niman

LOCUS KX358623 191 bp RNA linear VRL 12-JUN-2016 DEFINITION Zika virus isolate AF01 nonstructural protein 5 gene, partial cds. ACCESSION KX358623 VERSION KX358623.1 GI:1035155861 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 191) AUTHORS Perez,S. TITLE Confirmed case of Zika virus congenital infection in Spain JOURNAL Unpublished REFERENCE 2 (bases 1 to 191) AUTHORS Perez,S. TITLE Direct Submission JOURNAL Submitted (06-JUN-2016) Department of Microbiology, University Hospital of Vigo, Hospital Meixoeiro, Apartado Oficial s/n, Vigo, Pontevedra 36200, Spain COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..191 /organism="Zika virus" /mol_type="genomic RNA" /isolate="AF01" /isolation_source="amniotic fluid" /host="Homo sapiens; female" /db_xref="taxon:64320" /country="Venezuela" /collection_date="29-Mar-2016" /note="subtype: Asian Clade" CDS <1..>191 /note="NS5" /codon_start=2 /product="nonstructural protein 5" /protein_id="ANI87834.1" /db_xref="GI:1035155862" /translation="LGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYA DDTAGWDTRISRFDLENEA" ORIGIN 1 ccttggattc ttgaacgagg atcactggat ggggagagag aactcaggag gtggtgttga 61 agggctggga ttacaaagac tcggatatgt cctagaagag atgagtcgca taccaggagg 121 aaggatgtat gcagatgaca ctgctggctg ggacacccgc atcagcaggt ttgatctgga 181 gaatgaagct c

University Hospital of Vigo has released a partial Zika sequence from the amniotic fluid from a pregnant case in Spain, ex-Venezuela.

El Salvador confirms the first case of links between the zika and microcephaly in the countryBY EUROPE PRESS MADRID | 15.06.2016 - 3:32 El Salvador confirms the first case of links between the zika and microcephaly in the country MADRID | EUROPA PRESS TagsEl Salvador El Mundo Medical Research Genetics The Ministry of Health of El Salvador Tuesday confirmed the first case of links between the zika and microcephaly in the country, adding that so far this year there has been an increase in suspected cases. Minister of Health Violeta Menjivar, said that so far in 2016 there have been 48 cases, of which one has caused genetic abnormalities resulting in microcephaly. "El Salvador is the seventh country to confirm microcephaly by zika 60 countries where the virus is circulating," he said, as reported by the Salvadoran newspaper El Mundo. Experts from the World Health Organization (WHO) warned in early June that "thousands" of babies infected with the virus zika could suffer various anomalies, which has urged governments to strengthen surveillance beyond microcephaly. "The spatiotemporal cases of microcephaly with the outbreak of zika and the evidence resulting from the reports and epidemiological studies were carried relationship have a strong scientific consensus that the virus is implicated in congenital anomalies," they said. Specifically, they detailed it may cause craniofacial disproportion, cerebral dysfunction, seizures, irritability, spasticity (muscle stiffness), and "difficulties" in the digestive system and vision. WHO has declared a global health emergency by the virus, which, according to the forecasts of the international organization, could affect between three and four million people in Latin America and the Caribbean, the region hardest hit by the outbreak. http://noticias.lainformacion.com/salud/investigacion-medica/Salvador-confirma-primer-vinculacion-microcefalia_0_926307422.html?utm_source=twitterfeed&utm_medium=twitter

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Zika Confirmed Cases County Cases* Chelan1Clallam1Cowlitz 1King3Mason1Washington State Total 7* Confirmed travel-associated cases in WA as of 6/13/16 http://www.doh.wa.gov/YouandYourFamily/IllnessandDisease/ZikaVirus

Zika Confirmed Cases County Cases* Chelan1Clallam1Cowlitz 1King3Mason1Washington State Total 7* Confirmed travel-associated cases in WA as of 6/13/16

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

June 14, 2016 DEPARTMENT OF HEALTH DAILY ZIKA UPDATE: SEVEN NEW TRAVEL-RELATED CASES TODAY Contact:Communications [email protected](850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the Florida Department of Health will issue a Zika virus update each week day at 2 p.m. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. There are seven new travel-related cases today with four in Broward, two in Palm Beach and one in Seminole counties. Of the cases confirmed in Florida, 10 are still exhibiting symptoms. According to CDC, symptoms associated with the Zika virus last between seven to 10 days. CDC recommends that women who are pregnant or thinking of becoming pregnant postpone travel to Zika affected areas.According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms since January. The total number of pregnant women who have been monitored is 38, with 9 having met the previous CDC case definition. County Number of Cases (all travel related) Alachua 4 Brevard 3 Broward 24 Clay 2 Collier 2 Escambia 1 Hillsborough 4 Lee 5 Martin 1 Miami-Dade 53 Orange 11 Osceola 6 Palm Beach 10 Pasco 2 Pinellas 4 Polk 3 Santa Rosa 1 Seminole 5 St. Johns 2 Volusia 2 Total cases not involving pregnant women 145 Cases involving pregnant women regardless of symptoms* 38 *Counties of pregnant women will not be shared. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 2,047 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. All cases are travel-associated. There have been no locally-acquired cases of Zika in Florida. For more information on the Zika virus, click here. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. More Information on DOH action on Zika: On Feb. 3, Governor Scott directed the State Surgeon General to issue a Declaration of Public Health Emergency for the counties of residents with travel-associated cases of Zika.There have been 20 counties included in the declaration– Alachua, Brevard, Broward, Clay, Collier, Escambia, Hillsborough, Lee, Martin, Miami-Dade, Orange, Osceola, Palm Beach, Pasco, Pinellas, Polk, Santa Rosa, Seminole, St. Johns and Volusia – and will be updated as needed.DOH encourages Florida residents and visitors to protect themselves from all mosquito-borne illnesses by draining standing water; covering their skin with repellent and clothing; and covering windows with screens.DOH has a robust mosquito-borne illness surveillance system and is working with CDC, the Florida Department of Agriculture and Consumer Services and local county mosquito control boards to ensure that the proper precautions are being taken to protect Florida residents and visitors.On April 6, Governor Rick Scott and Interim State Surgeon General Dr. Celeste Philip hosted a conference call with Florida Mosquito Control Districts to discuss ongoing preparations to fight the possible spread of the Zika virus in Florida. There were 74 attendees on the call.On May 11, Governor Scott met with federal leaders on the importance of preparing for Zika as we would a hurricane. Governor Scott requested 5,000 Zika preparedness kits from HHS Secretary Sylvia Burwell as well as a plan from FEMA on how resources will be allocated to states in the event an emergency is declared.On June 1, Governor Scott requested for President Obama to provide preparedness items needed in order to increase Florida’s capacity to be ready when Zika becomes mosquito-borne in our state.On June 9, Governor Scott spoke with Health and Human Services Secretary Sylvia Burwell and Centers for Diseases Control (CDC) Director Dr. Tom Frieden on Zika preparedness and reiterated the requests that he has continued to make to the federal government to prepare for the Zika virus once it becomes mosquito-borne in Florida. Governor Scott also requested that the CDC provide an additional 1,300 Zika antibody tests to Florida to allow individuals, especially pregnant women and new mothers, to see if they ever had the Zika virus.Florida currently has the capacity to test 5,945 people for active Zika virus and 1,682 for Zika antibodies.Federal Guidance on Zika: According to CDC, Zika illness is generally mild with a rash, fever and joint pain. CDC researchers have concluded that Zika virus is a cause of microcephaly and other birth defects.The FDA released guidance regarding donor screening, deferral and product management to reduce the risk of transfusion-transmission of Zika virus. Additional information is available on the FDA website here.CDC has put out guidance related to the sexual transmission of the Zika virus. This includes CDC recommendation that if you have traveled to a country with local transmission of Zika you should abstain from unprotected sex.Based on CDC guidance released, DOH will now report pregnant women with evidence of Zika virus regardless of symptoms. Prior to new guidance, CDC guidance was only to report cases of Zika if the pregnant women was symptomatic.For more information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and onFacebook. For more information about the Florida Department of Health, please visitwww.FloridaHealth.gov. http://www.floridahealth.gov/newsroom/2016/06/061416-zika-update.html

County Number of Cases (all travel related) Alachua 4 Brevard 3 Broward 24 Clay 2 Collier 2 Escambia 1 Hillsborough 4 Lee 5 Martin 1 Miami-Dade 53 Orange 11 Osceola 6 Palm Beach 10 Pasco 2 Pinellas 4 Polk 3 Santa Rosa 1 Seminole 5 St. Johns 2 Volusia 2 Total cases not involving pregnant women 145 Cases involving pregnant women regardless of symptoms* 38

14 June 2016The third meeting of the Emergency Committee met regarding microcephaly, other neurological disorders and Zika virus. The Committee was asked to consider the potential risks of Zika transmission for mass gatherings, including the Olympic and Paralympic Games scheduled for August and September 2016, respectively, in Rio de Janeiro, Brazil.

WHO statement on the third meeting of the International Health Regulations (2005) (IHR(2005)) Emergency Committee on Zika virus and observed increase in neurological disorders and neonatal malformationsWHO statement 14 June 2016 The third meeting of the Emergency Committee (EC) convened by the Director-General under the International Health Regulations (2005) (IHR 2005) regarding microcephaly, other neurological disorders and Zika virus was held by teleconference on 14 June 2016, from 13:00 to 17:15 Central European Time. In addition to providing views to the Director-General on whether the event continued to constitute a Public Health Emergency of International Concern (PHEIC), the Committee was asked to consider the potential risks of Zika transmission for mass gatherings, including the Olympic and Paralympic Games scheduled for August and September 2016, respectively, in Rio de Janeiro, Brazil. The Committee was briefed on the implementation of the Temporary Recommendations issued by the Director-General on 8 March 2016 and updated on the epidemiology and association of Zika virus infection, microcephaly and Guillain-Barré Syndrome (GBS) since that time. The following States Parties provided information on microcephaly, GBS and other neurological disorders occurring in the presence of Zika virus transmission: Brazil, Cabo Verde, Colombia, France, and the United States of America. Advisors to the Committee provided further information on the potential risks of Zika virus transmission associated with mass gatherings and the upcoming Olympic and Paralympic Games, and the Committee thoroughly reviewed the range of public perspectives, opinions and concerns that have recently been aired on this subject. The Committee concurred with the international scientific consensus, reached since the Committee last met, that Zika virus is a cause of microcephaly and GBS, and, consequently, that Zika virus infection and its associated congenital and other neurological disorders is a Public Health Emergency of International Concern (PHEIC). The Committee restated the advice it provided to the Director-General in its 2nd meeting in the areas of public health research on microcephaly, other neurological disorders and Zika virus, surveillance, vector control, risk communications, clinical care, travel measures, and research and product development. The Committee noted that mass gatherings, such as the Olympic and Paralympic Games, can bring together substantial numbers of susceptible individuals, and can pose a risk to the individuals themselves, can result in the amplification of transmission and can, potentially, contribute to the international spread of a communicable disease depending on its epidemiology, the risk factors present and the mitigation strategies that are in place. In the context of Zika virus, the Committee noted that the individual risks in areas of transmission are the same whether or not a mass gathering is conducted, and can be minimized by good public health measures. The Committee reaffirmed and updated its advice to the Director-General on the prevention of infection in international travellers as follows: Pregnant women should be advised not to travel to areas of ongoing Zika virus outbreaks; pregnant women whose sexual partners live in or travel to areas with Zika virus outbreaks should ensure safe sexual practices or abstain from sex for the duration of their pregnancy, Travellers to areas with Zika virus outbreaks should be provided with up to date advice on potential risks and appropriate measures to reduce the possibility of exposure through mosquito bites and sexual transmission and, upon return, should take appropriate measures, including safe sex, to reduce the risk of onward transmission, The World Health Organization should regularly update its guidance on travel with evolving information on the nature and duration of risks associated with Zika virus infection. Based on the existing evidence from the current Zika virus outbreak, it is known that this virus can spread internationally and establish new transmission chains in areas where the vector is present. Focusing on the potential risks associated with the Olympic and Paralympic Games, the Committee reviewed information provided by Brazil and Advisors specializing in arboviruses, the international spread of infectious diseases, travel medicine, mass gatherings and bioethics. The Committee concluded that there is a very low risk of further international spread of Zika virus as a result of the Olympic and Paralympic Games as Brazil will be hosting the Games during the Brazilian winter when the intensity of autochthonous transmission of arboviruses, such dengue and Zika viruses, will be minimal and is intensifying vector-control measures in and around the venues for the Games which should further reduce the risk of transmission. The Committee reaffirmed its previous advice that there should be no general restrictions on travel and trade with countries, areas and/or territories with Zika virus transmission, including the cities in Brazil that will be hosting the Olympic and Paralympic Games. The Committee provided additional advice to the Director-General on mass gatherings and the Olympic and Paralympic Games as follows: Countries, communities and organizations that are convening mass gatherings in areas affected by Zika virus outbreaks should undertake a risk assessment prior to the event and increase measures to reduce the risk of exposure to Zika virus,Brazil should continue its work to intensify vector control measures in and around the cities and venues hosting Olympic and Paralympic Games events, make the nature and impact of those measures publicly available, enhance surveillance for Zika virus circulation and the mosquito vector in the cities hosting the events and publish that information in a timely manner, and ensure the availability of sufficient insect repellent and condoms for athletes and visitors,Countries with travellers to and from the Olympic and Paralympic Games should ensure that those travellers are fully informed on the risks of Zika virus infection, the personal protective measures that should be taken to reduce those risks, and the action that they should take if they suspect they have been infected. Countries should also establish protocols for managing returning travellers with Zika virus infection based on WHO guidance,Countries should act in accordance with guidance from the World Health Organization on mass gatherings in the context of Zika virus outbreaks, which will be updated as further information becomes available on the risks associated with Zika virus infection and factors affecting national and international spread. Based on this advice the Director-General declared the continuation of the Public Health Emergency of International Concern (PHEIC). The Director-General reissued the Temporary Recommendations from the 2nd meeting of the Committee, endorsed the additional advice from the Committee’s 3rd meeting, and issued them as Temporary Recommendations under the IHR (2005). The Director-General thanked the Committee Members and Advisors for their advice. http://www.who.int/mediacentre/news/statements/2016/zika-third-ec/en/

MC Map updated with La Paz location https://www.google.com/maps/d/u/0/edit?mid=1RcVTrkYW6hax_iITjKUkEcBCVeI

Confirms first case of microcephaly by zikaTuesday 14, Jun, 2016 24:05 | Posted by Gabriel García TWEETSHARE4+1The authorities of the National Health confirmed the first case of microcephaly by zika. The headlines said that childbirth is a mother of 20-year-old in the department of La Paz. Minister of Health Violeta Menjivar, explained that although only confirmed one case zika, is expected in the coming days will confirm more, because the births of infected women since last November, are planned for the coming months . Menjívar reported that this year 48 cases of microcephaly and counted in newborns, which means an increase from the 38 cases reported throughout 2015. Official data show that this year three babies have died by microcephaly, and total cases, 18 are due to conditions outside the zika. The remaining cases will be sent a sample to international laboratories for diagnosis. The authorities explained that there are a total of 274 pregnant women who presented symptoms of zika so they are under observation, of these 43 percent and gave birth without any inconvenience. Holders warned that cases of zika still trending downward, as in the last week only 50 diagnoses were recorded The Government attributed this decline to the national prevention effort, which joined 261 mayoralties.The representative of the Pan American Health Organization (PAHO), Carlos Garzón, reported that El Salvador already has all the requirements laboratory to diagnose with certainty the zika. However, Garzon said that as part of international protocol, in the country only 3% of cases of pregnant take laboratory testing. Garzon said that PAHO has paid hundreds of thousands of dollars and a great support to the country since increased cases of zika last November.http://www.informatvx.com/confirman-primer-caso-de-microcefalia-por-zika/

Confirms first case of microcephaly by Zika in El SalvadorSalvadoran health authorities - although they had themselves reported an increase in microcephaly - had no confirmed case linked between this disease and Zika virus. Until today. Drafting0 Health Minister and coordinator of the National Health System, Violeta Menjivar, confirmed Tuesday during a press conference, the first case of microcephaly associated with Zika virus in El Salvador. According to the minister, the system of Salvadoran public health has been an increase of microcephaly in the country in recent months, a situation that becomes more worrisome because between November 2015 and June 2016 have been registered at least 274 pregnant women Zika suspected. Of these, and already 118 children gave birth without microcephaly. Microcephaly (or reduction of the skull) is a is an anomaly that is insufficient development of the skull, often accompanied by cerebral atrophy that may cause the immediate death of the baby at birth. The link between Zika and microcephaly alerted several countries in Latin America, USA and Spain after being discovered earlier this year; however, Salvadoran health authorities - although they had themselves reported an increase in microcephaly - had no confirmed cases linked between this disease and virus Zika.Hasta today. http://diario1.com/nacionales/2016/06/confirman-primer-caso-de-microcefalia-por-zika-en-el-salvador/

Health Ministry confirms first case of microcephaly caused by Zika in El SalvadornationalHealthJune 14, 20160 The Digital Metropolitano This morning officials from the Ministry of Health confirmed the first case of microcephaly in a newborn caused by Zika virus. Microcephaly is a consistent anomaly insufficient development of the skull, often accompanied by cerebral atrophy. Although until the second week of June 48 cases of microcephaly in the country, representing an increase from the records of the ministry, only one case has been directly linked to the Zika virus were presented. El Salvador is the seventh country to confirm microcephaly by Zika 60 countries where the virus circulates. November 2015 to June this year, a total of 274 pregnant women with suspected Zika were recorded, 100% had follow-up, of them, 118 gave birth to their children, none with microcephaly. Minister Violeta Menjivar said "microcephaly has always been ... Not everything Zika leads to microcephaly." The confirmed case is a 20 year old woman who gave birth to her first child. http://www.elmetropolitanodigital.com/2016/06/ministerio-de-salud-confirma-primer-caso-de-microcefalia-causado-por-zika-en-el-salvador/

Authorities confirm first case of microcephaly by zikaRadio 102nueve June 14, 2016 | 11:32 a.m. Follow Radio102.9 A + A-Health Ministry officials (MINSAL) Tuesday confirmed the first case of microcephaly by Zika virus. The minister, Violeta Menjivar, reported to have been an increase in suspected cases. "There are 274 pregnant women with suspected zika with monitoring (of these) gave birth to 118 children without microcephaly," he explained the official during a press conference. The authorities presented the results of the 2016 registered 48 cases, among them was the first case of microcephaly associated with zika. "From 48 microcefalias, three babies died. Microcephaly always has been, not all Zika leads to microcephaly "he said. El Salvador is the seventh country to confirm microcephaly by Zika 60 countries where the virus circulates. http://102nueve.com/noticia/nacional/autoridades-confirman-primer-caso-de-microcefalia-por-zika/

Microcephaly Zika map update https://www.google.com/maps/d/u/0/edit?mid=1RcVTrkYW6hax_iITjKUkEcBCVeI

Minister of Health Violeta Menjivar, reported that in the country have seen an increase in cases of microcephaly and, at the same time confirmed the first event of the birth of a baby suffering from this disease and is related to the virus Zica. http://elblog.com/noticias/registro-30859.html

Minister of Health reports first case of microcephaly by zika in El SalvadorTo date, 48 babies were born with microcephaly, one of them is the one who has tested positive for Zika. 0 CommentsPatients with the disease in the Rosales Hospital Zika | Photo by MH By Xenia González14.jun.2016 | 10:43 Minister of Health Violeta Menjivar, today reported the first case of microcephaly related Zika virus in El Salvador. The finding makes the country the seventh of the Americas to confirm the association between the two conditions. Until the second week of June go 48 newborns with microcephaly, one of them is the one who has tested positive for Zika. Three of the babies died. You may also be interested in : Health recorded 133 cases of microcephaly in 2015 These babies are mothers who had no symptoms of the virus, and were asymptomatic cases, the Health Ministry said. The mother of the newborn with microcephaly related to zika is 20 years old and itwas her first pregnancy. According Menjívar there is already a protocol for monitoring pregnant women carrying the virus and children with microcephaly are born in the country. You may also be interested in : ¿Risk for mothers of babies with microcephaly? . To date, Health has been in control at 274 pregnant women with symptoms related to zika Menjivar said: "I want to appeal for calm and comply with the recommendations of the national health system." You may also be interested in : rising cases of concern and Guillain Barré zika http://www.elsalvador.com/articulo/nacional/ministra-salud-reporta-primer-caso-microcefalia-por-zika-salvador-115828?utm_source=dlvr.it&utm_medium=facebook

El Salvador confirms first case of microcephaly by Zika Carmina Castro IN NEWSTuesday June 14, 2016 Before the case registered by the Ministry of Health, El Salvador becomes the seventh country confirming delivery where the disease microcephaly is related to Zika virus. (Photo / Reference) Until June 2016, 60 countries are present Zika, 39 are from LatinCurrently, there are 274 pregnant women with suspected ZikaMinister of Health Violeta Menjivar, reported that in the country have seen an increase in cases of microcephaly and, at the same time confirmed the first event of the birth of a baby suffering from this disease and is related to the virus Zica. Given this, El Salvador becomes the seventh country to confirm microcephaly by Zika 60 nations where the virus is circulating, officials of the Ministry of Health (MINSAL) and the representative of the Pan American Health Organization (PAHO), Carlos Waiter.

Minister of Health Violeta Menjivar, reported that in the country have seen an increase in cases of microcephaly and, at the same time confirmed the first event of the birth of a baby suffering from this disease and is related to the virus Zica. http://elblog.com/noticias/registro-30859.html

Zika Virus – June 14, 2016. Texas has had 42 reported cases of Zika virus disease. Of those, 41 were in travelers who were infected abroad and diagnosed after they returned home; one of those travelers was a pregnant woman. One case involved a Dallas County resident who had sexual contact with someone who acquired the Zika infection while traveling abroad. Texas Zika Cases by County: CountyCasesBexar6Collin2Dallas6Denton2Ellis1Fort Bend2Grayson1Harris13Tarrant4Travis2Val Verde1Williamson1Wise1Total42