niman

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of August 3, 2016) http://www.cdc.gov/zika/geo/united-states.html States Travel-associated cases* No. (% of cases in states) (N=1,819) Locally acquired cases† No. (% of cases in states) (N=6) Alabama 11 (1) 0 (0) Arizona 10 (1) 0 (0) Arkansas 5 (<1) 0 (0) California 87 (5) 0 (0) Colorado 19 (1) 0 (0) Connecticut 39 (2) 0 (0) Delaware 10 (1) 0 (0) District of Columbia 10 (1) 0 (0) Florida 322 (18) 6 (100) Georgia 42 (2) 0 (0) Hawaii 10 (1) 0 (0) Illinois 33 (2) 0 (0) Indiana 20 (1) 0 (0) Iowa 9 (1) 0 (0) Kansas 8 (<1) 0 (0) Kentucky 10 (1) 0 (0) Louisiana 9 (<1) 0 (0) Maine 9 (<1) 0 (0) Maryland 54 (3) 0 (0) Massachusetts 54 (3) 0 (0) Michigan 17 (1) 0 (0) Minnesota 29 (2) 0 (0)

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of August 3, 2016) http://www.cdc.gov/zika/geo/united-states.html States Travel-associated cases* No. (% of cases in states) (N=1,819) Locally acquired cases† No. (% of cases in states) (N=6) Alabama 11 (1) 0 (0) Arizona 10 (1) 0 (0) Arkansas 5 (<1) 0 (0) California 87 (5) 0 (0) Colorado 19 (1) 0 (0) Connecticut 39 (2) 0 (0) Delaware 10 (1) 0 (0) District of Columbia 10 (1) 0 (0) Florida 322 (18) 6 (100) Georgia 42 (2) 0 (0) Hawaii 10 (1) 0 (0) Illinois 33 (2) 0 (0) Indiana 20 (1) 0 (0) Iowa 9 (1) 0 (0) Kansas 8 (<1) 0 (0) Kentucky 10 (1) 0 (0) Louisiana 9 (<1) 0 (0) Maine 9 (<1) 0 (0) Maryland 54 (3) 0 (0) Massachusetts 54 (3) 0 (0) Michigan 17 (1) 0 (0)

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of August 3, 2016) http://www.cdc.gov/zika/geo/united-states.html States Travel-associated cases* No. (% of cases in states) (N=1,819) Locally acquired cases† No. (% of cases in states) (N=6) Alabama 11 (1) 0 (0) Arizona 10 (1) 0 (0) Arkansas 5 (<1) 0 (0) California 87 (5) 0 (0) Colorado 19 (1) 0 (0) Connecticut 39 (2) 0 (0) Delaware 10 (1) 0 (0) District of Columbia 10 (1) 0 (0) Florida 322 (18) 6 (100) Georgia 42 (2) 0 (0) Hawaii 10 (1) 0 (0) Illinois 33 (2) 0 (0) Indiana 20 (1) 0 (0) Iowa 9 (1) 0 (0) Kansas 8 (<1) 0 (0) Kentucky 10 (1) 0 (0) Louisiana 9 (<1) 0 (0) Maine 9 (<1) 0 (0)

Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of August 3, 2016) http://www.cdc.gov/zika/geo/united-states.html States Travel-associated cases* No. (% of cases in states) (N=1,819) Locally acquired cases† No. (% of cases in states) (N=6) Alabama 11 (1) 0 (0) Arizona 10 (1) 0 (0) Arkansas 5 (<1) 0 (0) California 87 (5) 0 (0) Colorado 19 (1) 0 (0) Connecticut 39 (2) 0 (0) Delaware 10 (1) 0 (0) District of Columbia 10 (1) 0 (0) Florida 322 (18) 6 (100) Georgia 42 (2) 0 (0) Hawaii 10 (1) 0 (0) Illinois 33 (2) 0 (0) Indiana 20 (1) 0 (0) Iowa 9 (1) 0 (0) Kansas 8 (<1) 0 (0) Kentucky 10 (1) 0 (0) Louisiana 9 (<1) 0 (0) Maine 9 (<1) 0 (0) Maryland 54 (3) 0 (0) Massachusetts 54 (3) 0 (0)

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of August 3, 2016) States Travel-associated cases* No. (% of cases in states) (N=1,819) Locally acquired cases† No. (% of cases in states) (N=6) Alabama 11 (1) 0 (0) Arizona 10 (1) 0 (0) Arkansas 5 (<1) 0 (0) California 87 (5) 0 (0) Colorado 19 (1) 0 (0) http://www.cdc.gov/zika/geo/united-states.html

Summary As of 3 August 2016, 68 countries and territories (Fig. 1, Table 1) have reported evidence of mosquito-borne Zika virus transmission since 2007 (65 of these countries and territories have reported evidence of mosquito-borne Zika virus transmission since 2015): 51 countries and territories with a first reported outbreak from 2015 onwards (Table 1). Four countries are classified as having possible endemic transmission or have reported evidence of local mosquito-borne Zika infections in 2016. 13 countries and territories have reported evidence of local mosquito-borne Zika infections in or before 2015, but without documentation of cases in 2016, or with the outbreak terminated. The United States of America reported mosquito-borne Zika virus transmission for the first time on 29 July 2016. Since February 2016, 11 countries have reported evidence of person-to-person transmission of Zika virus, probably via a sexual route (Table 2). As of 3 August 2016, 14 countries or territories have reported microcephaly and other central nervous system (CNS) malformations potentially associated with Zika virus infection or suggestive of congenital infection. No additional countries or territories have reported microcephaly in the last week. Three of the 14 total countries reported microcephaly cases born from mothers in countries with no endemic Zika virus transmission but who reported recent travel history to Zika-affected countries in the WHO Region of the Americas (Table 3). As of 3 August 2016, the United States Centers for Disease Control and Prevention (US-CDC) reported 13 live-born infants with birth defects and six pregnancy losses with birth defects with laboratory evidence of Zika virus infection. As of 3 August 2016, 15 countries and territories worldwide have reported an increased incidence of Guillain-Barré syndrome (GBS) and/or laboratory confirmation of a Zika virus infection among GBS cases (Table 4). In Guinea-Bissau, on 29 June 2016, Institute Pasteur Dakar (IPD) confirmed that three of 12 samples tested positive for Zika by PC-R. All 12 samples tested negative against IgM Zika. One additional sample from a recent case also tested positive for Zika virus infection. All four samples were sent to IPD on 1 July for gene sequencing and the results are pending. Twenty-two additional samples were collected and sent for testing; the results are still pending. A roster of WHO technical and communication officers is available to answer media queries during the Olympics. WHO has developed advice and information on diverse topics in the context of Zika virus. ,

Zika situation report 4 August 2016 Zika virus, Microcephaly and Guillain-Barré syndrome Read the full situation report http://who.int/emergencies/zika-virus/situation-report/4-august-2016/en/ Download the map pdf, 400kb Download Countries and territories reporting mosquito-borne Zika virus transmission (Table 1.) png, 146kb

At A Glance - Zika in the U.S. (as of August 5, 2016) North CarolinaTravel-associated Zika virus disease cases reported: 33Locally acquired vectorborne cases reported: 0 http://epi.publichealth.nc.gov/zika/

At A Glance - Zika in the U.S. (as of August 5, 2016) North CarolinaTravel-associated Zika virus disease cases reported: 33Locally acquired vectorborne cases reported: 0 U.S. StatesTravel-associated Zika virus disease cases reported: 1,818Locally acquired vectorborne cases reported: 6 U.S. TerritoriesTravel-associated cases reported: 23Locally acquired vectorborne cases reported: 5,525

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Maryland Confirmed Zika Virus Infections (As of August 3, 2016) Travel-Associated Locally Acquired Vector-Borne Total 54 0 54 http://phpa.dhmh.maryland.gov/Pages/Zika.aspx

Maryland Confirmed Zika Virus Infections (As of August 3, 2016) Travel-Associated Locally Acquired Vector-Borne Total 54 0 54

Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq dbj|LC171327.1| Zika virus gene for polyprotein, partial cds, strain: ZIKV/Hu/Chiba/S36/2016 2727 2727 100% 0.0 100% LC171327.1 Select seq gb|KX576684.1| Zika virus vector pZIKV-ICD, complete sequence 2700 2700 100% 0.0 99% KX576684.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 2700 2700 100% 0.0 99% KX369547.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 2700 2700 100% 0.0 99% KX280026.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 2700 2700 100% 0.0 99% KX262887.1 Select seq gb|KJ776791.1| Zika virus strain H/PF/2013 polyprotein gene, complete cds 2700 2700 100% 0.0 99% KJ776791.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 2695 2695 100% 0.0 99% KX446951.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KX247632.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 2695 2695 100% 0.0 99% KX051563.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 2695 2695 100% 0.0 99% KU509998.3 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 2695 2695 100% 0.0 99% KU991811.1 Select seq gb|KU646828.1| Zika virus isolate Si322 polyprotein gene, partial cds 2695 2695 100% 0.0 99% KU646828.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 2691 2691 100% 0.0 99% KX446950.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU866423.2 Select seq gb|KU758871.1| Zika virus isolate 17170 polyprotein gene, partial cds 2691 2691 100% 0.0 99% KU758871.1 Select seq gb|KU758870.1| Zika virus isolate 17160 polyprotein gene, partial cds 2691 2691 100% 0.0 99% KU758870.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 2691 2691 100% 0.0 99% KX253996.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 2691 2691 100% 0.0 99% KX247646.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 2691 2691 100% 0.0 99% KX198135.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 2691 2691 100% 0.0 99% KX197192.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KX185891.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 2691 2691 100% 0.0 99% KX156776.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 2691 2691 100% 0.0 99% KX156775.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 2691 2691 100% 0.0 99% KX156774.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 2691 2691 100% 0.0 99% KX117076.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU963796.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU955589.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 2691 2691 100% 0.0 99% KU870645.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 2691 2691 100% 0.0 99% KU922960.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 2691 2691 100% 0.0 99% KU922923.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 2691 2691 100% 0.0 99% KU820899.2 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU729218.1 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 2691 2691 100% 0.0 99% KU527068.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 2691 2691 100% 0.0 99% KU647676.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 2691 2691 100% 0.0 99% KU321639.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 2686 2686 100% 0.0 99% KX520666.1 Select seq gb|KU820897.3| Zika virus isolate FLR polyprotein gene, complete cds 2686 2686 100% 0.0 99% KU820897.3 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 2686 2686 100% 0.0 99% KU758877.1 Select seq gb|KU758873.1| Zika virus isolate 18246 polyprotein gene, partial cds 2686 2686 100% 0.0 99% KU758873.1 Select seq gb|KU758869.1| Zika virus isolate 05211 polyprotein gene, partial cds 2686 2686 100% 0.0 99% KU758869.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 2686 2686 100% 0.0 99% KU937936.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 2686 2686 100% 0.0 99% KX087102.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 2686 2686 100% 0.0 99% KU940228.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 2686 2686 100% 0.0 99% KU926309.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 2686 2686 100% 0.0 99% KU497555.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 2686 2686 100% 0.0 99% KU501217.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 2686 2686 100% 0.0 99% KU501216.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 2686 2686 100% 0.0 99% KU365778.1 Select seq gb|KU312315.1| Zika virus isolate Z1106027 polyprotein gene, partial cds 2686 2686 100% 0.0 99% KU312315.1 Select seq gb|KU312314.1| Zika virus isolate Z1106031 polyprotein gene, partial cds 2686 2686 100% 0.0 99% KU312314.1 Select seq gb|KJ634273.1| Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds 2686 2686 100% 0.0 99% KJ634273.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 2682 2682 100% 0.0 99% KX548902.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 2682 2682 100% 0.0 99% KX377337.1 Select seq gb|KU758874.1| Zika virus isolate 20114 polyprotein gene, partial cds 2682 2682 100% 0.0 99% KU758874.1 Select seq gb|KU758868.1| Zika virus isolate 27229 polyprotein gene, partial cds 2682 2682 100% 0.0 99% KU758868.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 2682 2682 100% 0.0 99% KU820898.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 2682 2682 100% 0.0 99% KU740184.2 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 2682 2682 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 2682 2682 100% 0.0 99% KU853012.1 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 2682 2682 100% 0.0 99% KU761564.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 2682 2682 100% 0.0 99% KU707826.1 Select seq gb|KU646827.1| Zika virus isolate Si323 polyprotein gene, partial cds 2682 2682 100% 0.0 99% KU646827.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 2682 2682 100% 0.0 99% KU501215.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 2682 2682 100% 0.0 99% KU365780.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 2682 2682 100% 0.0 99% KU365779.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 2682 2682 100% 0.0 99% KU365777.1 Select seq gb|KU940224.1| Zika virus isolate Bahia09, partial genome 2679 2679 100% 0.0 99% KU940224.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 2677 2677 100% 0.0 99% KX601168.1 Select seq gb|KU758872.1| Zika virus isolate 01170 polyprotein gene, partial cds 2677 2677 100% 0.0 99% KU758872.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 2677 2677 100% 0.0 99% KX087101.2 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 2677 2677 100% 0.0 99% KX056898.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 2677 2677 100% 0.0 99% KU955590.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 2677 2677 100% 0.0 99% KU729217.2 Select seq gb|KU758876.1| Zika virus isolate 21068 polyprotein gene, partial cds 2673 2673 100% 0.0 99% KU758876.1 Select seq gb|KU758875.1| Zika virus isolate 15042 polyprotein gene, partial cds 2673 2673 100% 0.0 99% KU758875.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 2673 2673 100% 0.0 99% KU926310.1 Select seq gb|KU312313.1| Zika virus isolate Z1106032 polyprotein gene, partial cds 2673 2673 100% 0.0 99% KU312313.1 Select seq gb|KU681081.3| Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome 2668 2668 100% 0.0 99% KU681081.3 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 2668 2668 100% 0.0 99% KU312312.1 Select seq gb|KF993678.1| Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds 2664 2664 100% 0.0 99% KF993678.1 Select seq gb|KU955593.1| Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome 2641 2641 100% 0.0 99% KU955593.1 Select seq gb|JN860885.1| Zika virus isolate FSS13025 polyprotein gene, partial cds 2641 2641 100% 0.0 99% JN860885.1 Select seq gb|KU744693.1| Zika virus isolate VE_Ganxian, complete genome 2634 2634 99% 0.0 99% KU744693.1 Select seq gb|EU545988.1| Zika virus polyprotein gene, complete cds 2632 2632 100% 0.0 99% EU545988.1 Select seq gb|KU681082.3| Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome 2601 2601 100% 0.0 98% KU681082.3 Select seq gb|KX601167.1| Zika virus strain ZIKV/Aedes sp./MYS/P6-740/1966, complete genome 2443 2443 100% 0.0 96% KX601167.1 Select seq gb|KX377336.1| Zika virus strain P6-740, complete genome 2443 2443 100% 0.0 96% KX377336.1 Select seq gb|HQ234499.1| Zika virus isolate P6-740 polyprotein gene, partial cds 2441 2441 100% 0.0 96% HQ234499.1 Select seq gb|KX101060.1| Zika virus isolate Bahia02, partial genome 2282 2282 85% 0.0 99% KX101060.1

LOCUS LC171327 1512 bp RNA linear VRL 27-JUL-2016 DEFINITION Zika virus gene for polyprotein, partial cds, strain: ZIKV/Hu/Chiba/S36/2016. ACCESSION LC171327 VERSION LC171327.1 GI:1047208949 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 AUTHORS Taira,M., Ogawa,T., Hotta,C., Akita,M. and Nishijima,H. TITLE Zika virus isolate ZIKV/Hu/Chiba/S36/2016 Partial JOURNAL Unpublished REFERENCE 2 (bases 1 to 1512) AUTHORS Taira,M., Ogawa,T., Hotta,C., Akita,M. and Nishijima,H. TITLE Direct Submission JOURNAL Submitted (25-JUL-2016) Contact:Masakatsu Taira Chiba Prefectural Institute of Public Health, Division of Virology; 666-2 Nitona-cho Chuoh-ku, Chiba, Chiba 260-8715, Japan FEATURES Location/Qualifiers source 1..1512 /organism="Zika virus" /mol_type="genomic RNA" /strain="ZIKV/Hu/Chiba/S36/2016" /host="Homo sapiens" /db_xref="taxon:64320" /country="Japan" /collection_date="2016-07-20" CDS <1..>1512 /note="envelope protein" /codon_start=1 /product="polyprotein" /protein_id="BAV32139.1" /db_xref="GI:1047208950" /translation="IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSA" ORIGIN 1 atcaggtgca taggagtcag caatagggac tttgtggaag gtatgtcagg tgggacttgg 61 gttgatgttg tcttggaaca tggaggttgt gtcaccgtaa tggcacagga caaaccgact 121 gtcgacatag agctggttac aacaacagtc agcaacatgg cggaggtaag atcctactgc 181 tatgaggcat caatatcgga catggcttcg gacagccgct gcccaacaca aggtgaagcc 241 taccttgaca agcaatcaga cactcaatat gtctgcaaaa gaacgttagt ggacagaggc 301 tggggaaatg gatgtggact ttttggcaaa gggagcctgg tgacctgcgc taagtttgca 361 tgctccaaga aaatgaccgg gaagagcatc cagccagaga atctggagta ccggataatg 421 ctgtcagttc atggctccca gcacagtggg atgatcgtta atgacacagg acatgaaact 481 gatgagaata gagcgaaggt tgagataacg cccaattcac caagagccga agccaccctg 541 gggggttttg gaagcctagg acttgattgt gaaccgagga caggccttga cttttcagat 601 ttgtattact tgactatgaa taacaagcac tggttggttc acaaggagtg gttccacgac 661 attccattac cttggcacgc tggggcagac accggaactc cacactggaa caacaaagaa 721 gcactggtag agttcaagga cgcacatgcc aaaaggcaaa ctgtcgtggt tctagggagt 781 caagaaggag cagtccacac ggcccttgct ggagctctgg aggctgagat ggatggtgca 841 aagggaaggc tgtcctctgg ccacttgaaa tgtcgcctga aaatggataa acttagattg 901 aagggcgtgt catactcctt gtgtaccgca gcgttcacat tcaccaagat cccggctgaa 961 acactgcacg ggacagtcac agtggaggta cagtacgcag ggacagatgg accttgcaag 1021 gttccagctc agatggcggt ggacatgcaa actctgaccc cagttgggag gttgataacc 1081 gctaaccctg taatcactga aagcactgag aactctaaga tgatgctgga acttgatcca 1141 ccatttgggg actcttacat tgtcatagga gtcggggaga agaagatcac ccaccactgg 1201 cacaggagtg gtagcaccat tggaaaagca tttgaagcca ctgtgagagg tgccaagaga 1261 atggcagtct tgggagacac agcctgggac tttggatcag ttggaggcgc tctcaactca 1321 ttgggcaagg gcatccatca aatttttgga gcagctttca aatcattgtt tggaggaatg 1381 tcctggttct cacaaattct cattggaacg ttgctgatgt ggttgggtct gaacacaaag 1441 aacggatcta tttcccttat gtgcttggcc ttagggggag tgttgatctt cttatccaca 1501 gccgtctctg ct

Chiba Prefectural Institute of Public Health has released a partial Zika sequence (env), Chiba/S36/2016, which appears to be from Chiba case ex-Oceania.

Zika virus confirmed in boy who returned to Japan from Pacific islands KYODO APR 22, 2016 ARTICLE HISTORY PRINT SHARE Japanese health authorities said Friday that a Zika virus infection has been detected in a boy who returned from Pacific islands in Oceania, the fifth confirmation in the country of the infection of the mosquito-borne virus this year. The boy in Chiba Prefecture was confirmed to have contracted the virus after he returned to Japan on Wednesday after spending 15 months in Pacific islands in Oceania, said the Ministry of Health, Labor and Welfare and the Chiba Prefectural Government. The ministry only gave the boy’s age as being between 10 and 19. http://www.japantimes.co.jp/news/2016/04/22/national/zika-virus-confirmed-in-boy-who-returned-to-japan-from-pacific-islands/#.V6XWhLgrKpY

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

August 5, 2016 DEPARTMENT OF HEALTH DAILY ZIKA UPDATE Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will continue to issue a Zika virus update each week day at 2 p.m. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. There are 13 new travel-related cases today with five in Orange County, three in Seminole County, two in Brevard County, two in Palm Beach County and one in St. Lucie County. Please visit our website to see the full list of travel-related cases. There is one new non-travel related case today inside the identified one-square mile in Miami-Dade County. This individual was tested as one of the 26 close contacts around the two original cases. This case is considered probable and has been sent to CDC for confirmatory testing, along with the three other probable cases. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 351 Non-Travel Related Infections of Zika 16 Infections Involving Pregnant Women 55 ACTIVE INVESTIGATIONS 1) Identified one-square mile in Miami-Dade: Original two cases in the area of interest in Miami-Dade: tested 26 close contacts, one confirmed and four probable; 52 individuals from the community have been tested, six were positive but asymptomatic 142 individuals in the northwest quadrant of the identified area have been tested; only one travel-related infection was identified. After this very intensive active case finding, the department did not identify any additional cases of local transmission. No additional active surveillance is planned in the northwest section of the identified square mile area. Yesterday, 42 samples were collected for testing. Mosquito abatement and reduction activities are on-going. 2) Miami-Dade investigation outside the one-square mile: Testing has been completed for 11 individuals with no additional positives. Sample collection and door-to-door outreach continues. Mosquito abatement and reduction activities are on-going. CLOSED INVESTIGATIONS The department has closed out the investigations into the first cases in Miami-Dade and Broward County. The department tested 124 close contacts and individuals from the community and found no additional positives. On August 4, the department announced we have completed testing in a 10 block area of the northwest quadrant of the one-square mile area and no people within the 10 block radius tested positive. The department has cleared that area and is continuing to test people within the one-square mile radius. A map detailing the area is below. The department still believes active transmission is only taking place within the identified one-square mile area in Miami-Dade County. There are no active investigations in Broward County and no areas of active transmission in Broward County. One case does mean active transmission is taking place and that’s why the department conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. The department has not yet determined where the individual likely contracted Zika and will share more details as the investigation progresses. If the department finds evidence that active transmission is occurring in an area, we will notify the media and the public. The department has conducted testing for the Zika virus for more than 2,460 people statewide. Florida currently has the capacity to test 6,239 people for active Zika virus and 1,840 for Zika antibodies. The department still believes active transmissions of the Zika virus are occurring in one small area in Miami-Dade County, just north of downtown. The exact location is within the boundaries of the following area: NW 5th Avenue to the west, US 1 to the east, NW/NE 38th Street to the north and NW/NE 20thStreet to the south. This area is about one square mile and a map is below to detail the area. This remains the only area of the state where the department has confirmed there are local transmissions of Zika. If investigations reveal additional areas of likely active transmission, the department will announce a defined area of concern. CDC recommends that women who are pregnant or thinking of becoming pregnant postpone travel to areas with widespread Zika infection. Florida’s small case cluster is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted area in Miami-Dade County (see map below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the one square mile area to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms since January. The total number of pregnant women who have been or are being monitored is 55. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 3,079 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.

There are 13 new travel-related cases today with five in Orange County, three in Seminole County, two in Brevard County, two in Palm Beach County and one in St. Lucie County. http://www.floridahealth.gov/newsroom/2016/08/080516-zika-update.html

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ