Everything posted by niman
-
Full Zika 2015 Sequence From Bahia Brazil HS-2015-BA-01
Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX520666.1|Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds1852518525100%0.0100%KX520666.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome1850718507100%0.099%KU940228.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome184201842099%0.099%KU940224.1Select seq gb|KX369547.1|Zika virus strain PF13/251013-18, complete genome1838418384100%0.099%KX369547.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome1838418384100%0.099%KU509998.3Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1838118381100%0.099%KJ776791.1Select seq gb|KX280026.1|Zika virus isolate Paraiba_01, complete genome1837518375100%0.099%KX280026.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds1837218372100%0.099%KU991811.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1837218372100%0.099%KU729218.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1837218372100%0.099%KU321639.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome1836618366100%0.099%KX051563.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1836318363100%0.099%KU707826.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1836318363100%0.099%KU365779.1Select seq gb|KX262887.1|Zika virus isolate 103451, complete genome1835718357100%0.099%KX262887.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome1835718357100%0.099%KX197192.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome1834818348100%0.099%KX198135.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome1834818348100%0.099%KU926309.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1834818348100%0.099%KU365780.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1834518345100%0.099%KU647676.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1834518345100%0.099%KU365777.1Select seq gb|KU758877.1|Zika virus isolate 17271 polyprotein gene, complete cds1833918339100%0.099%KU758877.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome1833918339100%0.099%KX247646.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome1833918339100%0.099%KX156776.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1833918339100%0.099%KU501217.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome1833618336100%0.099%KX156774.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1833618336100%0.099%KU729217.2Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome183361833699%0.099%KU497555.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1833618336100%0.099%KU527068.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1833618336100%0.099%KU501216.1Select seq gb|KX446951.1|Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome1833018330100%0.099%KX446951.1Select seq gb|KU820897.3|Zika virus isolate FLR polyprotein gene, complete cds1833018330100%0.099%KU820897.3Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds1833018330100%0.099%KX247632.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome1833018330100%0.099%KX156775.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome1833018330100%0.099%KX087102.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1833018330100%0.099%KU501215.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1833018330100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1833018330100%0.099%KU312312.1Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome1832718327100%0.099%KX087101.2Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome1832718327100%0.099%KU922960.1Select seq gb|KX377337.1|Zika virus strain PRVABC-59, complete genome1832118321100%0.099%KX377337.1Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds1832118321100%0.099%KU937936.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome1832118321100%0.099%KU926310.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome1832118321100%0.099%KU922923.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome1832118321100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome1832118321100%0.099%KU853012.1Select seq gb|KX446950.1|Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome1831818318100%0.099%KX446950.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome1831818318100%0.099%KU870645.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds1830318303100%0.099%KU820898.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds1830018300100%0.099%KX056898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds1830018300100%0.099%KU955590.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds1829418294100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1829418294100%0.099%KU761564.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome1829118291100%0.099%KX117076.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds1828218282100%0.099%KX185891.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds1828218282100%0.099%KU963796.1Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome1827618276100%0.099%KX253996.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds1827618276100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1827618276100%0.099%KU820899.2Select seq gb|KU866423.2|Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds1827318273100%0.099%KU866423.2Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1813718137100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1803818038100%0.099%KU681081.3Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome1773217732100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177301773099%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds176851768598%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1757617576100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1742917429100%0.098%KU681082.3Select seq gb|KX377336.1|Zika virus strain P6-740, complete genome1641516415100%0.095%KX377336.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164151641599%0.095%HQ234499.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1330413304100%0.089%KU720415.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds132991329999%0.089%HQ234498.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1329513295100%0.089%KF383119.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1329313293100%0.089%KF383115.1Select seq gb|KX377335.1|Zika virus strain MR-766, complete genome1329013290100%0.089%KX377335.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1328113281100%0.089%LC002520.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1327913279100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1327913279100%0.089%KF268948.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1327213272100%0.089%KF268950.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome1326813268100%0.089%KU955595.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds1326513265100%0.089%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome1326513265100%0.089%KU955594.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome1325913259100%0.089%KU955592.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1325713257100%0.089%DQ859059.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome1324513733100%0.089%KX198134.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome1324113241100%0.089%KU955591.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1323413234100%0.089%KF383116.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1322313223100%0.089%AY632535.2Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132091320999%0.089%HQ234501.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1316413164100%0.088%KF383117.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds1314413251100%0.088%KU963574.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131441314499%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1296313031100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128911289197%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108621086297%0.084%KF383120.1Select seq gb|KX212103.1|Zika virus isolate BRZIKV_AB_ES polyprotein gene, partial cds5025502527%0.099%KX212103.1Select seq gb|KU758875.1|Zika virus isolate 15042 polyprotein gene, partial cds4991499127%0.099%KU758875.1Select seq gb|KU758871.1|Zika virus isolate 17170 polyprotein gene, partial cds4989498927%0.099%KU758871.1Select seq gb|KU758870.1|Zika virus isolate 17160 polyprotein gene, partial cds4982498227%0.099%KU758870.1Select seq gb|KU758873.1|Zika virus isolate 18246 polyprotein gene, partial cds4980498027%0.099%KU758873.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4980498027%0.099%KU312314.1Select seq gb|KU758872.1|Zika virus isolate 01170 polyprotein gene, partial cds4967496727%0.099%KU758872.1
-
Full Zika 2015 Sequence From Bahia Brazil HS-2015-BA-01
LOCUS KX520666 10538 bp RNA linear VRL 08-JUL-2016 DEFINITION Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds. ACCESSION KX520666 VERSION KX520666.1 GI:1042859933 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10538) AUTHORS Teixeira,M., Herman,B.D., Bassit,L.C. and Schinazi,R.F. TITLE Full coding sequence of the Zika Virus isolate HS-2015-BA-01 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10538) AUTHORS Teixeira,M., Herman,B.D., Bassit,L.C. and Schinazi,R.F. TITLE Direct Submission JOURNAL Submitted (08-JUL-2016) Pediatrics-Laboratory of Biochemical Pharmacology, Emory University, 1760 Haygood Dr NE Room E-450, Atlanta, GA 30322, USA COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10538 /organism="Zika virus" /mol_type="genomic RNA" /isolate="HS-2015-BA-01" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil: Bahia" /collection_date="2015" /note="genotype: Asian" CDS 37..10308 /codon_start=1 /product="polyprotein" /protein_id="ANQ92019.1" /db_xref="GI:1042859934" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTRQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT VISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKGGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAALGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQMPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPHGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLVNGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRPEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 ggttttattt ggatttggaa acgagagttt ctggtcatga aaaacccaaa aaagaaatcc 61 ggaggattcc ggattgtcaa tatgctaaaa cgcggagtag cccgtgtgag cccctttggg 121 ggcttgaaga ggctgccagc cggacttctg ctgggtcatg ggcccatcag gatggtcttg 181 gcgattctag cctttttgag attcacggca atcaagccat cactgggtct catcaataga 241 tggggttcag tggggaaaaa agaggctatg gaaataataa agaagttcaa gaaagatctg 301 gctgccatgc tgagaataat caatgctagg aaggagaaga agagacgagg cgcagatact 361 agtgtcggaa ttgttggcct cctgctgacc acagctatgg cagcggaggt cactagacgt 421 gggagtgcat actatatgta cttggacaga aacgatgctg gggaggccat atcttttcca 481 accacattgg ggatgaataa gtgttatata cagatcatgg atcttggaca catgtgtgat 541 gccaccatga gctatgaatg ccctatgctg gatgaggggg tggaaccaga tgacgtcgat 601 tgttggtgca acacgacgtc aacttgggtt gtgtacggaa cctgccatca caaaaaaggt 661 gaagcacgga gatctagaag agctgtgacg ctcccctccc attccactag gaagctgcaa 721 acgcggtcgc aaacctggtt ggaatcaaga gaatacacaa agcacttgat tagagtcgaa 781 aattggatat tcaggaaccc tggcttcgcg ttagcagcag ctgccatcgc ttggcttttg 841 ggaagctcaa cgcgccaaaa agtcatatac ttggtcatga tactgctgat tgccccggca 901 tacagcatca ggtgcatagg agtcagcaat agggactttg tggaaggtat gtcaggtggg 961 acttgggttg atgttgtctt ggaacatgga ggttgtgtca ccgtaatggc acaggacaaa 1021 ccgactgtcg acatagagct ggttacaaca acagtcagca acatggcgga ggtaagatcc 1081 tactgctatg aggcatcaat atcagacatg gcttcggaca gccgctgccc aacacaaggt 1141 gaagcctacc ttgacaagca atcagacact caatatgtct gcaaaagaac gttagtggac 1201 agaggctggg gaaatggatg tggacttttt ggcaaaggga gcctggtgac atgcgctaag 1261 tttgcatgct ccaagaaaat gaccgggaag agcatccagc cagagaatct ggagtaccgg 1321 ataatgctgt cagttcatgg ctcccagcac agtgggatga tcgttaatga cacaggacat 1381 gaaactgatg agaatagagc gaaggttgag ataacgccca attcaccaag agccgaagcc 1441 accctggggg gttttggaag cctaggactt gattgtgaac cgaggacagg ccttgacttt 1501 tcagatttgt attacttgac tatgaataac aagcactggt tggttcacaa ggagtggttc 1561 cacgacattc cattaccttg gcacgctggg gcagacaccg gaactccaca ctggaacaac 1621 aaagaagcac tggtagagtt caaggacgca catgccaaaa ggcaaactgt cgtggttcta 1681 gggagtcaag aaggagcagt tcacacggcc cttgctggag ctctagaggc tgagatggat 1741 ggtgcaaagg gaaggctgtc ctctggccac ttgaaatgtc gcctgaaaat ggataaactt 1801 agattgaagg gcgtgtcata ctccttgtgt accgcagcgt tcacattcac caagatcccg 1861 gctgaaacac tgcacgggac agtcacagtg gaggtacagt acgcagggac tgatggacct 1921 tgcaaggttc cagctcagat ggcggtggac atgcaaactc tgaccccagt tgggaggttg 1981 ataaccgcta accccgtaat cactgaaagc actgagaact ctaagatgat gctggaactt 2041 gatccaccat ttggggactc ctacattgtc ataggagtcg gggagaagaa gatcacccac 2101 cactggcaca ggagtggcag caccattgga aaagcatttg aagccactgt gagaggtgcc 2161 aagagaatgg cagtcttggg agacacagcc tgggactttg gatcagttgg aggcgctctc 2221 aactcattgg gcaagggcat ccatcaaatt tttggagcag ctttcaaatc attgtttgga 2281 ggaatgtcct ggttctcaca aattctcatt ggaacgttgc tgatgtggtt gggtctgaac 2341 acaaagaatg gatctatttc ccttatgtgc ttggccttag ggggagtgtt gatcttctta 2401 tccacagccg tctctgctga tgtggggtgc tcggtggact tctcaaagaa ggagacgaga 2461 tgcggtacag gggtgttcgt ctataacgac gttgaagcct ggagggacag gtacaagtac 2521 catcctgact ccccccgtag attggcagca gcagtcaagc aagcctggga agatggtatc 2581 tgcgggatct cctctgtttc aagaatggaa aacatcatgt ggagatcagt agaaggggag 2641 ctcaacgcaa tcctggaaga gaatggagtt caactgacgg tcgttgtggg atctgtaaaa 2701 aaccccatgt ggagaggtcc acagagattg cccgtgcctg tgaacgagct gccccacggc 2761 tggaaggctt gggggaaatc gtacttcgtc agagcagcaa agacaaataa cagctttgtc 2821 gtggatggtg acacactgaa ggaatgccca ctcaaacata gagcatggaa cagctttctt 2881 gtggaggatc atgggttcgg ggtatttcac actagtgtct ggctcaaggt tagagaagat 2941 tattcattag agtgtgatcc agccgttatt ggaacagctg ttaagggaaa ggaggctgta 3001 cacagtgatc taggctactg gattgagagt gagaagaatg acacatggag gctgaagagg 3061 gcccatctga tcgagatgaa aacatgtgaa tggccaaagt cccacacatt gtggacagat 3121 ggaatagaag agagtgatct gatcataccc aagtctttag ctgggccact cagccatcac 3181 aataccagag agggctacag gacccaaatg aaagggccat ggcacagtga agagcttgaa 3241 attcggtttg aggaatgccc aggcactaag gtccacgtgg aggaaacatg tggaacaaga 3301 ggaccatctc tgagatcaac cactgcaagc ggaagggtga tcgaggaatg gtgctgcagg 3361 gagtgcacaa tgcccccact gtcgttccgg gctaaagatg gctgttggta tggaatggag 3421 ataaggccca ggaaagaacc agaaagcaac ttagtaaggt caatggtgac tgcaggatca 3481 actgatcaca tggatcactt ctcccttgga gtgcttgtga ttctgctcat ggtgcaggaa 3541 gggctgaaga agagaatgac cacaaagatc atcataagca catcaatggc agtgctggta 3601 gctatgatcc tgggaggatt ttcaatgagt gacctggcta agcttgcaat tttgatgggt 3661 gccaccttcg cggaaatgaa cactggagga gatgtagctc atctggcgct gatagcggca 3721 ttcaaagtta gaccagcgtt gctggtatct ttcatcttca gagctaattg gacaccccgt 3781 gaaagcatgc tgctggcctt ggcctcgtgt cttttgcaaa ctgtgatctc cgccttggaa 3841 ggcgacctga tggttctcat caatggtttt gctttggcct ggttggcaat acgagcgatg 3901 gttgttccac gcactgataa catcaccttg gcaatcttgg ctgctctgac accactggcc 3961 cggggcacac tgcttgtggc gtggagagca ggccttgcta cttgcggggg gtttatgctc 4021 ctctctctga agggaaaagg cagtgtgaag aagaacttac catttgtcat ggccctggga 4081 ctaaccgctg tgaggctggt cgaccccatc aacgtggtgg gactgctgtt gctcacaagg 4141 agtgggaagc ggagctggcc ccccagcgaa gtactcacag ctgttggcct gatatgcgca 4201 ttggctggag ggttcgccaa ggcagatata gagatggctg ggcccatggc cgcggtcggt 4261 ctgctaattg tcagttacgt ggtctcagga aagagtgtgg acatgtacat tgaaagagca 4321 ggtgacatca catgggaaaa agatgcggaa gtcactggaa acagtccccg gctcgatgtg 4381 gcgctagatg agagtggtga tttctccctg gtggaggatg acggtccccc catgagagag 4441 atcatactca aggtggtcct gatgaccatc tgtggcatga acccaatagc catacccttt 4501 gcagctggag cgtggtacgt atacgtgaag actggaaaaa ggagtggtgc tctatgggat 4561 gtgcctgctc ccaaggaagt aaaaaagggg gagaccacag atggagtgta cagagtaatg 4621 actcgtagac tgctaggttc aacacaagtt ggagtgggag ttatgcaaga gggggtcttt 4681 cacactatgt ggcacgtcac aaaaggatcc gcgctgagaa gcggtgaagg gagacttgat 4741 ccatactggg gagatgtcaa gcaggatctg gtgtcatact gtggtccatg gaagctagat 4801 gccgcctggg acgggcacag cgaggtgcag ctcttggccg tgccccccgg agagagagcg 4861 aggaacatcc agactctgcc cggaatattt aagacaaagg gtggggacat tggagcggtt 4921 gcgctggatt acccagcagg aacttcagga tctccaatcc tagacaagtg tgggagagtg 4981 ataggacttt atggcaatgg ggtcgtgatc aaaaatggga gttatgttag tgccatcacc 5041 caagggagga gggaggaaga gactcctgtt gagtgcttcg agccttcgat gctgaagaag 5101 aagcagctaa ctgtcttaga cttgcatcct ggagctggga aaaccaggag agttcttcct 5161 gaaatagtcc gtgaagccat aaaaacaaga ctccgtactg tgatcttagc tccaaccagg 5221 gttgtcgctg ctgaaatgga ggaagccctt agagggcttc cagtgcgtta tatgacaaca 5281 gcagtcaatg tcacccactc tggaacagaa atcgtcgact taatgtgcca tgccaccttc 5341 acttcacgtc tactacagcc aatcagagtc cccaattata atctgtatat tatggatgag 5401 gcccacttca cagatccctc aagtatagca gcaagaggat acatttcaac aagggttgag 5461 atgggcgagg cggctgccat cttcatgacc gccacgccac caggaacccg tgacgcattt 5521 ccggactcca actcaccaat tatggacacc gaagtggaag tcccagagag agcctggagc 5581 tcaggctttg attgggtgac ggatcattct ggaaaaacag tttggtttgt tccaagcgtg 5641 aggaacggca atgagatcgc agcttgtctg acaaaggctg gaaaacgggt catacagctc 5701 agcagaaaga cttttgagac agagttccag aaaacaaaac atcaagagtg ggactttgtc 5761 gtgacaactg acatttcaga gatgggcgcc aactttaaag ctgaccgtgt catagattcc 5821 aggagatgcc taaagccggt catacttgat ggcgagagag tcattctggc tggacccatg 5881 cctgtcacac atgccagcgc tgcccagagg agggggcgca taggcaggaa tcccaacaaa 5941 cctggagatg agtatctgta tggaggtggg tgcgcagaga ctgacgaaga ccatgcacac 6001 tggcttgaag caagaatgct ccttgacaat atttacctcc aagatggcct catagcctcg 6061 ctctatcgac ctgaggccga caaagtagca gccattgagg gagagttcaa gcttaggacg 6121 gagcaaagga agacctttgt ggaactcatg aaaagaggag atcttcctgt ttggctggcc 6181 tatcaggttg catctgccgg aataacctac acagatagaa gatggtgctt tgatggcacg 6241 accaacaaca ccataatgga agacagtgtg ccggcagagg tgtggaccag acacggagag 6301 aaaagagtgc tcaaaccgag gtggatggat gccagagttt gttcagatca tgcggccctg 6361 aagtcattca aggagtttgc cgctgggaaa agaggagcgg ctcttggagt gatggaagcc 6421 ctgggaacac tgccaggaca catgacagag agattccagg aagccattga caacctcgct 6481 gtgctcatgc gggcagagac tggaagcagg ccttacaaag ccgcggcggc ccaaatgccg 6541 gagaccctag agaccattat gcttttgggg ttgctaggaa cagtctcgct gggaatcttt 6601 ttcgtcttga tgaggaacaa gggcataggg aagatgggct ttggaatggt gactcttggg 6661 gccagcgcat ggctcatgtg gctctcggaa attgagccag ccagaattgc atgtgtcctc 6721 attgttgtgt tcctattgct ggtggtgctc atacctgagc cagaaaagca aagatctccc 6781 caggacaacc aaatggcaat catcatcatg gtagcagtag gtcttctggg cttgattacc 6841 gccaatgaac tcggatggtt ggagagaaca aagagtgacc taagccatct aatgggaagg 6901 agagaggagg gggcaaccat aggattctca atggacattg acctgcggcc agcctcagct 6961 tgggccatct atgctgcctt gacaactttc attaccccag ccgtccaaca tgcagtgacc 7021 acttcataca acaactactc cttaatggcg atggccacgc aagctggagt gttgtttggt 7081 atgggcaaag ggatgccatt ctacgcatgg gactttggag tcccgctgct aatgataggt 7141 tgctactcac aattaacacc cctgacccta atagtggcca tcattttgct cgtggcgcac 7201 tacatgtact tgatcccagg gctgcaggca gcagctgcgc gtgctgccca gaagagaacg 7261 gcagctggca tcatgaagaa ccctgttgtg gatggaatag tggtgactga cattgacaca 7321 atgacaattg acccccaagt ggagaaaaag atgggacagg tgctactcat agcagtagcc 7381 gtctccagcg ccatactgtc gcggaccgcc tgggggtggg gggaggctgg ggctctgatc 7441 acagccgcaa cttccacttt gtgggaaggc tctccgaaca agtactggaa ctcctctaca 7501 gccacttcac tgtgtaacat ttttagggga agttacttgg ctggagcttc tctaatctac 7561 acagtaacaa gaaacgctgg cttggtcaag agacgtgggg gtggaacagg agagaccctg 7621 ggagagaaat ggaaggcccg cttgaaccag atgtcggccc tggagttcta ctcctacaaa 7681 aagtcaggca tcaccgaggt gtgcagagaa gaggcccgcc gcgccctcaa ggacggtgtg 7741 gcaacgggag gccatgctgt gtcccgagga agtgcaaagc tgagatggtt ggtggagcgg 7801 ggatacctgc agccccatgg aaaggtcatt gatcttggat gtggcagagg gggctggagt 7861 tactacgccg ccaccatccg caaagttcaa gaagtgaaag gatacacaaa aggaggccct 7921 ggtcatgaag aacccgtgtt ggtgcaaagc tatgggtgga acatagtccg tcttaagagt 7981 ggggtggacg tctttcatat ggcggctgag ccgtgtgaca cgttgctgtg tgacataggt 8041 gagtcatcat ctagtcctga agtggaagaa gcacggacgc tcagagttct ctccatggtg 8101 ggggattggc ttgaaaaaag accaggagcc ttttgtataa aagtgttgtg cccatacacc 8161 agcactatga tggaaaccct ggagcgactg cagcgtaggt atgggggagg actggtcaga 8221 gtgccactct cccgcaactc tacacatgag atgtactggg tctctggagc gaaaagcaac 8281 accataaaaa gtgtgtccac cacgagccag ctcctcttgg ggcgcatgga cgggcctagg 8341 aggccagtga aatatgagga ggatgtgaat ctcggctctg gcacgcgggc tgtggtaagc 8401 tgcgctgaag ctcccaacat gaagatcatt ggtaaccgca ttgaaaggat ccgcagtgag 8461 cacgcggaaa cgtggttctt tgacgagaac cacccatata ggacatgggc ttaccatgga 8521 agctatgagg cccccacaca agggtcagcg tcctctctag taaacggggt tgtcaggctc 8581 ctgtcaaaac cctgggatgt ggtgactgga gtcacaggaa tagccatgac cgacaccaca 8641 ccgtatggtc agcaaagagt tttcaaggaa aaagtggaca ctagggtgcc agacccccaa 8701 gaaggcactc gtcaggttat gagcatggtc tcttcctggt tgtggaaaga gctaggcaaa 8761 cacaaacggc cacgagtctg taccaaagaa gagttcatca acaaggttcg tagcaatgca 8821 gcactagggg caatatttga agaggaaaaa gagtggaaga ctgcagtgga agctgtgaac 8881 gatccaaggt tctgggctct agtggacaag gaaagagagc accacctgag aggagagtgc 8941 cagagttgtg tgtacaacat gatgggaaaa agagaaaaga aacaagggga atttggaaag 9001 gccaagggca gccgcgccat ctggtatatg tggctagggg ctagatttct agagttcgaa 9061 gcccttggat tcttgaacga ggatcactgg atggggagag agaactcagg aggtggtgtt 9121 gaagggctgg gattacaaag actcggatat gtcctagaag agatgagtcg cataccagga 9181 ggaaggatgt atgcagatga cactgctggc tgggacaccc gcatcagcag gtttgatctg 9241 gagaatgaag ctctaatcac caaccaaatg gagaaagggc acagggcctt ggcattggcc 9301 ataatcaagt acacatacca aaacaaagtg gtaaaggtcc ttagaccagc tgaaaaaggg 9361 aaaacagtta tggacattat ttcgagacaa gaccaaaggg ggagcggaca agttgtcact 9421 tacgctctta acacatttac caacctagtg gtgcaactca ttcggaatat ggaggctgag 9481 gaagttctcg agatgcaaga cttgtggctg ctgcggaggc cagagaaagt gaccaactgg 9541 ttgcagagca acggatggga taggctcaaa cgaatggcag tcagtggaga tgattgcgtt 9601 gtgaagccaa ttgatgatag gtttgcacat gccctcaggt tcttgaatga tatgggaaaa 9661 gttaggaagg acacacaaga gtggaaaccc tcaactggat gggacaactg ggaagaagtt 9721 ccgttttgct cccaccactt caacaagctc catctcaagg acgggaggtc cattgtggtt 9781 ccctgccgcc accaagatga actgattggc cgggcccgcg tctctccagg ggcgggatgg 9841 agcatccggg agactgcttg cctagcaaaa tcatatgcgc aaatgtggca gctcctttat 9901 ttccacagaa gggacctccg actgatggcc aatgccattt gctcatctgt gccagttgac 9961 tgggttccaa ctgggagaac tacctggtca atccatggaa agggagaatg gatgaccact 10021 gaagacatgc ttgtggtgtg gaacagagtg tggattgagg agaacgacca catggaagac 10081 aagaccccag ttacgaaatg gacagacatt ccctatttgg gaaaaaggga agacttgtgg 10141 tgtggatctc tcatagggca cagaccgcgc accacctggg ctgagaacat taaaaacaca 10201 gtcaacatgg tgcgcaggat cataggtgat gaagaaaagt acatggacta cctatccacc 10261 caagttcgct acttgggtga agaagggtct acacctggag tgctgtaagc accagtctta 10321 atgttgtcag gcctgctagt cagccacagc ttggggaaag ctgtgcagcc tgtgaccccc 10381 ccaggagaag ctgggaaacc aagcctatag tcaggccgag aacgccatgg cacggaagaa 10441 gccatgctgc ctgtgagccc ctcagaggac actgagtcaa aaaaccccac gcgcttggag 10501 gcgcaggatg ggaaaagaag gtggcgacct tccccacc
-
Full Zika 2015 Sequence From Bahia Brazil HS-2015-BA-01
REFERENCE 1 (bases 1 to 10538) AUTHORS Teixeira,M., Herman,B.D., Bassit,L.C. and Schinazi,R.F. TITLE Full coding sequence of the Zika Virus isolate HS-2015-BA-01 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10538) AUTHORS Teixeira,M., Herman,B.D., Bassit,L.C. and Schinazi,R.F. TITLE Direct Submission JOURNAL Submitted (08-JUL-2016) Pediatrics-Laboratory of Biochemical Pharmacology, Emory University, 1760 Haygood Dr NE Room E-450, Atlanta, GA 30322, USAVERSION KX520666.1 GI:1042859933
-
El Salvador Zika Confirmed Microcephaly Cases Increase To Two
Map Update https://www.google.com/maps/d/u/0/edit?mid=1RcVTrkYW6hax_iITjKUkEcBCVeI
-
El Salvador Zika Confirmed Microcephaly Cases Increase To Two
El Salvador confirms second case of microcephaly linked to zika JUL 82016 15h31 0COMMENTSHealth officials in El Salvador today confirmed a second case of microcephaly in a newborn associated with zika and said they expect the same increase. SEE MOREFlorida confirmed the first case of microcephaly by zika Smack in Puerto Rico plans to combat zika with aerial spraying Three babies born in the US with birth defects by zika First case in El Salvador microcephaly by zika El Salvador: confirms first case of zika with microcephaly Elmen epidemiologist Mendoza, Research Unit of the Ministry of Health (MINSAL), told Efe that this is a girl in the eastern department of Ahuachapan who was born on June 6. Mendoza explained that microcephaly suffering the neonate is "moderate", given that at birth the diameter of its head was 30 centimeters, when "normal is 35 to 40". "There are other elements (for cataloging the condition), but the most important thing is to talk the brain perimeter that has the girl, evolution will depend on continuous assessments to be made in the first two years of life, when the brain begins to take the appropriate volume, "said the expert. The first case of this congenital malformation linked to zika was confirmed by the head of MINSAL, Violeta Menjivar, on 14 June. On that occasion, he was a child born in April 2016 in the central department of La Paz. Mendoza said Friday they expect "cases increase and that in two or three months begin to reduce." The epidemiologist explained that this increase would be tied to women who were infected with the disease in the first three months of gestation between November and December 2015, when the existence of the virus was confirmed in this country, would already giving birth. According to a study published in The Lancet, made during an outbreak of the virus between 2014 and 2015 in French Polynesia, one in every hundred infected women during the first trimester of pregnancy risk that the fetus develop microcephaly. So far this year El Salvador has a total of 74 children born with malformation, of which only the two mentioned are related to the zika. Historically this country computes three cases of microcephaly per month, according to the source. Mendoza also noted that in this country a total 318 pregnant women have presented "a picture compatible with zika" since the outbreak was recorded in 2015, of which at least 118 and they gave birth without the neonate present evil birth. In fact, the expert MINSAL stressed that the two confirmed cases of microcephaly are women who have been infected and did not go to a health center because they did not show the characteristic symptoms of the virus. "These children are as safe as they are of those who did not have a clinical picture and now born with microcephaly," explained Mendoza, who said that only one in five infected people develop fever and skin rashes. https://vidayestilo.terra.cl/salud/el-salvador-confirma-segundo-caso-de-microcefalia-ligado-al-zika,70f3728cbd776ee704339d1f5f906ff71jaqye8x.html
-
El Salvador Zika Confirmed Microcephaly Cases Increase To Two
El Salvador confirmed a second case of microcephaly by zikaSAN SALVADOR, July 8 (Reuters / EP). http://www.europapress.es/internacional/noticia-salvador-confirma-segundo-caso-microcefalia-zika-20160708204703.html
-
New York Zika Cases Increase To 404
- Full French Polynesia 2013 Zika Sequence PF13/251013-18
Map Update https://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU- Full French Polynesia 2013 Zika Sequence PF13/251013-18
Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX369547.1|Zika virus strain PF13/251013-18, complete genome1852518525100%0.0100%KX369547.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1848918489100%0.099%KJ776791.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome1845318453100%0.099%KU509998.3Select seq gb|KX280026.1|Zika virus isolate Paraiba_01, complete genome1843518435100%0.099%KX280026.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome1843518435100%0.099%KX051563.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds1842918429100%0.099%KU991811.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1842918429100%0.099%KU321639.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1842018420100%0.099%KU729218.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1842018420100%0.099%KU707826.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1842018420100%0.099%KU365779.1Select seq gb|KX262887.1|Zika virus isolate 103451, complete genome1841718417100%0.099%KX262887.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome1841718417100%0.099%KX197192.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome1840818408100%0.099%KX198135.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome1840818408100%0.099%KX156776.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome1840818408100%0.099%KU926309.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1840818408100%0.099%KU365780.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome1840218402100%0.099%KX117076.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome1840218402100%0.099%KU940228.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1840218402100%0.099%KU527068.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1840218402100%0.099%KU647676.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1840218402100%0.099%KU365777.1Select seq gb|KU758877.1|Zika virus isolate 17271 polyprotein gene, complete cds1839918399100%0.099%KU758877.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome1839918399100%0.099%KX247646.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1839918399100%0.099%KU501217.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome183951839599%0.099%KU497555.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds1839318393100%0.099%KX185891.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome1839318393100%0.099%KX156774.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds1839318393100%0.099%KU963796.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1839318393100%0.099%KU729217.2Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1839318393100%0.099%KU501216.1Select seq gb|KU820897.3|Zika virus isolate FLR polyprotein gene, complete cds1839018390100%0.099%KU820897.3Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome1839018390100%0.099%KX253996.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds1839018390100%0.099%KX247632.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome1839018390100%0.099%KX156775.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome1839018390100%0.099%KX087102.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds1839018390100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1839018390100%0.099%KU820899.2Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1839018390100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1839018390100%0.099%KU312312.1Select seq gb|KU866423.2|Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds1838418384100%0.099%KU866423.2Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome1838418384100%0.099%KU922960.1Select seq gb|KX446951.1|Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome1838118381100%0.099%KX446951.1Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds1838118381100%0.099%KU937936.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome1838118381100%0.099%KU926310.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome1838118381100%0.099%KU922923.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1838118381100%0.099%KU501215.1Select seq gb|KX446950.1|Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome1837518375100%0.099%KX446950.1Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome1837518375100%0.099%KX087101.2Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome1837518375100%0.099%KU870645.1Select seq gb|KX377337.1|Zika virus strain PRVABC-59, complete genome1837218372100%0.099%KX377337.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome1837218372100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome1837018370100%0.099%KU853012.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds1836318363100%0.099%KU820898.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds1835718357100%0.099%KX056898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds1835718357100%0.099%KU955590.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds1835418354100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1835418354100%0.099%KU761564.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome183091830999%0.099%KU940224.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1820418204100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1815018150100%0.099%KU681081.3Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome1784317843100%0.099%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds178431784399%0.099%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds177781777898%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1768817688100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1753317533100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164931649399%0.096%HQ234499.1Select seq gb|KX377336.1|Zika virus strain P6-740, complete genome1648716487100%0.096%KX377336.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1331313313100%0.089%KU720415.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds133081330899%0.089%HQ234498.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1330213302100%0.089%KF383115.1Select seq gb|KX377335.1|Zika virus strain MR-766, complete genome1329913299100%0.089%KX377335.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1329713297100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1329713297100%0.089%KF268948.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1329013290100%0.089%LC002520.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1329013290100%0.089%KF268950.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome1328613286100%0.089%KU955595.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1328613286100%0.089%KF383119.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1327913279100%0.089%DQ859059.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome1327713277100%0.089%KU955592.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds1327413274100%0.089%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome1327413274100%0.089%KU955594.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome1326313746100%0.089%KX198134.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome1325913259100%0.089%KU955591.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1324313243100%0.089%KF383116.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1323213232100%0.089%AY632535.2Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132271322799%0.089%HQ234501.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1316413164100%0.088%KF383117.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds1315813260100%0.088%KU963574.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131561315699%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1296313031100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128821288297%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108591085997%0.084%KF383120.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome50611448287%0.095%KU940227.1Select seq gb|KX212103.1|Zika virus isolate BRZIKV_AB_ES polyprotein gene, partial cds5030503027%0.099%KX212103.1Select seq gb|KU758875.1|Zika virus isolate 15042 polyprotein gene, partial cds4996499627%0.099%KU758875.1Select seq gb|KU758871.1|Zika virus isolate 17170 polyprotein gene, partial cds4993499327%0.099%KU758871.1Select seq gb|KU758870.1|Zika virus isolate 17160 polyprotein gene, partial cds4985498527%0.099%KU758870.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4985498527%0.099%KU312314.1Select seq gb|KU758873.1|Zika virus isolate 18246 polyprotein gene, partial cds4983498327%0.099%KU758873.1Select seq gb|KU758872.1|Zika virus isolate 01170 polyprotein gene, partial cds4971497127%0.099%KU758872.1Select seq gb|KU758876.1|Zika virus isolate 21068 polyprotein gene, partial cds4960496027%0.099%KU758876.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4958495827%0.099%KU312313.1Select seq gb|KU758869.1|Zika virus isolate 05211 polyprotein gene, partial cds4949494926%0.099%KU758869.1Select seq gb|KU758868.1|Zika virus isolate 27229 polyprotein gene, partial cds4924492426%0.099%KU758868.1Select seq gb|KU758874.1|Zika virus isolate 20114 polyprotein gene, partial cds4920492026%0.099%KU758874.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4659465925%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4650465025%0.099%KU646827.1Select seq gb|KX101060.1|Zika virus isolate Bahia02, partial genome42261334475%0.095%KX101060.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3449344918%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3223322317%0.099%KU740199.1Select seq gb|KX101066.1|Zika virus isolate Bahia01, partial genome31221313374%0.099%KX101066.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds2883421395%0.071%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2704270414%0.099%KJ634273.1Select seq gb|KX101064.1|Zika virus isolate Bahia11, partial genome22771082265%0.092%KX101064.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2051205111%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2030203011%0.099%KU179098.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds184718479%0.0100%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds184718479%0.0100%KX059013.1Select seq gb|KX101061.1|Zika virus isolate Bahia03, partial genome18371393478%0.099%KX101061.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds176117619%0.0100%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds175717579%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds175517559%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds175417549%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds175417549%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds175417549%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds175217529%0.099%KM078929.1Select seq gb|KX173841.1|Zika virus isolate 16Z11 envelope protein gene, partial cds166316639%0.099%KX173841.1Select seq gb|KX173840.1|Zika virus isolate 16Z10 envelope protein gene, partial cds166316639%0.099%KX173840.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds161116118%0.0100%KJ873160.1Select seq gb|KX173843.1|Zika virus isolate 16Z62 envelope protein gene, partial cds153215328%0.0100%KX173843.1Select seq gb|KX173844.1|Zika virus isolate 16Z62 envelope protein gene, partial cds152115218%0.0100%KX173844.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds142914297%0.0100%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds139113917%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds135513557%0.098%KM851038.1Select seq gb|KU985087.1|Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds135313537%0.099%KU985087.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds134613467%0.099%KU556802.1Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds1306130610%0.088%AF013415.1Select seq gb|KU724096.1|Zika virus isolate 259249_2015_Panama NS5B gene, partial cds130113017%0.099%KU724096.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds124012406%0.099%KU232300.1Select seq gb|KT200609.1|Zika virus isolate BR/949/15 NS5 gene, partial cds124012406%0.099%KT200609.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds123112316%0.099%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds122912296%0.099%KU232297.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds122012206%0.099%KU232294.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds121812186%0.099%KU232292.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds121412146%0.099%KU232298.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds121112116%0.099%KU232296.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds121112116%0.099%KU232293.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds120512056%0.099%KU232295.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds119511956%0.099%KU232288.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds119111916%0.099%KU232289.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds118711876%0.099%KU232299.1Select seq gb|KX101063.1|Zika virus isolate Bahia05, partial genome1186746342%0.099%KX101063.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds118611866%0.099%KU232291.1Select seq gb|KX101065.1|Zika virus isolate Bahia15, partial genome1184781846%0.099%KX101065.1Select seq gb|KU724097.1|Zika virus isolate 259250_2015_Panama NS5B gene, partial cds117311736%0.099%KU724097.1Select seq gb|KU724098.1|Zika virus isolate 259060_2015_Panama NS5B gene, partial cds116211626%0.099%KU724098.1Select seq gb|KU758878.1|Zika virus polyprotein gene, partial cds113911396%0.099%KU758878.1Select seq gb|KU724099.1|Zika virus isolate 259032_2015_Panama NS5B gene, partial cds109710975%0.099%KU724099.1Select seq gb|KF270886.1|Zika virus strain CCB-870 envelope glycoprotein gene, partial cds107710778%0.089%KF270886.1Select seq gb|KX101062.1|Zika virus isolate Bahia04, partial genome1054736841%0.097%KX101062.1Select seq gb|AF372422.1|AF372422Zika virus envelope protein (E) gene, partial cds102010208%0.087%AF372422.1Select seq gb|KU867812.1|Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds101810185%0.0100%KU867812.1Select seq gb|KF270887.1|Zika virus strain CCB-870 NS3 protein gene, partial cds100010007%0.089%KF270887.1Select seq gb|KF383022.1|Zika virus strain ArD127988 envelope protein gene, partial cds9809807%0.089%KF383022.1Select seq gb|KF383026.1|Zika virus strain ArD127994 envelope protein gene, partial cds9759757%0.089%KF383026.1Select seq gb|EU303241.1|Zika virus note MR766 (p4 15/9/76) nonstructural protein 5 (NS5) gene, partial cds9719717%0.088%EU303241.1Select seq gb|KF383032.1|Zika virus strain ArD30101 envelope protein gene, partial cds9669667%0.088%KF383032.1Select seq gb|KF383034.1|Zika virus strain ArD30156 envelope protein gene, partial cds9629627%0.088%KF383034.1Select seq gb|KF383029.1|Zika virus strain ArD165522 envelope protein gene, partial cds9629627%0.088%KF383029.1Select seq gb|KF383037.1|Zika virus strain ArA506 envelope protein gene, partial cds9609607%0.088%KF383037.1Select seq gb|KF383036.1|Zika virus strain ArA975 envelope protein gene, partial cds9579577%0.088%KF383036.1Select seq gb|KF383033.1|Zika virus strain AnD30332 envelope protein gene, partial cds9579577%0.088%KF383033.1Select seq gb|KU724100.1|Zika virus isolate 259043_2015_Panama NS5B gene, partial cds9449445%0.099%KU724100.1Select seq gb|KF383039.1|Zika virus strain HD78788 envelope protein gene, partial cds9399397%0.088%KF383039.1Select seq gb|KF383028.1|Zika virus strain ArD165531 envelope protein gene, partial cds9399397%0.088%KF383028.1Select seq gb|KF383031.1|Zika virus strain ArD9957 envelope protein gene, partial cds9359357%0.088%KF383031.1Select seq gb|KF383038.1|Zika virus strain ArA986 envelope protein gene, partial cds9309307%0.087%KF383038.1Select seq gb|KF383046.1|Zika virus strain ArA982 envelope protein gene, partial cds9219217%0.087%KF383046.1Select seq gb|KF383045.1|Zika virus strain ArA27106 envelope protein gene, partial cds9069067%0.087%KF383045.1Select seq gb|KF383043.1|Zika virus strain ArA27443 envelope protein gene, partial cds9029027%0.087%KF383043.1Select seq gb|KF383035.1|Zika virus strain MR1429 envelope protein gene, partial cds9019017%0.086%KF383035.1Select seq gb|KF383103.1|Zika virus strain ArA986 nonstructural protein 5 gene, partial cds8978976%0.088%KF383103.1Select seq gb|KF383086.1|Zika virus strain ArA975 nonstructural protein 5 gene, partial cds8978976%0.088%KF383086.1Select seq gb|KF383041.1|Zika virus strain ArA27290 envelope protein gene, partial cds8978977%0.087%KF383041.1Select seq gb|KF383042.1|Zika virus strain ArA27096 envelope protein gene, partial cds8938937%0.086%KF383042.1Select seq gb|KX247638.1|Zika virus isolate Dominican_Rep-Rus-3-2016 polyprotein gene, partial cds8838834%0.0100%KX247638.1Select seq gb|KU978616.1|Zika virus isolate Dominican_Rep-Rus-2-2016 polyprotein gene, partial cds8778774%0.099%KU978616.1Select seq gb|KX101067.1|Zika virus isolate Bahia12, partial genome872854051%0.090%KX101067.1Select seq gb|KF383040.1|Zika virus strain ArA27101 envelope protein gene, partial cds8668667%0.086%KF383040.1Select seq gb|KF383104.1|Zika virus strain ArA982 nonstructural protein 5 gene, partial cds8658656%0.087%KF383104.1Select seq gb|KF383085.1|Zika virus strain ArD9957 nonstructural protein 5 gene, partial cds8658656%0.087%KF383085.1Select seq gb|KF383106.1|Zika virus strain ArA27443 nonstructural protein 5 gene, partial cds8618616%0.087%KF383106.1Select seq gb|KF383114.1|Zika virus strain AnD30332 nonstructural protein 5 gene, partial cds8568566%0.087%KF383114.1Select seq gb|KF383107.1|Zika virus strain ArA27407 nonstructural protein 5 gene, partial cds8568566%0.087%KF383107.1Select seq gb|KF383088.1|Zika virus strain ArD30101 nonstructural protein 5 gene, partial cds8568566%0.087%KF383088.1Select seq gb|KF383087.1|Zika virus strain ArD30156 nonstructural protein 5 gene, partial cds8528526%0.087%KF383087.1Select seq gb|KF383089.1|Zika virus strain ArD165531 nonstructural protein 5 gene, partial cds8388386%0.086%KF383089.1Select seq gb|KF383101.1|Zika virus strain ArD127710 nonstructural protein 5 gene, partial cds8348346%0.086%KF383101.1Select seq gb|KF383097.1|Zika virus strain ArD127994 nonstructural protein 5 gene, partial cds8348346%0.086%KF383097.1Select seq dbj|AB908162.1|Zika virus gene for polyprotein, partial cds, strain: ZIKV Hu/Tahiti/01u/2014NIID8348344%0.099%AB908162.1Select seq gb|KF383099.1|Zika virus strain ArD127987 nonstructural protein 5 gene, partial cds8298296%0.086%KF383099.1Select seq gb|KF383098.1|Zika virus strain ArD127988 nonstructural protein 5 gene, partial cds8258256%0.086%KF383098.1Select seq gb|KU872850.1|Zika virus isolate Dominican Rep-Rus-2016, NS2 partial cds8208204%0.099%KU872850.1Select seq gb|KX253994.1|Zika virus strain ZIKV/Homo sapiens/GER/GER-BNI-P2/2016 polyprotein gene, partial cds8018014%0.099%KX253994.1Select seq gb|KF383084.1|Zika virus strain HD78788 nonstructural protein 5 gene, partial cds7987986%0.085%KF383084.1Select seq gb|KF383113.1|Zika virus strain ArA1465 nonstructural protein 5 gene, partial cds7927926%0.085%KF383113.1Select seq gb|KC754958.1|Usutu virus isolate ArB1803, complete genome791187954%0.068%KC754958.1Select seq gb|HM147824.1|West Nile virus from Democratic Republic of the Congo, complete genome780171053%0.068%HM147824.1Select seq gb|EF429199.1|West Nile virus SA381/00, complete genome760163357%0.068%EF429199.1Select seq gb|KM203863.1|West Nile virus strain Cz 13-502, complete genome738167454%0.068%KM203863.1Select seq gb|KM203860.1|West Nile virus strain Cz 13-104, complete genome724164654%0.067%KM203860.1Select seq gb|KF383017.1|Zika virus strain ArD149938 envelope protein gene, partial cds7177177%0.081%KF383017.1Select seq gb|KF383016.1|Zika virus strain ArD147917 envelope protein gene, partial cds7137137%0.081%KF383016.1Select seq gb|KF383015.1|Zika virus strain ArD149810 envelope protein gene, partial cds7137137%0.081%KF383015.1Select seq gb|KF383020.1|Zika virus strain ArA1465 envelope protein gene, partial cds7087087%0.081%KF383020.1Select seq gb|KF383021.1|Zika virus strain ArD132912 envelope protein gene, partial cds7067067%0.081%KF383021.1Select seq gb|KF258813.1|Zika virus isolate Java non-structural protein 5 mRNA, partial cds6996993%0.099%KF258813.1Select seq gb|KF383019.1|Zika virus strain ArD132915 envelope protein gene, partial cds6906907%0.080%KF383019.1Select seq gb|KX253995.1|Zika virus strain ZIKV/Homo sapiens/PRI/PRI-BNI-P1/2016 polyprotein gene, partial cds6756753%0.099%KX253995.1Select seq gb|KF383092.1|Zika virus strain ArD147917 nonstructural protein 5 gene, partial cds6556556%0.081%KF383092.1Select seq gb|KF383093.1|Zika virus strain ArD149810 nonstructural protein 5 gene, partial cds6546546%0.080%KF383093.1Select seq gb|KU985088.1|Zika virus isolate MEX/InDRE/Zika-2/2015 envelope protein gene, partial cds6506503%0.0100%KU985088.1Select seq gb|KF383095.1|Zika virus strain ArD132915 nonstructural protein 5 gene, partial cds6486486%0.080%KF383095.1Select seq gb|KF383091.1|Zika virus strain ArD149938 nonstructural protein 5 gene, partial cds6456456%8e-18080%KF383091.1Select seq gb|KX062045.1|Zika virus isolate Haiti/1230/2014 envelope protein gene, partial cds6306303%2e-175100%KX062045.1Select seq gb|KX062044.1|Zika virus isolate Haiti/1227/2014 envelope protein gene, partial cds6256253%7e-17499%KX062044.1Select seq emb|FM210240.2|Dengue virus 2 isolate MD1273, complete genome616142259%4e-17169%FM210240.2Select seq gb|DQ181799.1|Dengue virus type 2 strain ThD2_0017_98, complete genome614164748%1e-17069%DQ181799.1Select seq gb|AF100462.1|AF100462Dengue virus type 2 strain C0390 polyprotein gene, complete cds609162052%6e-16969%AF100462.1Select seq gb|GQ868633.1|Dengue virus 1 isolate DENV-1/IPC/BID-V3793/2008, complete genome600145442%3e-16669%GQ868633.1Select seq gb|KX173842.1|Zika virus isolate 16Z08 envelope protein gene, partial cds5895893%5e-16399%KX173842.1Select seq gb|KR815989.1|Zika virus isolate 15095 envelope protein gene, partial cds5875873%2e-16299%KR815989.1Select seq gb|EU529701.1|Dengue virus 2 isolate DENV-2/US/BID-V1087/1991, complete genome587167948%2e-16268%EU529701.1Select seq gb|JN819408.1|Dengue virus 2 isolate DENV-2/VE/BID-V2161/2001, complete genome583159948%2e-16169%JN819408.1Select seq gb|GU131887.1|Dengue virus 1 isolate DENV-1/IPC/BID-V3775/2006, complete genome581153942%8e-16168%GU131887.1Select seq gb|EU482580.1|Dengue virus 2 isolate DENV-2/US/BID-V1177/1989, complete genome578165948%1e-15968%EU482580.1Select seq gb|EU569702.1|Dengue virus 2 isolate DENV-2/NI/BID-V1228/2007, complete genome574163650%1e-15868%EU569702.1Select seq gb|EU596483.1|Dengue virus 2 isolate DENV-2/NI/BID-V608/2006, complete genome571164750%1e-15768%EU596483.1Select seq gb|JN819407.1|Dengue virus 2 isolate DENV-2/VE/BID-V2613/2007, complete genome569161445%5e-15768%JN819407.1Select seq gb|FJ898466.1|Dengue virus 2 isolate DENV-2/VE/BID-V2942/2000, complete genome565158448%6e-15668%FJ898466.1Select seq gb|KR816334.1|Zika virus isolate BR/UFBA/LabViro/Ex1 envelope protein gene, partial cds5455452%6e-15099%KR816334.1Select seq gb|KR816333.1|Zika virus isolate BR/UFBA/LabViro/23 envelope protein gene, partial cds5445442%2e-14999%KR816333.1Select seq gb|KR816335.1|Zika virus isolate BR/UFBA/LabViro/18 envelope protein gene, partial cds5405402%2e-14899%KR816335.1Select seq gb|KM212966.1|Zika virus isolate NC13(FP)-26112013-22072 glycoprotein gene, partial cds5355352%1e-146100%KM212966.1Select seq gb|KM212965.1|Zika virus isolate NC13(FP)-20112013-22015 glycoprotein gene, partial cds5295292%4e-14599%KM212965.1Select seq gb|KM212964.1|Zika virus isolate NC14-17042014-4554 glycoprotein gene, partial cds5295292%4e-14599%KM212964.1Select seq gb|KM212963.1|Zika virus isolate NC14-23012014-250 glycoprotein gene, partial cds5295292%4e-14599%KM212963.1Select seq gb|KJ579441.1|Zika virus isolate PF13-CP221013c polyprotein gene, partial cds5085082%1e-138100%KJ579441.1Select seq gb|KJ680134.1|Zika virus strain PF13-091213-121 polyprotein gene, partial cds5025022%6e-13799%KJ680134.1Select seq gb|KX261853.1|Zika virus isolate ZIKCOL10 polyprotein gene, partial cds4464462%4e-12099%KX261853.1- Full French Polynesia 2013 Zika Sequence PF13/251013-18
LOCUS KX369547 10769 bp RNA linear VRL 05-JUL-2016 DEFINITION Zika virus strain PF13/251013-18, complete genome. ACCESSION KX369547 VERSION KX369547.1 GI:1040461413 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10769) AUTHORS Troesemeier,J.-H., Musso,D., Bluemel,J. and Baylis,S.A. TITLE Genome sequence of a candidate World Health Organization reference strain for Zika virus for nucleic acid testing JOURNAL Unpublished REFERENCE 2 (bases 1 to 10769) AUTHORS Troesemeier,J.-H., Musso,D., Bluemel,J. and Baylis,S.A. TITLE Direct Submission JOURNAL Submitted (08-JUN-2016) Microbiology, Paul-Ehrlich-Institute, Paul-Ehrlich-Str. 51-59, Langen, Hessen 63225, Germany COMMENT ##Assembly-Data-START## Assembly Method :: MIRA v. 4.0.2; BWA v. 0.7.13 Coverage :: 120 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10769 /organism="Zika virus" /mol_type="genomic RNA" /strain="PF13/251013-18" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="French Polynesia" /collection_date="25-Oct-2013" 5'UTR 1..90 CDS 91..10362 /codon_start=1 /product="polyprotein" /protein_id="ANN44857.1" /db_xref="GI:1040461414" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGLALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLEHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPMLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" mat_peptide 91..465 /product="capsid protein" mat_peptide 466..735 /product="propeptide" mat_peptide 736..960 /product="membrane protein" mat_peptide 961..2475 /product="envelope protein" mat_peptide 2476..3561 /product="NS1" mat_peptide 3562..4215 /product="NS2A" mat_peptide 4216..4647 /product="NS2B" mat_peptide 4648..6456 /product="NS3" mat_peptide 6457..6897 /product="NS4A" mat_peptide 6898..8403 /product="NS4B" mat_peptide 8404..10359 /product="NS5" 3'UTR 10363..10661 ORIGIN 1 gaatcagact gcgacagttc gagtttgaag cgaaagctag caacagtatc aacaggtttt 61 atttggattt ggaaacgaga gtttctggtc atgaaaaacc caaaaaagaa atccggagga 121 ttccggattg tcaatatgct aaaacgcgga gtagcccgtg tgagcccctt tgggggcttg 181 aagaggctgc cagccggact tctgctgggt catgggccca tcaggatggt cttggcgatt 241 ctagcctttt tgagattcac ggcaatcaag ccatcactgg gtctcatcaa tagatggggt 301 tcagtgggga aaaaagaggc tatggaaata ataaagaagt tcaagaaaga tctggctgcc 361 atgctgagaa taatcaatgc taggaaggag aagaagagac gaggcgcaga tactagtgtc 421 ggaattgttg gcctcctgct gaccacagct atggcagcgg aggtcactag acgtgggagt 481 gcatactata tgtacttgga cagaaacgat gctggggagg ccatatcttt tccaaccaca 541 ttggggatga ataagtgtta tatacagatc atggatcttg gacacatgtg tgatgccacc 601 atgagctatg aatgccctat gctggatgag ggggtggaac cagatgacgt cgattgttgg 661 tgcaacacga cgtcaacttg ggttgtgtac ggaacctgcc atcacaaaaa aggtgaagca 721 cggagatcta gaagagctgt gacgctcccc tcccattcca ctagaaagct gcaaacgcgg 781 tcgcaaacct ggttggaatc aagagaatac acaaagcact tgattagagt cgaaaattgg 841 atattcagga accctggcct cgcgttagca gcagctgcca tcgcttggct tttgggaagc 901 tcaacgagcc aaaaagtcat atacttggtc atgatactgc tgattgcccc ggcatacagc 961 atcaggtgca taggagtcag caatagggac tttgtggaag gtatgtcagg tgggacttgg 1021 gttgatgttg tcttggaaca tggaggttgt gtcaccgtaa tggcacagga caaaccgact 1081 gtcgacatag agctggttac aacaacagtc agcaacatgg cggaggtaag atcctactgc 1141 tatgaggcat caatatcaga catggcttcg gacagccgct gcccaacaca aggtgaagcc 1201 taccttgaca agcaatcaga cactcaatat gtctgcaaaa gaacgttagt ggacagaggc 1261 tggggaaatg gatgtggact ttttggcaaa gggagcctgg tgacatgcgc taagtttgca 1321 tgctccaaga aaatgaccgg gaagagcatc cagccagaga atctggagta ccggataatg 1381 ctgtcagttc atggctccca gcacagtggg atgatcgtta atgacacagg acatgaaact 1441 gatgagaata gagcgaaggt tgagataacg cccaattcac caagagccga agccaccctg 1501 gggggttttg gaagcctagg acttgattgt gaaccgagga caggccttga cttttcagat 1561 ttgtattact tgactatgaa taacaagcac tggttggttc acaaggagtg gttccacgac 1621 attccattac cttggcacgc tggggcagac accggaactc cacactggaa caacaaagaa 1681 gcactggtag agttcaagga cgcacatgcc aaaaggcaaa ctgtcgtggt tctagggagt 1741 caagaaggag cagttcacac ggcccttgct ggagctctgg aggctgagat ggatggtgca 1801 aagggaaggc tgtcctctgg ccacttgaaa tgtcgcctga aaatggataa acttagattg 1861 aagggcgtgt catactcctt gtgtaccgca gcgttcacat tcaccaagat cccggctgaa 1921 acactgcacg ggacagtcac agtggaggta cagtacgcag ggacagatgg accttgcaag 1981 gttccagctc agatggcggt ggacatgcaa actctgaccc cagttgggag gttgataacc 2041 gctaaccccg taatcactga aagcactgag aactctaaga tgatgctgga acttgatcca 2101 ccatttgggg actcttacat tgtcatagga gtcggggaga agaagatcac ccaccactgg 2161 cacaggagtg gcagcaccat tggaaaagca tttgaagcca ctgtgagagg tgccaagaga 2221 atggcagtct tgggagacac agcctgggac tttggatcag ttggaggcgc tctcaactca 2281 ttgggcaagg gcatccatca aatttttgga gcagctttca aatcattgtt tggaggaatg 2341 tcctggttct cacaaattct cattggaacg ttgctgatgt ggttgggtct gaacacaaag 2401 aatggatcta tttcccttat gtgcttggcc ttagggggag tgttgatctt cttatccaca 2461 gccgtctctg ctgatgtggg gtgctcggtg gacttctcaa agaaggagac gagatgcggt 2521 acaggggtgt tcgtctataa cgacgttgaa gcctggaggg acaggtacaa gtaccatcct 2581 gactcccccc gtagattggc agcagcagtc aagcaagcct gggaagatgg tatctgtggg 2641 atctcctctg tttcaagaat ggaaaacatc atgtggagat cagtagaagg ggagctcaac 2701 gcaatcctgg aagagaatgg agttcaactg acggtcgttg tgggatctgt aaaaaacccc 2761 atgtggagag gtccacagag attgcccgtg cctgtgaacg agctgcccca cggctggaag 2821 gcttggggga aatcgtactt cgtcagagca gcaaagacaa ataacagctt tgtcgtggat 2881 ggtgacacac tgaaggaatg cccactcgaa catagagcat ggaacagctt tcttgtggag 2941 gatcatgggt tcggggtatt tcacactagt gtctggctca aggttagaga agattattca 3001 ttagagtgtg atccagccgt tattggaaca gctgttaagg gaaaggaggc tgtacacagt 3061 gatctaggct actggattga gagtgagaag aatgacacat ggaggctgaa gagggcccat 3121 ctgatcgaga tgaaaacatg tgaatggcca aagtcccaca cattgtggac agatggaata 3181 gaagagagtg atctgatcat acccaagtct ttagctgggc cactcagcca tcacaatacc 3241 agagagggct acaggaccca aatgaaaggg ccatggcaca gtgaagagct tgaaattcgg 3301 tttgaggaat gcccaggcac taaggtccac gtggaggaaa catgtggaac aagaggacca 3361 tctctgagat caaccactgc aagcggaagg gtgatcgagg aatggtgctg cagggagtgc 3421 acaatgcccc cactgtcgtt ccgggctaaa gatggctgtt ggtatggaat ggagataagg 3481 cccaggaaag aaccagaaag taacttagta aggtcaatgg tgactgcagg atcaactgat 3541 cacatggatc acttctccct tggagtgctt gtgattctgc tcatggtgca ggaagggctg 3601 aagaagagaa tgaccacaaa gatcatcata agcacatcaa tggcagtgct ggtagctatg 3661 atcctgggag gattttcaat gagtgacctg gctaagcttg caattttgat gggtgccacc 3721 ttcgcggaaa tgaacactgg aggagatgta gctcatctgg cgctgatagc ggcattcaaa 3781 gtcagaccag cgttgctggt atctttcatc ttcagagcta attggacacc ccgtgaaagc 3841 atgctgctgg ccttggcctc gtgtcttttg caaactgcga tctccgcctt ggaaggcgac 3901 ctgatggttc tcatcaatgg ttttgctttg gcctggttgg caatacgagc gatggttgtt 3961 ccacgcactg ataacatcac cttggcaatc ctggctgctc tgacaccact ggcccggggc 4021 acactgcttg tggcgtggag agcaggcctt gctacttgcg gggggtttat gctcctctct 4081 ctgaagggaa aaggcagtgt gaagaagaac ttaccatttg tcatggccct gggactaacc 4141 gctgtgaggc tggtcgaccc catcaacgtg gtgggactgc tgttgctcac aaggagtggg 4201 aagcggagct ggccccctag cgaagtactc acagctgttg gcctgatatg cgcattggct 4261 ggagggttcg ccaaggcaga tatagagatg gctgggccca tggccgcggt cggtctgcta 4321 attgtcagtt acgtggtctc aggaaagagt gtggacatgt acattgaaag agcaggtgac 4381 atcacatggg aaaaagatgc ggaagtcact ggaaacagtc cccggctcga tgtggcgcta 4441 gatgagagtg gtgatttctc cctggtggag gatgacggtc cccccatgag agagatcata 4501 ctcaaggtgg tcctgatgac catctgtggc atgaacccaa tagccatacc ctttgcagct 4561 ggagcgtggt acgtatacgt gaagactgga aaaaggagtg gtgctctatg ggatgtgcct 4621 gctcccaagg aagtaaaaaa gggggagacc acagatggag tgtacagagt aatgactcgt 4681 agactgctag gttcaacaca agttggagtg ggagttatgc aagagggggt ctttcacact 4741 atgtggcacg tcacaaaagg atccgcgctg agaagcggtg aagggagact tgatccatac 4801 tggggagatg tcaagcagga tctggtgtca tactgtggtc catggaagct agatgccgcc 4861 tgggacgggc acagcgaggt gcagctcttg gccgtgcccc ccggagagag agcgaggaac 4921 atccagactc tgcccggaat atttaagaca aaggatgggg acattggagc ggttgcgctg 4981 gattacccag caggaacttc aggatctcca atcctagaca agtgtgggag agtgatagga 5041 ctttatggca atggggtcgt gatcaaaaat gggagttatg ttagtgccat cacccaaggg 5101 aggagggagg aagagactcc tgttgagtgc ttcgagcctt cgatgctgaa gaagaagcag 5161 ctaactgtct tagacttgca tcctggagct gggaaaacca ggagagttct tcctgaaata 5221 gtccgtgaag ccataaaaac aagactccgt actgtgatct tagctccaac cagggttgtc 5281 gctgctgaaa tggaggaagc ccttagaggg cttccagtgc gttatatgac aacagcagtc 5341 aatgtcaccc actctggaac agaaatcgtc gacttaatgt gccatgccac cttcacttca 5401 cgtctactac agccaatcag agtccccaac tataatctgt atattatgga tgaggcccac 5461 ttcacagatc cctcaagtat agcagcaaga ggatacattt caacaagggt tgagatgggc 5521 gaggcggctg ccatcttcat gaccgccacg ccaccaggaa cccgtgacgc atttccggac 5581 tccaactcac caattatgga caccgaagtg gaagtcccag agagagcctg gagctcaggc 5641 tttgattggg tgacggatca ttctggaaaa acagtttggt ttgttccaag cgtgaggaac 5701 ggcaatgaga tcgcagcttg tctgacaaag gctggaaaac gggtcataca gctcagcaga 5761 aagacttttg agacagagtt ccagaaaaca aaacatcaag agtgggactt tgtcgtgaca 5821 actgacattt cagagatggg cgccaacttt aaagctgacc gtgtcataga ttccaggaga 5881 tgcctaaagc cggtcatact tgatggcgag agagtcattc tggctggacc catgcctgtc 5941 acacatgcca gcgctgccca gaggaggggg cgcataggca ggaatcccaa caaacctgga 6001 gatgagtatc tgtatggagg tgggtgcgca gagactgacg aagaccatgc acactggctt 6061 gaagcaagaa tgctccttga caatatttac ctccaagatg gcctcatagc ctcgctctat 6121 cgacctgagg ccgacaaagt agcagccatt gagggagagt tcaagcttag gacggagcaa 6181 aggaagacct ttgtggaact catgaaaaga ggagatcttc ctgtttggct ggcctatcag 6241 gttgcatctg ccggaataac ctacacagat agaagatggt gctttgatgg cacgaccaac 6301 aacaccataa tggaagacag tgtgccggca gaggtgtgga ccagacacgg agagaaaaga 6361 gtgctcaaac cgaggtggat ggacgccaga gtttgttcag atcatgcggc cctgaagtca 6421 ttcaaggagt ttgccgctgg gaaaagagga gcggcttttg gagtgatgga agccctggga 6481 acactgccag gacacatgac agagagattc caggaagcca ttgacaacct cgctgtgctc 6541 atgcgggcag agactggaag caggccttac aaagccgcgg cggcccaatt gccggagacc 6601 ctagagacca ttatgctttt ggggttgctg ggaacagtct cgctgggaat ctttttcgtc 6661 ttgatgagga acaagggcat agggaagatg ggctttggaa tggtgactct tggggccagc 6721 gcatggctca tgtggctctc ggaaattgag ccagccagaa ttgcatgtgt cctcattgtt 6781 gtgttcctat tgctggtggt gctcatacct gagccagaaa agcaaagatc tccccaggac 6841 aaccaaatgg caatcatcat catggtagca gtaggtcttc tgggcttgat taccgccaat 6901 gaactcggat ggttggagag aacaaagagt gacctaagcc atctaatggg aaggagagag 6961 gagggggcaa ccataggatt ctcaatggac attgacctgc ggccagcctc agcttgggcc 7021 atctatgctg ccttgacaac tttcattacc ccagccgtcc aacatgcagt gaccacttca 7081 tacaacaact actccttaat ggcgatggcc acgcaagctg gagtgttgtt tggtatgggc 7141 aaagggatgc cattctacgc atgggacttt ggagtcccgc tgctaatgat aggttgctac 7201 tcacaattaa cacccctgac cctaatagtg gccatcattt tgctcgtggc gcactacatg 7261 tacttgatcc cagggctgca ggcagcagct gcgcgtgctg cccagaagag aacggcagct 7321 ggcatcatga agaaccctgt tgtggatgga atagtggtga ctgacattga cacaatgaca 7381 attgaccccc aagtggagaa aaagatggga caggtgctac tcatagcagt agccgtctcc 7441 agcgccatac tgtcgcggac cgcctggggg tggggggagg ctggggccct gatcacagct 7501 gcaacttcca ctttgtggga aggctctccg aacaagtact ggaactcctc tacagccact 7561 tcactgtgta acatttttag gggaagttac ttggctggag cttctctaat ctacacagta 7621 acaagaaacg ctggcttggt caagagacgt gggggtggaa caggagagac cctgggagag 7681 aaatggaagg cccgcttgaa ccagatgtcg gccctggagt tctactccta caaaaagtca 7741 ggcatcaccg aggtgtgcag agaagaggcc cgccgcgccc tcaaggacgg tgtggcaacg 7801 ggaggccatg ctgtgtcccg aggaagtgca aagctgagat ggttggtgga gcggggatac 7861 ctgcagccct atggaaaggt cattgatctt ggatgtggca gagggggctg gagttactac 7921 gccgccacca tccgcaaagt tcaagaagtg aaaggataca caaaaggagg ccctggtcat 7981 gaagaaccca tgttggtgca aagctatggg tggaacatag tccgtcttaa gagtggggtg 8041 gacgtctttc atatggcggc tgagccgtgt gacacgttgc tgtgtgacat aggtgagtca 8101 tcatctagtc ctgaagtgga agaagcacgg acgctcagag tcctctccat ggtgggggat 8161 tggcttgaaa aaagaccagg agccttttgt ataaaagtgt tgtgcccata caccagcact 8221 atgatggaaa ccctggagcg actgcagcgt aggtatgggg gaggactggt cagagtgcca 8281 ctctcccgca actctacaca tgagatgtac tgggtctctg gagcgaaaag caacaccata 8341 aaaagtgtgt ccaccacgag ccagctcctc ttggggcgca tggacgggcc caggaggcca 8401 gtgaaatatg aggaggatgt gaatctcggc tctggcacgc gggctgtggt aagctgcgct 8461 gaagctccca acatgaagat cattggtaac cgcattgaaa ggatccgcag tgagcacgcg 8521 gaaacgtggt tctttgacga gaaccaccca tataggacat gggcttacca tggaagctat 8581 gaggccccca cacaagggtc agcgtcctct ctaataaacg gggttgtcag gctcctgtca 8641 aaaccctggg atgtggtgac tggagtcaca ggaatagcca tgaccgacac cacaccgtat 8701 ggtcagcaaa gagttttcaa ggaaaaagtg gacactaggg tgccagaccc ccaagaaggc 8761 actcgtcagg ttatgagcat ggtctcttcc tggttgtgga aagagctagg caaacacaaa 8821 cggccacgag tctgtaccaa agaagagttc atcaacaagg ttcgtagcaa tgcagcatta 8881 ggggcaatat ttgaagagga aaaagagtgg aagactgcag tggaagctgt gaacgatcca 8941 aggttctggg ctctagtgga caaggaaaga gagcaccacc tgagaggaga gtgccagagt 9001 tgtgtgtaca acatgatggg aaaaagagaa aagaaacaag gggaatttgg aaaggccaag 9061 ggcagccgcg ccatctggta tatgtggcta ggggctagat ttctagagtt cgaagccctt 9121 ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg tgttgaaggg 9181 ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc aggaggaagg 9241 atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga tctggagaat 9301 gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt ggccataatc 9361 aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa agggaagaca 9421 gttatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt cacttacgct 9481 cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc tgaggaagtt 9541 ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa ctggttgcag 9601 agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg cgttgtgaag 9661 ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg aaaagttagg 9721 aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga agttccgttt 9781 tgctcccacc acttcaacaa gctccatctc aaggacggga ggtccattgt ggttccctgc 9841 cgccaccaag atgaactgat tggccgggcc cgcgtctctc caggggcggg atggagcatc 9901 cgggagactg cttgcctagc aaaatcatat gcgcaaatgt ggcagctcct ttatttccac 9961 agaagggacc tccgactgat ggccaatgcc atttgttcat ctgtgccagt tgactgggtt 10021 ccaactggga gaactacctg gtcaatccat ggaaagggag aatggatgac cactgaagac 10081 atgcttgtgg tgtggaacag agtgtggatt gaggagaacg accacatgga agacaagacc 10141 ccagttacga aatggacaga cattccctat ttgggaaaaa gggaagactt gtggtgtgga 10201 tctctcatag ggcacagacc gcgcaccacc tgggctgaga acattaaaaa cacagtcaac 10261 atggtgcgca ggatcatagg tgatgaagaa aagtacatgg actacctatc cacccaagtt 10321 cgctacttgg gtgaagaagg gtctacacct ggagtgctgt aagcaccaat cttagtgttg 10381 tcaggcctgc tagtcagcca cagcttgggg aaagctgtgc agcctgtgac ccccccagga 10441 gaagctggga aaccaagcct atagtcaggc cgagaacgcc atggcacgga agaagccatg 10501 ctgcctgtga gcccctcaga ggacactgag tcaaaaaacc ccacgcgctt ggaggcgcag 10561 gatgggaaaa gaaggtggcg accttcccca cccttcaatc tggggcctga actggagatc 10621 agctgtggat ctccagaaga gggactagtg gttagaggag accccccgga aaacgcaaaa 10681 cagcatattg acgctgggaa agaccagaga ctccatgagt ttccaccacg ctggccgcca 10741 ggcacagatc gccgaatagc ggcggccgg- Full French Polynesia 2013 Zika Sequence PF13/251013-18
Paul-Ehrlich-Institute has released a full 2013 Zika sequence collected Oct 25, 2013, PF13/251013-18. This isolate is distinct from the only prior full Zika sequence (collected Nov 28, 2013, H/PF/2013).- Confirmed Microcephaly Cases In Brazil Increases To 1656
Registration Date: 07/07/2016 17:07:01 the amended 07/07/2016 17:07:01 theREPORT CARD Ministry of Health confirmed 1,656 cases of microcephalyThe weekly report gathers information submitted by state health departments until July 2. Other 3,130 cases remain under investigation The Ministry of Health released, on Thursday (07), microcephaly new data. Until July 2, it was confirmed 1,656 cases of microcephaly and other nervous system disorders, suggestive of congenital infection throughout the country. Other 3,130 suspected cases of microcephaly across the country remain under investigation by the Ministry of Health and the states. Since the beginning of the investigation, in October last year, 8,301 cases were reported to the Ministry of Health. Of these, 3,515 were discarded because of exams normal, or because theyhave microcephaly or malformations confirmed because noninfectious. Were also discarded by do not meet the case definition. Of the total confirmed cases, 255 were confirmed by specific laboratory criteria for Zika virus.The Ministry of Health, however, points out that this figure does not represent adequately the total number of cases related to the virus. The folder considers that there was infection Zika most of the mothers who had babies with a final diagnosis of microcephaly. The 1,656 confirmed cases in Brazil occurred in 588 municipalities located in all Brazilian states and the Federal District. The mortality rate in the same period, there were 334 suspected deaths of microcephaly and / or alteration of the central nervous system after childbirth or during pregnancy (miscarriage or stillbirth) in the country. This represents 4% of the total reported cases. Of these, 92 were confirmed to microcephaly and / or alteration of the central nervous system. Other 184 are still under investigation and 58 were discarded. The Ministry of Health says it is investigating all cases of microcephaly and other disorders of the central nervous system informed by the states, as well as possible relationship with the Zika virus and other congenital infections. Microcephaly may be caused by , various infectious agents beyond Zika as Syphilis, Toxoplasmosis, Other Infectious Agents, Rubella, Cytomegalovirus and Herpes Viral. The folder guides pregnant women adopt measures to reduce the presence of Aedes aegypti, the elimination of breeding, and protect themselves from mosquito exposure, keeping doors and windows closed or screened, wear pants and long sleeved shirts and use repellents allowed to pregnant women. Distribution of reported cases of microcephaly by UF until July 2, 2016 Regions and Federative UnitsMicrocephaly cases and / or malformations suggestive of congenital infection Total acumulado1 of reported cases from 2015 to 2016 research confirmed 2.3 Descartados4 Brazil 3,130 1,656 3,515 8,301 Alagoas 67 77 181 325 Bahia 659 265 251 1,175 Ceará 175 125 221 521 Maranhão 89 131 62 282 Paraíba 262 148 479 889 Pernambuco 489 367 1,173 2,029 Piauí 14 89 73 176 large northern river 261 113 66 440 Sergipe 74 114 54 242 Northeast 2,090 1,429 2,560 6,079 Holy Spirit 85 14 61 160 Minas Gerais 64 13 55 122 Rio de Janeiro 286 83 168 537 Sao Paulo 290th 10b 179 479 Southeast region 725 110 463 1,298 Acre 11 two 27 40 Amapá 1 7 3 11 Amazon 12 8 5 25 For 45 1 0 46 Rondônia 5 5 7 17 Roraima 5 10 11 26 Tocantins 59 17 88 164 North region 138 50 141 329 Federal district two 6 39 47 Goiás 50 14 81 145 Mato Grosso 89 31 120 240 Mato Grosso do Sul 3 5 14 22 Midwest region 144 56 254 454 Paraná two 4 31 37 Santa Catarina two 1 5 8 Rio Grande do Sul 29 6 61 96 South region 33 11 97 141 Cumulative number of reported cases that met the definition of previous operating case (33 cm), and the definitions adopted in Surveillance Protocol (from 12/09/2015) that defined the Head Circumference 32 cm for newborns to 37 or more weeks of gestation and other protocol definitions. Present typical changes: indicative of congenital infection, such as cerebral calcifications, ventricular changes and posterior fossa and other clinical signs observed by any imaging method or identification of Zika virus in laboratory tests.255 cases were confirmed by specific laboratory criteria for Zika (PCR and serology technique) virus. In relation to SE 25, a reduction in the number of cases confirmed by laboratory testing because of the state of Pernambuco have rectified the amount of confirmed cases this criterion;Discarded have normal exams by presenting microcephaly and / or congenital malformations confirmed by non - infectious causes or does not meet the case definitions. A. As reported by the Epidemiological Surveillance Center "Prof. Alexandre Vranjac ", the State Secretary of Health of São Paulo, 290 cases are under investigation for congenital infection. Of these, 38 are possibly associated with infection by Zika virus, but have not yet finalized the investigation. B. 01 confirmed case of microcephaly Virus Zika in newborn with suspected infection site in another UF. Service Press Release (61) 3315-3580 / 2745 http://portalsaude.saude.gov.br/index.php/cidadao/principal/agencia-saude/24437-ministerio-da-saude-confirma-1-656-casos-de-microcefalia- Four Suspect Zika Microcephaly Cases In Guatemala
four possible cases of microcephaly are reported zika Health authorities in Guatemala study four children who were born with smaller than normal head, but whose mothers have suffered from this evil. Filed in:Guatemala,Ministry of Health,Health,ZikaBy Andrea Orozco and Geldi Muñoz July 7, 2016 at 12: 02h Edgar Arana, Health Ministry spokesman confirmed that four children were born with this anomaly, one in Escuintla and three in Suchitepequez. The Aedes Aegypti and Aedes albopictus mosquito is transmitting Dengue, Chikugunya and Zika virus. "In none of them are mothers -the process of pregnancy was followed by the Ministry. He indicated that the particular doctor that tried told them they could have had zika and they did tests, both babies and mothers, to determine if there was presence of zika, and were negative, "he said. Arana said samples to the Center for Disease Control and Prevention (CDC in English) in the United States for a second evaluation were sent, and the results will be known when that entity to provide its findings. "But at the moment it is false that there is a birth of microcephaly associated with zika already proven," he said. Carlos Soto, director of the Roosevelt Hospital, differs with respect Arana Health, as indicated last June that attended a patient who was admitted with diagnosed zika and this gave birth to a baby with microcephaly. "We did all the tests to the newborn. They have not returned National Laboratory, but he did all the other tests were negative and the patient. He also did a CT scan and found the child itself is obviously microcephaly "he said. Soto, however, stressed that they have the lab results may be certain if the child contracted zika. "Obviously, if we zika mother, newborn with microcephaly, and other negative tests for microcephaly, then I think it could be microcephaly by zika" he said. The doctor said the patient was referred to a sanatorium in Mazatenango, Suchitepequez. Arana said that since November 15, 2015 to June 25 last reported 453 newly confirmed cases zika two thousand 76 suspects. Besides that period recorded in 109 pregnant women, of which 36 babies were born. "We all are healthy, none have been reported with congenital anomaly," he said. Read also: Zika, a latent threat in GuatemalaThe official explained that the laboratory tests to confirm or exclude that children have been infected with the virus, and that mothers have had the disease, were sent to the Center for Disease Control (CDC in English), for a second opinion as those practiced in the country were negative. The results of the second tests are in Guatemala within a month. http://www.prensalibre.com/guatemala/comunitario/salud-reporta-cuatro-posibles-casos-de-microcefalia-por-zika- Four Suspect Zika Microcephaly Cases In Guatemala
four possible cases of microcephaly are reported zikaLaboratory tests are carried out in Guatemala, USA.UU. and Brazil, to confirm the diagnosis. Filed in:microcephaly,Ministry of Health,Health,ZikaBy Andrea Orozco and Geldi Muñoz July 7, 2016 at 12: 02hEdgar Arana, ministry spokesperson, told Prensa Libre that two of the births occurred in Suchitepequez, Escuintla and another one in the Roosevelt Hospital. Still no dates which were recorded births is determined. According to Arana, the mothers had no prenatal care in the public sector and only attended the national hospital for the birth of children. Read also: Zika, a latent threat in GuatemalaThe official explained that the laboratory tests to confirm or exclude that children have been infected with the virus, and that mothers have had the disease, were sent to the Center for Disease Control (CDC in English), for a second opinion as those practiced in the country were negative. The results of the second tests are in Guatemala within a month. TransferRoosevelt Hospital director, Carlos Soto, said the birth at the hospital occurred in June, of a mother who came referred to Mazatenango, Suchitepequez. According to the doctor, the woman would have her child in a private hospital, but when doctors realized that the child's skull was smaller than normal and followed the protocol referred to that hospital. The background Mother confirmed that she was infected with zika, but laboratory samples of the child were sent to the National Health Laboratory and Brazil to determine if the baby also contracted the virus and, if positive, have a reconfirmation . This is the first birth of a child with microcephaly, because zika, who served in the Roosevelt Hospital. Health spokesman indicated that registered the birth of 34 children who are healthy and whose mothers were infected with the virus. Read also: Gives birth first woman infected with zika in GuatemalaIn figuresUntil 4 June, health authorities confirmed 343 cases of zika in the country and 534 thousand suspected cases. The departments reported more confirmed cases are Suchitepequez, 51; Guatemala, 49; and Santa Rosa, 31. As suspects leads Santa Rosa, 266; Quetzaltenango, 261; and Zacapa, 183. Of the 343 confirmed cases, 85 are pregnant women, 14 of which are in Suchitepequez and 11 in Quetzaltenango. http://www.prensalibre.com/guatemala/comunitario/salud-reporta-cuatro-posibles-casos-de-microcefalia-por-zika- New York Zika Cases Increase To 403
21 Pregnancy Registry cases- Confirmed Zika Microcephaly Cases In Colombia Increase To 13
intensified surveillance of microcephaly Review July 1, 2016 Among the epidemiological weeks 01 to 25, 2016 have been thirteen confirmed cases of microcephaly associated virus Zika, 56 cases were dismissed, and 112 cases are under consideration. http://www.ins.gov.co/boletin-epidemiologico/Boletn Epidemiolgico/2016 Boletín epidemiológico semana 25.pdf- July 7 Zika Situation Report - WHO
- July 7 Zika Situation Report - WHO
SummaryWHO and partners have established a definition of what constitutes an outbreak, endemic transmission, and the interruption of vector-borne transmission in order to better characterize the level of transmission of Zika virus infection (Table 1, Fig. 2). In addition, this will facilitate public health recommendations for residents and travellers. Based on these definitions, countries and territories reporting mosquito-borne Zika virus transmission were reclassified.As of 6 July 2016, 65 countries and territories (Fig. 1, Table 1) have reported evidence of vector-borne Zika virus transmission since 2007 (62 of these countries and territories have reported evidence of vector-borne Zika virus transmission since 2015):48 countries and territories with a first reported outbreak from 2015 onwards (Table 1).Four countries are classified as having possible endemic transmission or have reported evidence of local vector-borne Zika infections in 2016.13 countries and territories have reported evidence of local vector-borne Zika infections in or before 2015, but without documentation of cases in 2016, or with outbreak terminated.Guinea-Bissau is the latest country to report mosquito-borne Zika virus transmission.Eleven countries have reported evidence of person-to-person transmission of Zika virus, probably via a sexual route (Table 2). Spain is the latest country to report Zika infection through person-to-person transmission.As of 6 July 2016, microcephaly and other central nervous system (CNS) malformations potentially associated with Zika virus infection or suggestive of congenital infection have been reported by 13 countries or territories. Three of those countries reported microcephaly cases born from mothers with a recent travel history to Zika-affected countries in Latin America (Table 3).As of 6 July, the United States Centers for Disease Control and Prevention (US-CDC) reported seven live-born infants with birth defects and five pregnancy losses with birth defects with laboratory evidence of possible Zika virus infection.In the context of Zika virus circulation, 15 countries and territories worldwide have reported an increased incidence of Guillain-Barré syndrome (GBS) and/or laboratory confirmation of a Zika virus infection among GBS cases (Table 4).Based on research to date, there is scientific consensus that Zika virus is a cause of microcephaly and GBS.A case of GBS has recently been confirmed positive for Zika virus in Jamaica.Zika virus infections were diagnosed in eight cases with severe neurologic conditions in Guadeloupe.A WHO mission to Guinea-Bissau will be conducted to assist in understanding the lineage of the Zika virus detected in the country using viral sequencing. The mission will also focus on the identification of priority activities to strengthen national response capacity.The global Strategic Response Framework launched by WHO in February 2016 encompasses surveillance, response activities and research. An interim report3 describing some of the key activities being undertaken jointly by WHO and international, regional and national partners in response to this public health emergency was published on 27 May 2016. A revised strategy for the period of July 2016 to December 2017 was published on 17 June.WHO has developed new advice and information on diverse topics in the context of Zika virus.5 WHO’s latest information materials, news and resources to support corporate and programmatic risk communication and community engagement are available online. Download the image jpg, 384kb- July 7 Zika Situation Report - WHO
7 July 2016Zika virus, Microcephaly and Guillain-Barré syndromeRead the full situation reporthttp://www.who.int/emergencies/zika-virus/situation-report/7-july-2016/en/- Florida Zika Cases Remain At 263
July 7, 2016 DEPARTMENT OF HEALTH DAILY ZIKA UPDATE: NO NEW CASES TODAY http://www.floridahealth.gov/newsroom/2016/07/070716-zika-update.htmlContact:Communications [email protected](850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the Florida Department of Health will issue a Zika virus update each week day at 2 p.m. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. There are no new cases today. According to CDC, symptoms associated with the Zika virus last between seven to 10 days. CDC recommends that women who are pregnant or thinking of becoming pregnant postpone travel to Zika affected areas. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms since January. The total number of pregnant women who have been monitored is 43, with 12 having met the previous CDC case definition. The Council of State and Territorial Epidemiologists and CDC released a new case definition for Zika that now includes reporting both asymptomatic and symptomatic cases of Zika. Prior to this change, states reported only symptomatic non-pregnant cases and pregnant cases regardless of symptoms. This change comes as a result of increased availability for testing in commercial laboratories. County Number of Cases (all travel related) Alachua 4 Brevard 4 Broward 37 Charlotte 1 Citrus 2 Clay 2 Collier 3 Duval 5 Escambia 1 Highlands 1 Hillsborough 6 Lake 1 Lee 6 Martin 1 Miami-Dade 72 Okaloosa 1 Orange 21 Osceola 10 Palm Beach 12 Pasco 4 Pinellas 6 Polk 6 Santa Rosa 1 Seminole 9 St. Johns 2 Volusia 2 Total cases not involving pregnant women 220 Cases involving pregnant women regardless of symptoms* 43 *Counties of pregnant women will not be shared. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 2,227 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. All cases are travel-associated. There have been no locally-acquired cases of Zika in Florida. For more information on the Zika virus, click here. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. More Information on DOH action on Zika: On Feb. 3, Governor Scott directed the State Surgeon General to issue a Declaration of Public Health Emergency for the counties of residents with travel-associated cases of Zika.There have been 26 counties included in the declaration– Alachua, Brevard, Broward, Charlotte, Citrus, Clay, Collier, Duval, Escambia, Highlands, Hillsborough, Lake, Lee, Martin, Miami-Dade, Okaloosa, Orange, Osceola, Palm Beach, Pasco, Pinellas, Polk, Santa Rosa, Seminole, St. Johns and Volusia – and will be updated as needed. DOH encourages Florida residents and visitors to protect themselves from all mosquito-borne illnesses by draining standing water; covering their skin with repellent and clothing; and covering windows with screens.DOH has a robust mosquito-borne illness surveillance system and is working with CDC, the Florida Department of Agriculture and Consumer Services and local county mosquito control boards to ensure that the proper precautions are being taken to protect Florida residents and visitors.On April 6, Governor Rick Scott and Interim State Surgeon General Dr. Celeste Philip hosted a conference call with Florida Mosquito Control Districts to discuss ongoing preparations to fight the possible spread of the Zika virus in Florida. There were 74 attendees on the call.On May 11, Governor Scott met with federal leaders on the importance of preparing for Zika as we would a hurricane. Governor Scott requested 5,000 Zika preparedness kits from HHS Secretary Sylvia Burwell as well as a plan from FEMA on how resources will be allocated to states in the event an emergency is declared.On June 1, Governor Scott requested for President Obama to provide preparedness items needed in order to increase Florida’s capacity to be ready when Zika becomes mosquito-borne in our state.On June 9, Governor Scott spoke with Health and Human Services Secretary Sylvia Burwell and CDC Director Dr. Tom Frieden on Zika preparedness and reiterated the requests that he has continued to make to the federal government to prepare for the Zika virus once it becomes mosquito-borne in Florida. Governor Scott also requested that the CDC provide an additional 1,300 Zika antibody tests to Florida to allow individuals, especially pregnant women and new mothers, to see if they ever had the Zika virus.On June 23, Governor Rick Scott announced that he will use his emergency executive authority to allocate $26.2 million in state funds for Zika preparedness, prevention and response in Florida.On June 28, the department announced the first confirmed case of microcephaly in an infant born in Florida whose mother had a travel-related case of Zika. The mother of the infant contracted Zika while in Haiti. Following the confirmation of this case, Governor Rick Scott called on CDC to host a call with Florida medical professionals, including OBGYNs and physicians specializing in family medicine, to discuss the neurological impacts of Zika and what precautions new and expecting mothers should take.On July 1, CDC hosted a call with Florida medical professionals, including OBGYNs and physicians specializing in family medicine, to discuss the neurological impacts of Zika and what precautions new and expecting mothers should take. More than 120 clinicians participated.Florida currently has the capacity to test 5,371 people for active Zika virus and 1,772 for Zika antibodies.Federal Guidance on Zika: According to CDC, Zika illness is generally mild with a rash, fever and joint pain. CDC researchers have concluded that Zika virus is a cause of microcephaly and other birth defects.The FDA released guidance regarding donor screening, deferral and product management to reduce the risk of transfusion-transmission of Zika virus. Additional information is available on the FDA website here.CDC has put out guidance related to the sexual transmission of the Zika virus. This includes CDC recommendation that if you have traveled to a country with local transmission of Zika you should abstain from unprotected sex.For more information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.- Zika Cases In Virginia Increase To 33
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ- Zika Cases In Virginia Increase To 33
As of Thursday, July 7, 2016, VDH has reported 33 cases of Zika virus disease in Virginia residents to the CDC (3 in Northwest Region, 21 in Northern Region, 1 in Eastern Region, 6 in Central Region and 2 in Southwest Region) http://www.vdh.virginia.gov/epidemiology/zika-virus-update/- Virginia Zika Tally Page
As of Thursday, July 7, 2016, VDH has reported 33 cases of Zika virus disease in Virginia residents to the CDC (3 in Northwest Region, 21 in Northern Region, 1 in Eastern Region, 6 in Central Region and 2 in Southwest Region). CDC has issued a travel alert (Level 2-Practice Enhanced Precautions) for people traveling to regions and certain countries where Zika virus transmission is ongoing.- Utah Zika Cases Increase To Three
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ- Utah Zika Cases Increase To Three
Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of July 6, 2016) http://www.cdc.gov/zika/geo/united-states.html StatesTravel-associated cases* No. (% of cases in states) (N=1,133)Locally acquired cases† No. (% of cases in states) (N=0)Alabama2 (<1)0 (0)Arizona6 (1)0 (0)Arkansas5 (<1)0 (0)California69 (6)0 (0)Colorado10 (1)0 (0)Connecticut27 (2)0 (0)Delaware5 (<1)0 (0)District of Columbia7 (1)0 (0)Florida206 (18)0 (0)Georgia29 (3)0 (0)Hawaii10 (1)0 (0)Illinois23 (2)0 (0)Indiana10 (1)0 (0)Iowa9 (1)0 (0)Kansas5 (<1)0 (0)Kentucky7 (1)0 (0)Louisiana6 (1)0 (0)Maine6 (1)0 (0)Maryland31 (3)0 (0)Massachusetts39 (3)0 (0)Michigan10 (1)0 (0)Minnesota21 (2)0 (0)Mississippi5 (<1)0 (0)Missouri6 (1)0 (0)Montana1 (<1)0 (0)Nebraska2 (<1)0 (0)Nevada7 (1)0 (0)New Hampshire4 (<1)0 (0)New Jersey45 (4)0 (0)New Mexico3 (<1)0 (0)New York285 (25)0 (0)North Carolina17 (2)0 (0)Ohio21 (2)0 (0)Oklahoma12 (1)0 (0)Oregon7 (1)0 (0)Pennsylvania††35 (3)0 (0)Rhode Island16 (1)0 (0)South Carolina6 (1)0 (0)Tennessee10 (1)0 (0)Texas53 (5)0 (0)Utah3 (<1)0 (0) - Full French Polynesia 2013 Zika Sequence PF13/251013-18