-associated Zika cases confirmed in Arizona: 26 Arizona Arboviral Handbook for Chikungunya, Dengue, & Zika Viruses
  4. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  5. Alabama Residents Tested for Zika Virus as of August 25, 2016 Number of Submissions Positive Test Results for Zika or Flavivirus, unspecified (likely Zika) 241 29 http://www.adph.org/mosquito/index.asp?id=7427
  6. Alabama Residents Tested for Zika Virus as of August 25, 2016 Number of Submissions Positive Test Results for Zika or Flavivirus, unspecified (likely Zika) 241 29 http://www.adph.org/mosquito/index.asp?id=7427
  7. Alabama Residents Tested for Zika Virus as of August 25, 2016 Number of Submissions Positive Test Results for Zika or Flavivirus, unspecified (likely Zika) 241 29
  8. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  9. County Cases Bell 4 Bexar 8 Brazos 1 Collin 3 Dallas 30 Denton 4 El Paso 2 Ellis 1 Fort Bend 6 Frio 1 Galveston 3 Gray 1 Grayson 1 Gregg 1 Hamilton 1 Harris 34 Jefferson 1 Lubbock 1 Matagorda 1 Medina 1 Midland 1 Palo Pinto 1 Randall 1 Tarrant 14 Travis 3 Val Verde 1 Walker 1 Williamson 3 Wise 1 Total 131 Dallas Pregnant Registry 12 Texas Preg Reg excl Dallas 34 Total 177
  10. Dominican Republic has 3 babies with birth defect from Zika Share on Facebook By: Staff The Associated Press Published on SANTO DOMINGO, Dominican Republic — The Dominican Republic has reported its first three cases of babies born with a birth defect linked to the mosquito-borne Zika virus. Health Ministry officials say three babies were born with the condition known as microcephaly. The babies were born in June and July but it took time to confirm the condition and the link to the Zika virus in the mothers. None of the mothers recalled having symptoms of Zika, which include fever, rash, joint pain and reddened eyes. Micrcocephaly is a defect in which a baby's head does not develop fully and is smaller than expected. Health Minister Altagracia Guzman urged women Thursday to avoid pregnancy for the rest of the year and through early 2017 due to the risks of Zika. http://www.metronews.ca/news/world/2016/08/25/dominican-republic-has-3-babies-with-birth-defect-from-zika.html
  11. Public Health confirms 3 cases of microcephaly associated with zika By: EFEFecha: August 25, 2016En: portada2 Comments SANTO DOMINGO, Dominican Republic.- The three babies born with microcephaly hospitals Independencia, Santo Domingo and the National District are related to zika, transmitted by the mosquito Aedes aegypti, the same dengue and chikungunya, inform this Thursday Ministry of Public Health. He explained in a statement that although the mothers of the babies said they had not submitted suspicious symptoms of the disease during pregnancy, one doctor who attended the birth documented in the clinical record a transient rash on the abdomen, compatible with zika, between the eighth and tenth week of pregnancy. Children born between June and July, according to the information. The report states that children were made them neurological, hearing and visual assessments did not provide evidence of other damage at discharge. Previously, he said, each case was applied test TORCH (toxoplasmosis, rubella, cytomegalovirus, herpes simplex and HIV), which were negative. Although most children born with microcephaly fail to show significant consequences, as a way to make early diagnosis of any additional pathology, the Dominican State through the National Health Service guarantees tutors the necessary facilities for these infants receive newspapers and recommended by the World Health Organization studies checkups. Public Health said that in compliance with Law 172-13, which guarantees full protection of personal data, refrain by the National Health Service and deconcentrated to provide information that might reveal the identity or location of newborns or its progenitor. On the other hand, the portfolio reported a significant decline in the epidemic curve of the disease by Zika virus, which has led to a significant reduction of cases in the country. He said that during the last eight weeks epidemiological the zika has registered a frank decline in suspected and confirmed cases. Measures to prevent zika the Ministry of Health cites control the mosquito population by permanent elimination of breeding grounds, the application of chlorine between the empty surface and the edge of the tanks and other containers of water for domestic use, keep tightly covered. wj / am http://almomento.net/salud-publica-confirma-tres-casos-de-microcefalia-relacionados-con-el-zika/237772?utm_source=twitterfeed&utm_medium=twitter
  12. MC Map Update https://www.google.com/maps/d/u/0/edit?mid=1RcVTrkYW6hax_iITjKUkEcBCVeI
  13. The three babies born with microcephaly hospitals Independencia, Santo Domingo and the National District are related to zika, transmitted by the mosquito Aedes aegypti, the same dengue and chikungunya, inform this Thursday Ministry of Public Health. He explained in a statement that although the mothers of the babies said they had not submitted suspicious symptoms of the disease during pregnancy, one doctor who attended the birth documented in the clinical record a transient rash on the abdomen, compatible with zika, between the eighth and tenth week of pregnancy. Children born between June and July, according to the information. http://almomento.net/salud-publica-confirma-tres-casos-de-microcefalia-relacionados-con-el-zika/237772?utm_source=twitterfeed&utm_medium=twitter
  14. Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 18498 18498 100% 0.0 99% KX247646.1 Select seq gb|KU820897.4| Zika virus isolate FLR polyprotein gene, complete cds 18489 18489 100% 0.0 99% KU820897.4 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 18489 18489 100% 0.0 99% KX087102.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 18453 18453 100% 0.0 99% KX198135.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 18444 18444 100% 0.0 99% KX156776.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 18438 18438 100% 0.0 99% KX156774.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 18435 18435 100% 0.0 99% KX156775.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 18411 18411 100% 0.0 99% KU647676.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 18408 18408 100% 0.0 99% KX548902.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 18393 18393 100% 0.0 99% KU922960.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 18390 18390 100% 0.0 99% KU922923.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 18381 18381 100% 0.0 99% KX447510.1 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 18375 18375 100% 0.0 99% KU991811.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 18372 18372 100% 0.0 99% KX447512.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 18372 18372 100% 0.0 99% KX369547.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 18372 18372 100% 0.0 99% KU509998.3 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 18366 18366 100% 0.0 99% KX447509.1 Select seq gb|KJ776791.1| Zika virus strain H/PF/2013 polyprotein gene, complete cds 18366 18366 100% 0.0 99% KJ776791.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 18363 18363 100% 0.0 99% KX447515.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 18363 18363 100% 0.0 99% KX447513.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 18357 18357 100% 0.0 99% KX447511.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 18357 18357 100% 0.0 99% KX280026.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 18357 18357 100% 0.0 99% KU707826.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 18357 18357 100% 0.0 99% KU365779.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 18357 18357 100% 0.0 99% KU321639.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 18354 18354 100% 0.0 99% KX447514.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 18354 18354 100% 0.0 99% KX051563.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 18348 18348 100% 0.0 99% KX447516.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 18348 18348 100% 0.0 99% KU729218.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 18345 18345 100% 0.0 99% KX262887.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 18345 18345 100% 0.0 99% KX197192.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 18345 18345 100% 0.0 99% KU365780.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 18341 18341 99% 0.0 99% KU497555.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 18339 18339 100% 0.0 99% KU365777.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 18336 18336 100% 0.0 99% KX694534.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 18336 18336 100% 0.0 99% KU758877.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 18336 18336 100% 0.0 99% KU926309.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 18330 18330 100% 0.0 99% KU940228.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 18327 18327 100% 0.0 99% KX447517.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 18327 18327 100% 0.0 99% KU501217.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 18327 18327 100% 0.0 99% KU365778.1 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 18327 18327 100% 0.0 99% KU312312.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 18321 18321 100% 0.0 99% KU729217.2 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 18321 18321 100% 0.0 99% KU527068.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 18321 18321 100% 0.0 99% KU501216.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 18318 18318 100% 0.0 99% KX247632.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 18318 18318 100% 0.0 99% KU937936.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 18318 18318 100% 0.0 99% KU926310.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 18318 18318 100% 0.0 99% KU501215.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 18312 18312 100% 0.0 99% KX601168.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 18312 18312 100% 0.0 99% KX520666.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 18312 18312 100% 0.0 99% KX087101.2 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 18309 18309 100% 0.0 99% KX446951.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 18309 18309 100% 0.0 99% KX377337.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 18309 18309 100% 0.0 99% KU820898.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 18303 18303 100% 0.0 99% KX446950.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 18303 18303 100% 0.0 99% KU870645.1 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 18300 18300 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 18298 18298 100% 0.0 99% KU853012.1 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 18294 18294 100% 0.0 99% KX056898.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 18294 18294 100% 0.0 99% KU955590.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 18291 18291 100% 0.0 99% KU740184.2 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 18291 18291 100% 0.0 99% KU761564.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 18276 18276 100% 0.0 99% KX673530.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 18276 18276 100% 0.0 99% KX117076.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 18267 18267 100% 0.0 99% KX185891.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 18267 18267 100% 0.0 99% KU963796.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 18264 18264 100% 0.0 99% KX253996.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 18264 18264 100% 0.0 99% KU955589.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 18264 18264 100% 0.0 99% KU820899.2 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 18260 18260 100% 0.0 99% KX266255.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 18258 18258 100% 0.0 99% KU866423.2 Select seq gb|KU940224.1| Zika virus isolate Bahia09, partial genome 18236 18236 99% 0.0 99% KU940224.1 Select seq gb|KU744693.1| Zika virus isolate VE_Ganxian, complete genome 18141 18141 100% 0.0 99% KU744693.1 Select seq gb|KU681081.3| Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome 18033 18033 100% 0.0 99% KU681081.3 Select seq gb|KX694532.1| Zika virus strain ZIKV/Homo sapiens/THA/PLCal_ZV/2013, complete genome 17924 17924 100% 0.0 99% KX694532.1 Select seq gb|KU955593.1| Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome 17726 17726 100% 0.0 98% KU955593.1 Select seq gb|JN860885.1| Zika virus isolate FSS13025 polyprotein gene, partial cds 17726 17726 99% 0.0 98% JN860885.1 Select seq gb|KF993678.1| Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds 17694 17694 98% 0.0 99% KF993678.1 Select seq gb|EU545988.1| Zika virus polyprotein gene, complete cds 17571 17571 100% 0.0 98% EU545988.1 Select seq gb|KU681082.3| Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome 17420 17420 100% 0.0 98% KU681082.3 Select seq gb|KX601167.1| Zika virus strain ZIKV/Aedes sp./MYS/P6-740/1966, complete genome 16424 16424 100% 0.0 95% KX601167.1 Select seq gb|KX694533.1| Zika virus strain ZIKV/Aedes aegypti/MYS/P6-740/1966, complete genome 16415 16415 100% 0.0 95% KX694533.1 Select seq gb|HQ234499.1| Zika virus isolate P6-740 polyprotein gene, partial cds 16415 16415 99% 0.0 95% HQ234499.1 Select seq gb|KX377336.1| Zika virus strain P6-740, complete genome 16410 16410 100% 0.0 95% KX377336.1 Select seq gb|KX447518.1| Zika virus isolate 1_0117_PF polyprotein gene, partial cds 16211 16211 88% 0.0 99% KX447518.1 Select seq gb|KF383115.1| Zika virus strain ArB1362 polyprotein gene, complete cds 13306 13306 100% 0.0 89% KF383115.1 Select seq gb|KF268949.1| Zika virus isolate ARB15076 polyprotein gene, complete cds 13297 13297 100% 0.0 89% KF268949.1 Select seq gb|KF268948.1| Zika virus isolate ARB13565 polyprotein gene, complete cds 13297 13297 100% 0.0 89% KF268948.1 Select seq gb|KU720415.1| Zika virus strain MR 766 polyprotein gene, complete cds 13290 13290 100% 0.0 89% KU720415.1 Select seq gb|KF268950.1| Zika virus isolate ARB7701 polyprotein gene, complete cds 13290 13290 100% 0.0 89% KF268950.1 Select seq gb|HQ234498.1| Zika virus isolate MR_766 polyprotein gene, partial cds 13284 13284 99% 0.0 89% HQ234498.1 Select seq gb|KU955595.1| Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome 13281 13281 100% 0.0 89% KU955595.1 Select seq gb|KX377335.1| Zika virus strain MR-766, complete genome 13277 13277 100% 0.0 89% KX377335.1 Select seq gb|DQ859059.1| Zika virus strain MR 766 polyprotein gene, complete cds 13275 13275 100% 0.0 89% DQ859059.1 Select seq gb|KU955592.1| Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome 13272 13272 100% 0.0 89% KU955592.1 Select seq gb|KF383119.1| Zika virus strain ArD158084 polyprotein gene, complete cds 13272 13272 100% 0.0 89% KF383119.1 Select seq dbj|LC002520.1| Zika virus genomic RNA, complete genome, strain: MR766-NIID 13268 13268 100% 0.0 89% LC002520.1 Select seq gb|KX198134.1| Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome 13259 13738 100% 0.0 89% KX198134.1 Select seq gb|KU955591.1| Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome 13254 13254 100% 0.0 89% KU955591.1 Select seq gb|KX601169.1| Zika virus strain ZIKV/Macaca mulatta/UGA/MR-766/1947, complete genome 13252 13252 100% 0.0 89% KX601169.1 Select seq gb|KU963573.1| Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds 13252 13252 100% 0.0 89% KU963573.1 Select seq gb|KU955594.1| Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome 13252 13252 100% 0.0 89% KU955594.1 Select seq gb|KF383116.1| Zika virus strain ArD7117 polyprotein gene, complete cds 13239 13239 100% 0.0 89% KF383116.1 Select seq gb|HQ234501.1| Zika virus isolate ArD_41519 polyprotein gene, partial cds 13223 13223 99% 0.0 89% HQ234501.1 Select seq gb|AY632535.2| Zika virus strain MR 766, complete genome 13209 13209 100% 0.0 89% AY632535.2 Select seq gb|KX601166.1| Zika virus strain ZIKV/Aedes africanus/SEN/DakAr41524/1984, complete genome 13198 13198 100% 0.0 88% KX601166.1 Select seq gb|KF383117.1| Zika virus strain ArD128000 polyprotein gene, complete cds 13155 13155 100% 0.0 88% KF383117.1 Select seq gb|KU963574.1| Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds 13140 13248 100% 0.0 88% KU963574.1 Select seq gb|HQ234500.1| Zika virus isolate IbH_30656 polyprotein gene, partial cds 13138 13138 99% 0.0 88% HQ234500.1 Select seq gb|KF383118.1| Zika virus strain ArD157995 polyprotein gene, complete cds 12949 13017 100% 0.0 88% KF383118.1 Select seq gb|KF383121.1| Zika virus strain ArD158095 polyprotein gene, partial cds 12870 12870 97% 0.0 89% KF383121.1 Select seq gb|KX447520.1| Zika virus isolate 1_0016_PF polyprotein gene, partial cds 11490 15810 86% 0.0 99% KX447520.1 Select seq gb|KX576684.1| Zika virus vector pZIKV-ICD, complete sequence 10931 18358 100% 0.0 99% KX576684.1 Select seq gb|KF383120.1| Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence 10862 10862 97% 0.0 84% KF383120.1 Select seq gb|KX447519.1| Zika virus isolate 1_0199_PF polyprotein gene, partial cds 10024 16083 87% 0.0 99% KX447519.1 Select seq gb|KX447521.1| Zika virus isolate 1_0080_PF polyprotein gene, partial cds 9822 14966 81% 0.0 99% KX447521.1 Select seq gb|KU940227.1| Zika virus isolate Bahia08, partial genome 5029 14417 87% 0.0 95% KU940227.1 Select seq gb|KX212103.1| Zika virus isolate BRZIKV_AB_ES polyprotein gene, partial cds 4998 4998 27% 0.0 99% KX212103.1 Select seq gb|KU758875.1| Zika virus isolate 15042 polyprotein gene, partial cds 4960 4960 27% 0.0 99% KU758875.1 Select seq gb|KU758871.1| Zika virus isolate 17170 polyprotein gene, partial cds 4956 4956 27% 0.0 99% KU758871.1 Select seq gb|KU758870.1| Zika virus isolate 17160 polyprotein gene, partial cds 4949 4949 27% 0.0 99% KU758870.1 Select seq gb|KU312314.1| Zika virus isolate Z1106031 polyprotein gene, partial cds 4949 4949 27% 0.0 99% KU312314.1 Select seq gb|KU758873.1| Zika virus isolate 18246 polyprotein gene, partial cds 4947 4947 27% 0.0 99% KU758873.1 Select seq gb|KU758872.1| Zika virus isolate 01170 polyprotein gene, partial cds 4935 4935 27% 0.0 99% KU758872.1 Select seq gb|KU758876.1| Zika virus isolate 21068 polyprotein gene, partial cds 4924 4924 27% 0.0 99% KU758876.1 Select seq gb|KU312313.1| Zika virus isolate Z1106032 polyprotein gene, partial cds 4922 4922 27% 0.0 99% KU312313.1 Select seq gb|KU758869.1| Zika virus isolate 05211 polyprotein gene, partial cds 4913 4913 26% 0.0 99% KU758869.1 Select seq gb|KU758868.1| Zika virus isolate 27229 polyprotein gene, partial cds 4888 4888 26% 0.0 99% KU758868.1 Select seq gb|KU758874.1| Zika virus isolate 20114 polyprotein gene, partial cds 4884 4884 26% 0.0 99% KU758874.1 Select seq gb|KU646828.1| Zika virus isolate Si322 polyprotein gene, partial cds 4664 4664 25% 0.0 99% KU646828.1 Select seq gb|KU646827.1| Zika virus isolate Si323 polyprotein gene, partial cds 4664 4664 25% 0.0 99% KU646827.1 Select seq gb|KX101060.1| Zika virus isolate Bahia02, partial genome 4226 13295 75% 0.0 95% KX101060.1 Select seq gb|KU312315.1| Zika virus isolate Z1106027 polyprotein gene, partial cds 3431 3431 18% 0.0 99% KU312315.1 Select seq gb|KU740199.1| Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds 3205 3205 17% 0.0 99% KU740199.1 Select seq gb|KX101066.1| Zika virus isolate Bahia01, partial genome 3113 13092 74% 0.0 99% KX101066.1 Select seq gb|DQ859064.1| Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds 2852 4159 95% 0.0 71% DQ859064.1 Select seq gb|KJ634273.1| Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds 2686 2686 14% 0.0 99% KJ634273.1 Select seq dbj|LC171327.1| Zika virus gene for polyprotein, partial cds, strain: ZIKV/Hu/Chiba/S36/2016 2682 2682 14% 0.0 99% LC171327.1 Select seq gb|KX101064.1| Zika virus isolate Bahia11, partial genome 2253 10777 65% 0.0 92% KX101064.1 Select seq gb|KU686218.1| Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds 2060 2060 11% 0.0 99% KU686218.1 Select seq gb|KU179098.1| Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds 2021 2021 11% 0.0 99% KU179098.1 Select seq gb|KU886298.1| Zika virus isolate MN NS5 gene, partial cds 1867 1867 10% 0.0 99% KU886298.1 Select seq gb|KX101061.1| Zika virus isolate Bahia03, partial genome 1840 13871 78% 0.0 99% KX101061.1 Select seq gb|KX059014.1| Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds 1838 1838 9% 0.0 99% KX059014.1 Select seq gb|KX059013.1| Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds 1838 1838 9% 0.0 99% KX059013.1 Select seq gb|KM078936.1| Zika virus strain CHI1410214 NS5 protein gene, partial cds 1752 1752 9% 0.0 99% KM078936.1 Select seq gb|KM078961.1| Zika virus strain CHI2612114 NS5 protein gene, partial cds 1748 1748 9% 0.0 99% KM078961.1 Select seq gb|KM078930.1| Zika virus strain CHI2283714 NS5 protein gene, partial cds 1746 1746 9% 0.0 99% KM078930.1 Select seq gb|KM078971.1| Zika virus strain CHI2613014 NS5 protein gene, partial cds 1745 1745 9% 0.0 99% KM078971.1 Select seq gb|KM078970.1| Zika virus strain CHI2490414 NS5 protein gene, partial cds 1745 1745 9% 0.0 99% KM078970.1 Select seq gb|KM078933.1| Zika virus strain CHI1058514 NS5 protein gene, partial cds 1745 1745 9% 0.0 99% KM078933.1 Select seq gb|KM078929.1| Zika virus strain CHI1805214 NS5 protein gene, partial cds 1743 1743 9% 0.0 99% KM078929.1 Select seq gb|KX173841.1| Zika virus isolate 16Z11 envelope protein gene, partial cds 1645 1645 9% 0.0 99% KX173841.1 Select seq gb|KX173840.1| Zika virus isolate 16Z10 envelope protein gene, partial cds 1645 1645 9% 0.0 99% KX173840.1 Select seq gb|KJ873160.1| Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds 1602 1602 8% 0.0 99% KJ873160.1 Select seq gb|KX173843.1| Zika virus isolate 16Z62 envelope protein gene, partial cds 1514 1514 8% 0.0 99% KX173843.1 Select seq gb|KX173844.1| Zika virus isolate 16Z62 envelope protein gene, partial cds 1503 1503 8% 0.0 99% KX173844.1 Select seq gb|KJ873161.1| Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds 1420 1420 7% 0.0 99% KJ873161.1 Select seq gb|KM851039.1| Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds 1382 1382 7% 0.0 99% KM851039.1 Select seq gb|KU985087.1| Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds 1353 1353 7% 0.0 99% KU985087.1 Select seq gb|KU556802.1| Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds 1346 1346 7% 0.0 99% KU556802.1 Select seq gb|KM851038.1| Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds 1346 1346 7% 0.0 98% KM851038.1 Select seq gb|AF013415.1| Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds 1315 1315 10% 0.0 88% AF013415.1 Select seq gb|KU724096.1| Zika virus isolate 259249_2015_Panama NS5B gene, partial cds 1310 1310 7% 0.0 100% KU724096.1 Select seq gb|KU232300.1| Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds 1240 1240 6% 0.0 99% KU232300.1 Select seq gb|KT200609.1| Zika virus isolate BR/949/15 NS5 gene, partial cds 1240 1240 6% 0.0 99% KT200609.1 Select seq gb|KU232290.1| Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds 1231 1231 6% 0.0 99% KU232290.1 Select seq gb|KU232297.1| Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds 1229 1229 6% 0.0 99% KU232297.1 Select seq gb|KU232294.1| Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds 1220 1220 6% 0.0 99% KU232294.1 Select seq gb|KU232292.1| Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds 1218 1218 6% 0.0 99% KU232292.1 Select seq gb|KU232298.1| Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds 1214 1214 6% 0.0 99% KU232298.1 Select seq gb|KU232296.1| Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds 1211 1211 6% 0.0 99% KU232296.1 Select seq gb|KU232293.1| Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds 1211 1211 6% 0.0 99% KU232293.1 Select seq gb|KU232295.1| Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds 1205 1205 6% 0.0 99% KU232295.1 Select seq gb|KU232288.1| Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds 1195 1195 6% 0.0 99% KU232288.1 Select seq gb|KU232289.1| Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds 1191 1191 6% 0.0 99% KU232289.1 Select seq gb|KU232299.1| Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds 1187 1187 6% 0.0 99% KU232299.1 Select seq gb|KU232291.1| Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds 1186 1186 6% 0.0 99% KU232291.1 Select seq gb|KX101065.1| Zika virus isolate Bahia15, partial genome 1184 7780 46% 0.0 99% KX101065.1 Select seq gb|KU724097.1| Zika virus isolate 259250_2015_Panama NS5B gene, partial cds 1178 1178 6% 0.0 100% KU724097.1 Select seq gb|KX101063.1| Zika virus isolate Bahia05, partial genome 1177 7438 42% 0.0 99% KX101063.1 Select seq gb|KU724098.1| Zika virus isolate 259060_2015_Panama NS5B gene, partial cds 1166 1166 6% 0.0 99% KU724098.1 Select seq gb|KU758878.1| Zika virus polyprotein gene, partial cds 1124 1124 6% 0.0 98% KU758878.1 Select seq gb|KU724099.1| Zika virus isolate 259032_2015_Panama NS5B gene, partial cds 1101 1101 5% 0.0 99% KU724099.1 Select seq gb|KF270886.1| Zika virus strain CCB-870 envelope glycoprotein gene, partial cds 1077 1077 8% 0.0 89% KF270886.1 Select seq gb|KX101062.1| Zika virus isolate Bahia04, partial genome 1049 7316 41% 0.0 97% KX101062.1 Select seq gb|AF372422.1|AF372422 Zika virus envelope protein (E) gene, partial cds 1020 1020 8% 0.0 87% AF372422.1 Select seq gb|KU867812.1| Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds 1018 1018 5% 0.0 100% KU867812.1 Select seq gb|KF270887.1| Zika virus strain CCB-870 NS3 protein gene, partial cds 1000 1000 7% 0.0 89% KF270887.1 Select seq gb|KF383022.1| Zika virus strain ArD127988 envelope protein gene, partial cds 980 980 7% 0.0 89% KF383022.1 Select seq gb|KF383026.1| Zika virus strain ArD127994 envelope protein gene, partial cds 975 975 7% 0.0 89% KF383026.1 Select seq gb|EU303241.1| Zika virus note MR766 (p4 15/9/76) nonstructural protein 5 (NS5) gene, partial cds 971 971 7% 0.0 88% EU303241.1 Select seq gb|KF383032.1| Zika virus strain ArD30101 envelope protein gene, partial cds 966 966 7% 0.0 88% KF383032.1 Select seq gb|KF383034.1| Zika virus strain ArD30156 envelope protein gene, partial cds 962 962 7% 0.0 88% KF383034.1 Select seq gb|KF383029.1| Zika virus strain ArD165522 envelope protein gene, partial cds 962 962 7% 0.0 88% KF383029.1 Select seq gb|KF383037.1| Zika virus strain ArA506 envelope protein gene, partial cds 960 960 7% 0.0 88% KF383037.1 Select seq gb|KF383036.1| Zika virus strain ArA975 envelope protein gene, partial cds 957 957 7% 0.0 88% KF383036.1 Select seq gb|KF383033.1| Zika virus strain AnD30332 envelope protein gene, partial cds 957 957 7% 0.0 88% KF383033.1 Select seq gb|KU724100.1| Zika virus isolate 259043_2015_Panama NS5B gene, partial cds 944 944 5% 0.0 99% KU724100.1 Select seq gb|KF383039.1| Zika virus strain HD78788 envelope protein gene, partial cds 939 939 7% 0.0 88% KF383039.1 Select seq gb|KF383028.1| Zika virus strain ArD165531 envelope protein gene, partial cds 939 939 7% 0.0 88% KF383028.1 Select seq gb|KF383031.1| Zika virus strain ArD9957 envelope protein gene, partial cds 935 935 7% 0.0 88% KF383031.1 Select seq gb|KF383038.1| Zika virus strain ArA986 envelope protein gene, partial cds 930 930 7% 0.0 87% KF383038.1 Select seq gb|KF383046.1| Zika virus strain ArA982 envelope protein gene, partial cds 921 921 7% 0.0 87% KF383046.1 Select seq gb|KF383103.1| Zika virus strain ArA986 nonstructural protein 5 gene, partial cds 906 906 6% 0.0 88% KF383103.1 Select seq gb|KF383086.1| Zika virus strain ArA975 nonstructural protein 5 gene, partial cds 906 906 6% 0.0 88% KF383086.1 Select seq gb|KF383045.1| Zika virus strain ArA27106 envelope protein gene, partial cds 906 906 7% 0.0 87% KF383045.1 Select seq gb|KF383043.1| Zika virus strain ArA27443 envelope protein gene, partial cds 902 902 7% 0.0 87% KF383043.1 Select seq gb|KF383035.1| Zika virus strain MR1429 envelope protein gene, partial cds 901 901 7% 0.0 86% KF383035.1 Select seq gb|KF383041.1| Zika virus strain ArA27290 envelope protein gene, partial cds 897 897 7% 0.0 87% KF383041.1 Select seq gb|KF383042.1| Zika virus strain ArA27096 envelope protein gene, partial cds 893 893 7% 0.0 86% KF383042.1 Select seq gb|KF383104.1| Zika virus strain ArA982 nonstructural protein 5 gene, partial cds 874 874 6% 0.0 87% KF383104.1 Select seq gb|KF383085.1| Zika virus strain ArD9957 nonstructural protein 5 gene, partial cds 874 874 6% 0.0 87% KF383085.1 Select seq gb|KF383106.1| Zika virus strain ArA27443 nonstructural protein 5 gene, partial cds 870 870 6% 0.0 87% KF383106.1 Select seq gb|KX247638.1| Zika virus isolate Dominican_Rep-Rus-3-2016 polyprotein gene, partial cds 868 868 4% 0.0 99% KX247638.1 Select seq gb|KF383040.1| Zika virus strain ArA27101 envelope protein gene, partial cds 866 866 7% 0.0 86% KF383040.1 Select seq gb|KU978616.1| Zika virus isolate Dominican_Rep-Rus-2-2016 polyprotein gene, partial cds 865 865 4% 0.0 99% KU978616.1 Select seq gb|KF383114.1| Zika virus strain AnD30332 nonstructural protein 5 gene, partial cds 865 865 6% 0.0 87% KF383114.1 Select seq gb|KF383107.1| Zika virus strain ArA27407 nonstructural protein 5 gene, partial cds 865 865 6% 0.0 87% KF383107.1 Select seq gb|KF383088.1| Zika virus strain ArD30101 nonstructural protein 5 gene, partial cds 865 865 6% 0.0 87% KF383088.1 Select seq gb|KF383087.1| Zika virus strain ArD30156 nonstructural protein 5 gene, partial cds 861 861 6% 0.0 87% KF383087.1 Select seq gb|KX101067.1| Zika virus isolate Bahia12, partial genome 854 8490 51% 0.0 89% KX101067.1 Select seq gb|KF383089.1| Zika virus strain ArD165531 nonstructural protein 5 gene, partial cds 847 847 6% 0.0 87% KF383089.1 Select seq gb|KF383101.1| Zika virus strain ArD127710 nonstructural protein 5 gene, partial cds 843 843 6% 0.0 86% KF383101.1 Select seq gb|KF383097.1| Zika virus strain ArD127994 nonstructural protein 5 gene, partial cds 843 843 6% 0.0 86% KF383097.1 Select seq gb|KF383099.1| Zika virus strain ArD127987 nonstructural protein 5 gene, partial cds 838 838 6% 0.0 86% KF383099.1 Select seq gb|KF383098.1| Zika virus strain ArD127988 nonstructural protein 5 gene, partial cds 834 834 6% 0.0 86% KF383098.1 Select seq gb|KU872850.1| Zika virus isolate Dominican Rep-Rus-2016, NS2 partial cds 823 823 4% 0.0 99% KU872850.1 Select seq dbj|AB908162.1| Zika virus gene for polyprotein, partial cds, strain: ZIKV Hu/Tahiti/01u/2014NIID 820 820 4% 0.0 99% AB908162.1 Select seq gb|KX253994.1| Zika virus strain ZIKV/Homo sapiens/GER/GER-BNI-P2/2016 polyprotein gene, partial cds 807 807 4% 0.0 100% KX253994.1 Select seq gb|KF383084.1| Zika virus strain HD78788 nonstructural protein 5 gene, partial cds 807 807 6% 0.0 85% KF383084.1 Select seq gb|KF383113.1| Zika virus strain ArA1465 nonstructural protein 5 gene, partial cds 801 801 6% 0.0 85% KF383113.1 Select seq gb|KF383017.1| Zika virus strain ArD149938 envelope protein gene, partial cds 717 717 7% 0.0 81% KF383017.1 Select seq gb|KF383016.1| Zika virus strain ArD147917 envelope protein gene, partial cds 713 713 7% 0.0 81% KF383016.1 Select seq gb|KF383015.1| Zika virus strain ArD149810 envelope protein gene, partial cds 713 713 7% 0.0 81% KF383015.1 Select seq gb|KF383020.1| Zika virus strain ArA1465 envelope protein gene, partial cds 708 708 7% 0.0 81% KF383020.1 Select seq gb|KF383021.1| Zika virus strain ArD132912 envelope protein gene, partial cds 706 706 7% 0.0 81% KF383021.1 Select seq gb|KF258813.1| Zika virus isolate Java non-structural protein 5 mRNA, partial cds 693 693 3% 0.0 98% KF258813.1 Select seq gb|KF383019.1| Zika virus strain ArD132915 envelope protein gene, partial cds 690 690 7% 0.0 80% KF383019.1 Select seq gb|KX253995.1| Zika virus strain ZIKV/Homo sapiens/PRI/PRI-BNI-P1/2016 polyprotein gene, partial cds 681 681 3% 0.0 100% KX253995.1 Select seq gb|KF383092.1| Zika virus strain ArD147917 nonstructural protein 5 gene, partial cds 664 664 6% 0.0 81% KF383092.1 Select seq gb|KF383093.1| Zika virus strain ArD149810 nonstructural protein 5 gene, partial cds 663 663 6% 0.0 81% KF383093.1 Select seq gb|KF383095.1| Zika virus strain ArD132915 nonstructural protein 5 gene, partial cds 657 657 6% 0.0 81% KF383095.1 Select seq gb|KF383091.1| Zika virus strain ArD149938 nonstructural protein 5 gene, partial cds 654 654 6% 0.0 80% KF383091.1 Select seq gb|KU985088.1| Zika virus isolate MEX/InDRE/Zika-2/2015 envelope protein gene, partial cds 636 636 3% 4e-177 99% KU985088.1 Select seq gb|KX062045.1| Zika virus isolate Haiti/1230/2014 envelope protein gene, partial cds 630 630 3% 2e-175 100% KX062045.1 Select seq gb|KX062044.1| Zika virus isolate Haiti/1227/2014 envelope protein gene, partial cds 625 625 3% 8e-174 99% KX062044.1 Select seq gb|KR815989.1| Zika virus isolate 15095 envelope protein gene, partial cds 587 587 3% 2e-162 99% KR815989.1 Select seq gb|KX173842.1| Zika virus isolate 16Z08 envelope protein gene, partial cds 580 580 3% 3e-160 99% KX173842.1
  15. LOCUS KX702400 10808 bp cRNA linear VRL 24-AUG-2016 DEFINITION Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome. ACCESSION KX702400 VERSION KX702400.1 GI:1057445801 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10808) AUTHORS Blohm,G.M., Paniz Mondolfi,A.E., Puliam,J.R.C., Morris,J.G. Jr., Bonny,T.S., Loeb,J.C., Pacheco,C., Marquez,M. and Lednicky,J.A. TITLE Viable Zika virus in the breast milk of a lactating woman with acute signs and symptoms of Zika Fever in Venezuela in 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10808) AUTHORS Blohm,G.M., Paniz Mondolfi,A.E., Puliam,J.R.C., Morris,J.G. Jr., Bonny,T.S., Loeb,J.C., Pacheco,C., Marquez,M. and Lednicky,J.A. TITLE Direct Submission JOURNAL Submitted (15-AUG-2016) Environmental and Global Health, University of Florida - Gainesville, 1225 Center Drive, Room 4155, Gainesville, FL 32610, USA COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10808 /organism="Zika virus" /mol_type="viral cRNA" /strain="Zika virus/Homo sapiens/VEN/UF-1/2016" /isolation_source="whole breast milk, and separated fat and liquid components" /host="Homo sapiens; lactating female with acute symptoms" /db_xref="taxon:64320" /country="Venezuela: Barquisimeto" /collection_date="25-Mar-2016" /collected_by="Alberto E. Paniz Mondolfi" /identified_by="Gabriela Blohm and John Lednicky" /note="passage details: LLC-MK2 cells, passage 1" 5'UTR 1..107 CDS 108..10379 /codon_start=1 /product="polyprotein" /protein_id="AOE22997.1" /db_xref="GI:1057445802" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKDAMEIIKKFKKDLAAMLRIINARKEKK RRGAETSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSPTASGRVIEEWCCRECTMPPLSFWAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" 3'UTR 10380..10808 ORIGIN 1 agttgttact gttgctgact cagactgcga cagttcgagt ttgaagcgaa agctagcaac 61 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa 121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga 181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca 241 ggatggtctt ggcgattcta gcctttttga gattcacggc aatcaagcca tcactgggtc 301 tcatcaatag atggggttca gtggggaaaa aagatgctat ggaaataata aagaagttca 361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag 421 gcgcagaaac tagtgtcgga attgttggcc tccttctgac cacagctatg gcagcggagg 481 tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct ggggaggcca 541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac 601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag 661 atgacgtcga ttgttggtgc aacacgacgt caacttgggt tgtgtacgga acctgccatc 721 acaaaaaagg tgaagcacgg agatctagaa gagccgtgac gctcccctcc cattccacta 781 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcacttga 841 ttagagtcga aaattggata ttcaggaacc ctggtttcgc tttagcagca gctgccatcg 901 cttggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga 961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta 1021 tgtcaggtgg gacttgggtt gatgtcgtct tggaacatgg aggttgtgtc accgtaatgg 1081 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg 1141 aggtaagatc ctactgctat gaggcatcaa tatcagacat ggcttcggac agccgctgcc 1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtt tgcaaaagaa 1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga 1321 catgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc 1381 tggagtaccg gataatgttg tcagttcatg gctcccagca cagtgggatg attgttaatg 1441 acacaggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa 1501 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag 1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggttcaca 1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac 1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg 1741 tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga gctctggagg 1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa 1861 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca 1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga 1981 cagatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact ctgaccccag 2041 ttgggaggtt gataaccgct aaccccgtaa tcactgaaag cactgagaac tctaagatga 2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga 2161 agatcaccca ccactggcac aggagtggca gcaccattgg aaaagcattt gaagccactg 2221 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg 2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat 2341 cattgtttgg aggaatgtcc tggttctcac aaattctcat tggaacgttg ctgatgtggt 2401 tgggtctgaa cacaaagaat ggatctattt cccttatgtg cttggcctta gggggagtgt 2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga 2521 aggagacgag atgtggtaca ggggtgttcg tctataacga cgttgaagcc tggagggaca 2581 ggtacaagta ccatcctgac tccccccgta gattggcagc agcagtcaag caagcctggg 2641 aagatggtat ctgcgggatc tcctctgttt caagaatgga aaacatcatg tggagatcag 2701 tagaagggga gctcaacgca atcctggaag agaatggagt tcaactgacg gtcgttgtgg 2761 gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct gtgaacgagc 2821 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt cagagcagca aagacaaata 2881 acagctttgt cgtggatggt gacacactga aagaatgccc actcaaacat agagcatgga 2941 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg 3001 ttagagaaga ttattcatta gagtgtgatc cagccgttat tggaacagct gttaagggaa 3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga 3121 ggctgaagag ggcccatctg atcgagatga aaacatgtga atggccaaag tcccacacat 3181 tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttta gctgggccac 3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg 3301 aagagcttga aattcggttt gaggaatgcc caggcactaa ggtccacgtg gaggaaacat 3361 gtggaacaag aggaccatct ctgagatcac ccactgcaag cggaagggtg atcgaggaat 3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttctg ggctaaagat ggctgttggt 3481 atggaatgga gataaggccc aggaaagaac cagaaagcaa cttagtaagg tcaatggtga 3541 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca 3601 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcaatgg 3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa 3721 tcttgatggg tgccaccttc gcggaaatga acactggagg agatgtagct catctggcgc 3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc cttcatcttc agagctaatt 3841 ggacaccccg tgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct 3901 ccgccttgga gggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa 3961 tacgagcgat ggttgttcca cgcactgaca acatcacctt ggcaatcctg gctgctctga 4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg 4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca 4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt 4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc 4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg 4321 ccgcggttgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca 4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc 4441 ggctcgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc 4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag 4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggtg 4621 cgctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt 4681 acagagtaat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag 4741 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag 4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat 4861 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg 4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca 4981 ttggagcggt tgcgctggat tacccagcag gaacttcagg atctccaatc ctagacaagt 5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg agttatgtta 5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga 5161 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga 5221 gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact gtgatcttag 5281 ctccaaccag ggttgtcgct gctgaaatgg aggaagccct tagagggctt ccagtgcgtt 5341 atatgacaac agcagtcaat gtcacccact ctggaacaga aatcgtcgac ttaatgtgcc 5401 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtata 5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcaa 5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc 5581 gtgacgcatt tccggactcc aactcaccaa ttatggacac cgaagtggaa gtcccagaga 5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg 5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg 5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt 5821 gggactttgt cgtgacaact gacatttcag agatgggcgc caactttaaa gctgaccgtg 5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattctgg 5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga 6001 atcccaataa acctggagat gagtatctgt atggaggtgg gtgcgcagag actgacgaag 6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc 6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca 6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg 6241 tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga agatggtgct 6301 ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag gtgtggacca 6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc 6421 atgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag 6481 tgatggaagc cctgggaaca ctgccaggac acatgacaga gagattccag gaagccattg 6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg 6601 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgt 6661 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg 6721 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg 6781 catgtgtcct cattgttgtg ttcctattgc tggtggtgct catacctgag ccagaaaagc 6841 aaagatctcc ccaggacaac caaatggcaa tcatcatcat ggtagcagta ggtcttctgg 6901 gcttgattac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc 6961 taatgggaag gagagaggag ggggcaacca taggattctc aatggacatt gacctgcggc 7021 cagcctcagc ttgggccatc tatgctgcct tgacaacttt cattacccca gccgtccaac 7081 atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg caagctggag 7141 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc 7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc 7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc 7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg 7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca 7441 tagcagtagc cgtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg 7501 gggccctgat cacagccgca acttccactt tgtgggaagg ctctccgaac aagtactgga 7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt 7621 ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag 7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct 7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca 7801 aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt 7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag 7921 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa 7981 aaggaggccc tggtcatgaa gaacccgtgt tggtgcaaag ctatgggtgg aatatagtcc 8041 gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt 8101 gtgacatagg tgagtcatca tctagtcctg aagtggaaga agcacggacg ctcagagtcc 8161 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt 8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag 8281 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag 8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg 8401 acgggcctag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg 8461 ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga 8521 tccgcagtga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg 8581 cttaccatgg aagctatgag gcccccacac aagggtcagc gtcctctcta ataaacgggg 8641 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga 8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc 8761 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag 8821 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc aacaaggtgc 8881 gtagcaatgc agcattaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg 8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga 9001 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg 9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc 9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag 9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc 9241 gcataccagg aggaaggatg tatgcagatg acactgctgg ctgggacacc cgcattagca 9301 ggtttgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg cacagggcct 9361 tggcattggc cataatcaag tacacatacc aaaacaaagt ggtaaaggtc cttagaccag 9421 ctgaaaaagg gaaaacagtt atggacatta tttcgagaca agaccaaagg gggagcggac 9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggaata 9541 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag 9601 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag 9661 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg 9721 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact 9781 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt 9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag 9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc 9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg 10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat 10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc 10141 acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg ggaaaaaggg 10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca 10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag tacatggact 10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctgga gtgctgtaag 10381 caccaatctt aatgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc 10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg 10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca 10561 cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg 10621 ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt agaggagacc 10681 ccccggaaaa cgcaaaacag catattgacg ctgggaaaga ccagagactc catgagtttc 10741 caccacgctg gccgccaggc acagatcgcc gaatagcggc ggccggtgtg gggaaatcca 10801 tgggtctt
  16. University of Florida released full 2016 Venezuela sequence from milk from lactating mother.
  17. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  18. FDA says blood banks in 11 states, including California, must test for Zika by September The battle to contain the Zika virus is now expanding to protect the nation's blood supply. The U.S. Food and Drug Administration announced new blood bank guidelines Friday nationwide. POSTED:AUG 26 2016 10:54PM PDT UPDATED:AUG 26 2016 10:54PM PDT SAN FRANCISCO (KTVU) - The federal government is taking action to prevent the Zika virus from entering the nation's blood supply. The U.S. Food and Drug Administration announced Friday that blood banks nationwide should begin screening all donated blood units for the Zika virus within three months. "We're recommending testing of donated blood throughout the United States and its territories. We're taking this step to further enhance the safety of the blood supply," said Dr. Peter Marks, a U.S. Food and Drug Administration spokesman. FDA says blood banks in 11 states, including California, must test for Zika by September California is one of eleven states facing an earlier deadline to implement testing by the end of September. Those states are Alabama, Arizona, California, Georgia, Hawaii, Louisiana, Mississippi, New Mexico, New York, South Carolina and Texas. Most of those states are close to Florida or Mexico where the Zika virus has been spread by mosquitoes. Some states on the list have had a large number of Zika cases related to travel or sexual transmission. California has 170 such Zika cases. Doctors say the concern is that blood donors might be carrying the Zika virus without knowing it. "About 80% of people who are infected with Zika will never develop any symptoms and that's one reason why it's a risk to a unit of blood," said Dr. Suchitra Pandey, the Chief Medical Officer at the Blood Centers of the Pacific, which has donation centers throughout the Bay Area. http://www.ktvu.com/news/196321366-story
  19. Case Count: Detected U.S. Human Infections with H3N2v by State since August 2011 Language: English Español Recommend on FacebookTweet Table 1. Case Count: Detected U.S. Human Infections with H3N2v by State since August 2011 States Reporting H3N2v Cases Cases in 2011 Cases in 2012 Cases in 2013 Cases in 2014 Cases in 2015 Cases in 2016 Hawaii 1 Illinois 4 1 Indiana 2 138 14 Iowa 3 1 1 Maine 2 Maryland 12 Michigan 6 2 1 12 Minnesota 5 1 New Jersey 1 Ohio 107 1 2 6 Pennsylvania 3 11 Utah 1* West Virginia 2 3 Wisconsin 20 1 Total 12 309 19 3 3 18 * Case in Utah occurred in April 2012. This chart indicates the number of CDC-reported infections with H3N2v influenza A viruses since August 2011. This case count will be updated on Fridays as new cases are reported. NOTE: The state totals reported by CDC may not always be consistent with those reported by state health departments. If there is a discrepancy between these two counts, data from the state health departments should be used as the most accurate number. Table 2. H3N2v Hospitalizations and Deaths Since July 2012* H3N2v Hospitalizations and Deaths Since July 2012 Cases in 2012 Cases in 2013 Cases in 2014 Cases in 2015 Cases in 2016 Hospitalizations 16 1 1 2 1 Deaths 1 0 0 0 0 * As reported by states to CDC. This chart indicates the number of CDC-reported infections with H3N2v influenza A viruses since July 2012. This case count will be updated when new cases are reported. See Reported Infections with Variant Influenza Viruses in the United States since 2005 for a complete list of human infections with all variant viruses since 2005. http://www.cdc.gov/flu/swineflu/h3n2v-case-count.htm
  20. edit Name Isolate ID Subtype Passage PB2 PB1 PA HA NP NA MP NS HE P3 Collection date edit Name Isolate ID Subtype Passage PB2 PB1 PA HA NP NA MP NS HE P3 Collection date A/Michigan/84/2016 EPI_ISL_232047 H3N2 OR --- --- --- 1701 --- 1358 --- --- --- --- 2016-08-11 A/Michigan/83/2016 EPI_ISL_232048 H3N2 OR 2316 2286 2208 1737 1540 1441 1002 865 --- --- 2016-08-09 A/Michigan/82/2016 EPI_ISL_232046 H3N2 OR 2264 2274 1094 956 --- 1360 970 664 --- --- 2016-08-09 A/Ohio/28/2016 EPI_ISL_232045 H3N2 OR 2264 2274 --- 1701 --- 1342 969 838 --- --- 2016-08-04 A/Ohio/27/2016 EPI_ISL_232044 H3N2 OR 2264 2274 2151 1693 1497 1363 982 838 --- --- 2016-07-30
  21. Novel Influenza A Viruses: Seven human infections with novel influenza A viruses were reported by two states (Michigan [4] and Ohio [3]) during week 33. All seven persons were infected with influenza A (H3N2) variant (H3N2v) viruses and reported exposure to swine in fair settings during the week preceding illness onset. To date, a total of 18 (Michigan [12] and Ohio [6]) human infections with H3N2v viruses have been identified during 2016, all reported during the month of August. One of the 18 persons were hospitalized as a result of H3N2v illness. No deaths have occurred. All variant virus infections have been associated with swine exposure in fair settings. No human-to-human transmission has been identified. Public health and agriculture officials are investigating the extent of disease among humans and swine, and additional cases may be identified as the investigation continues. Early identification and investigation of human infections with novel influenza A viruses are critical to ensure timely risk assessment and so that appropriate public health measures can be taken. Additional information on influenza in swine, variant influenza infection in humans, and strategies to interact safely with swine can be found athttp://www.cdc.gov/flu/swineflu/index.htm.
  22. Seven human infections with novel influenza A viruses were reported by two states (Michigan [4] and Ohio [3]) during week 33. All seven persons were infected with influenza A (H3N2) variant (H3N2v) viruses and reported exposure to swine in fair settings during the week preceding illness onset. http://www.cdc.gov/flu/weekly/
  23. CDPH Weekly Update on Number of Zika Virus Infections in California August 26, 2016 The following table provides the number of travel-associated infections with Zika virus in California residents in 2015 and 2016. CDPH is following CDC testing guidelines. This table is updated every Friday. As of August 26, 2016, there have been 189 travel-associated Zika virus infections in California. • Total infections: 189 • Cumulative number of infections due to sexual transmission: 1 • Cumulative number of infections in pregnant women: 25a o Liveborn infants with birth defects: 2b o Pregnancy losses with birth defects: 0c Zika virus infections in California, 2015-2016d (as of August 26, 2016) County Travel-associated e Locally acquired f Alameda (City of Berkeley) 13g (1) 0 Contra Costa 8 0 Fresno 1 0 Kern 2 0 Lake 1 0 Los Angeles (City of Long Beach) 41h (1) 0 Marin 4 0 Merced 3 0 Monterey 1 0 Napa 2 0 Orange 14 0 Riverside 7 0 Sacramento 4 0 San Bernardino 7 0 San Diego 30i 0 San Francisco 14 0 San Joaquin 5 0 San Mateo 4 0 Santa Barbara 1 0 Santa Clara 13 0 Santa Cruz 1 0 Solano 1 0 Sonoma 4 0 Stanislaus 2 0 Tulare 2 0 Ventura 1 0 Total 189 0 STATE OF CALIFORNIA California Department of Public Health HEALTH AND HUMAN SERVICES AGENCY Division of Communicable Disease Control a Local Health Departments and CDPH are monitoring all pregnant women and their infants b Includes microcephaly, calcium deposits in the brain indicating possible brain damage, excess fluid in the brain cavities and surrounding the brain, absent or poorly formed brain structures, abnormal eye development, or other problems resulting from damage to the brain that affects nerves, muscles and bones, such as clubfoot or inflexible joints. c Includes miscarriage, stillbirths, and terminations with evidence of the birth defects mentioned above d Total number includes laboratory-confirmed and probable infections as defined by the CSTE Position Statement e Persons exposed through travel to an affected area or contact with a traveler f Presumed local mosquito-borne transmission g Includes one resident of the City of Berkeley h Includes one resident of the City of Long Beach I Includes one non-resident https://www.cdph.ca.gov/HealthInfo/discond/Documents/TravelAssociatedCasesofZikaVirusinCA.pdf
  24. 1-Aug asymp 52 contact 26 2-Aug asymp 52 contact 26 3-Aug asymp 52 contact 26 4-Aug asymp 52 contact 26 5-Aug asymp 52 contact 26 Invest date collect negative positive pending MD1 1-Aug 54 54 0 0 B1 1-Aug 70 70 0 0 Wyn 8-Aug 437 418 11 8 #1 9-Aug 455 424 17 14 10-Aug 498 424 16 46 11-Aug 511 480 19 12 12-Aug 517 492 21 4 15-Aug 518 492 22 4 16-Aug 518 492 22 4 17-Aug 518 492 23 4 18-Aug 519 492 23 4 19-Aug 519 492 23 4 22-Aug 519 492 23 4 23-Aug 519 492 29 0 24-Aug 519 492 27 0 25-Aug 519 492 27 0 26-Aug 519 492 26 0 MD2 5-Aug 11 #2 8-Aug 19 16 0 3 9-Aug 19 16 0 3 10-Aug 19 18 0 1 11-Aug 19 18 0 1 12-Aug 19 19 0 0 15-Aug 21 19 0 2 16-Aug 21 19 0 2 17-Aug 21 19 0 2 18-Aug 21 19 0 2 19-Aug 21 19 0 2 22-Aug 21 19 0 2 23-Aug 21 19 0 2 24-Aug 21 19 0 2 25-Aug 21 21 0 0 26-Aug 21 21 0 0 PB1 8-Aug 1 0 0 1 #3 9-Aug 1 0 0 1 10-Aug 3 0 0 3 11-Aug 3 2 0 1 12-Aug 3 3 0 0 15-Aug 3 3 0 0 16-Aug 3 3 0 0 17-Aug 3 3 0 0 18-Aug 3 3 0 0 19-Aug 3 3 0 0 22-Aug 3 3 0 0 23-Aug 3 3 0 0 24-Aug 3 3 0 0 25-Aug 3 3 0 0 26-Aug 3 3 0 0 MD3 17-Aug 0 #4 18-Aug 0 19-Aug 0 22-Aug 0 23-Aug 0 24-Aug 0 25-Aug 0 26-Aug 0 MD4 15-Aug 5 1 0 4 #5 16-Aug 5 1 0 4 17-Aug 6 1 0 5 18-Aug 6 1 0 5 19-Aug 6 1 0 5 22-Aug 6 1 0 5 23-Aug 6 1 0 5 24-Aug 6 1 0 5 25-Aug 6 1 0 5 26-Aug 6 1 0 5 MD5 17-Aug 2 0 0 2 #6 18-Aug 2 0 0 2 19-Aug 2 0 0 2 22-Aug 8 6 0 2 23-Aug 26 6 0 20 24-Aug 27 24 0 3 25-Aug 27 24 0 3 26-Aug 27 24 0 3 MD6 17-Aug 18-Aug 19-Aug 22-Aug comb MD7 18-Aug 0 #7 19-Aug 0 22-Aug 0 23-Aug 0 24-Aug 0 25-Aug 0 26-Aug MD8 18-Aug 19-Aug MB 22-Aug comb 5 #8 23-Aug 0 24-Aug 0 25-Aug 97 0 0 97 26-Aug 97 0 0 97 MD9 19-Aug 22-Aug comb PIN 23-Aug 3 0 0 3 #9 24-Aug 3 0 0 3 25-Aug 3 0 0 3 26-Aug 21 3 0 18 PB2 24-Aug 0 #10 25-Aug 0 26-Aug 5 0 0 5

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.