Everything posted by niman
-
Pennsylvania Zika Cases Increase To 24
CDC Confirmed Cases: 24Pending Test Results: 222 Last update: 06/13/2016 http://www.health.pa.gov/My Health/Diseases and Conditions/U-Z/Zikavirus/Pages/ZikaVirusHomePage.aspx#.V03dG_krLtQ
-
Florida Zika Cases Increase To 176
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
-
Florida Zika Cases Increase To 176
June 13, 2016 DEPARTMENT OF HEALTH DAILY ZIKA UPDATE: ONE NEW TRAVEL-RELATED CASE TODAY IN BROWARD COUNTY Contact:Communications [email protected](850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the Florida Department of Health will issue a Zika virus update each week day at 2 p.m. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. There is one new travel-related case today in Broward County. Of the cases confirmed in Florida, eight are still exhibiting symptoms. According to CDC, symptoms associated with the Zika virus last between seven to 10 days. CDC recommends that women who are pregnant or thinking of becoming pregnant postpone travel to Zika affected areas. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms since January. The total number of pregnant women who have been monitored is 38, with 9 having met the previous CDC case definition. County Number of Cases (all travel related) Alachua 4 Brevard 3 Broward 20 Clay 2 Collier 2 Escambia 1 Hillsborough 4 Lee 5 Martin 1 Miami-Dade 53 Orange 11 Osceola 6 Palm Beach 8 Pasco 2 Pinellas 4 Polk 3 Santa Rosa 1 Seminole 4 St. Johns 2 Volusia 2 Total cases not involving pregnant women 138 Cases involving pregnant women regardless of symptoms* 38 *Counties of pregnant women will not be shared. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 2,019 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. All cases are travel-associated. There have been no locally-acquired cases of Zika in Florida. For more information on the Zika virus, click here. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. More Information on DOH action on Zika: On Feb. 3, Governor Scott directed the State Surgeon General to issue a Declaration of Public Health Emergency for the counties of residents with travel-associated cases of Zika.There have been 20 counties included in the declaration– Alachua, Brevard, Broward, Clay, Collier, Escambia, Hillsborough, Lee, Martin, Miami-Dade, Orange, Osceola, Palm Beach, Pasco, Pinellas, Polk, Santa Rosa, Seminole, St. Johns and Volusia – and will be updated as needed.DOH encourages Florida residents and visitors to protect themselves from all mosquito-borne illnesses by draining standing water; covering their skin with repellent and clothing; and covering windows with screens.DOH has a robust mosquito-borne illness surveillance system and is working with CDC, the Florida Department of Agriculture and Consumer Services and local county mosquito control boards to ensure that the proper precautions are being taken to protect Florida residents and visitors.On April 6, Governor Rick Scott and Interim State Surgeon General Dr. Celeste Philip hosted a conference call with Florida Mosquito Control Districts to discuss ongoing preparations to fight the possible spread of the Zika virus in Florida. There were 74 attendees on the call.On May 11, Governor Scott met with federal leaders on the importance of preparing for Zika as we would a hurricane. Governor Scott requested 5,000 Zika preparedness kits from HHS Secretary Sylvia Burwell as well as a plan from FEMA on how resources will be allocated to states in the event an emergency is declared.On June 1, Governor Scott requested for President Obama to provide preparedness items needed in order to increase Florida’s capacity to be ready when Zika becomes mosquito-borne in our state.On June 9, Governor Scott spoke with Health and Human Services Secretary Sylvia Burwell and Centers for Diseases Control (CDC) Director Dr. Tom Frieden on Zika preparedness and reiterated the requests that he has continued to make to the federal government to prepare for the Zika virus once it becomes mosquito-borne in Florida. Governor Scott also requested that the CDC provide an additional 1,300 Zika antibody tests to Florida to allow individuals, especially pregnant women and new mothers, to see if they ever had the Zika virus.Florida currently has the capacity to test 5,955 people for active Zika virus and 1,732 for Zika antibodies.Federal Guidance on Zika: According to CDC, Zika illness is generally mild with a rash, fever and joint pain. CDC researchers have concluded that Zika virus is a cause of microcephaly and other birth defects.The FDA released guidance regarding donor screening, deferral and product management to reduce the risk of transfusion-transmission of Zika virus. Additional information is available on the FDA website here.CDC has put out guidance related to the sexual transmission of the Zika virus. This includes CDC recommendation that if you have traveled to a country with local transmission of Zika you should abstain from unprotected sex.Based on CDC guidance released, DOH will now report pregnant women with evidence of Zika virus regardless of symptoms. Prior to new guidance, CDC guidance was only to report cases of Zika if the pregnant women was symptomatic.For more information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov. http://www.floridahealth.gov/newsroom/2016/06/061316-zika-update.html
-
Florida Zika Cases Increase To 176
County Number of Cases (all travel related) Alachua 4 Brevard 3 Broward 20 Clay 2 Collier 2 Escambia 1 Hillsborough 4 Lee 5 Martin 1 Miami-Dade 53 Orange 11 Osceola 6 Palm Beach 8 Pasco 2 Pinellas 4 Polk 3 Santa Rosa 1 Seminole 4 St. Johns 2 Volusia 2 Total cases not involving pregnant women 138 Cases involving pregnant women regardless of symptoms* 38 *Counties of pregnant women will not be shared.
-
Pennsylvania Zika Tally Page
CDC Confirmed Cases: 24Pending Test Results: 222 Last update: 06/13/2016
-
Collin County Texas Zika Cases Increase To Two
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
-
Collin County Texas Zika Cases Increase To Two
Zika Virus – June 13, 2016. Texas has had 42 reported cases of Zika virus disease. Of those, 41 were in travelers who were infected abroad and diagnosed after they returned home; one of those travelers was a pregnant woman. One case involved a Dallas County resident who had sexual contact with someone who acquired the Zika infection while traveling abroad. Texas Zika Cases by County: CountyCasesBexar6Collin2Dallas6Denton2Ellis1Fort Bend2Grayson1Harris13Tarrant4Travis2Val Verde1Williamson1Wise1Total42 http://www.texaszika.org/
-
Texas Zika Tally Page
Zika Virus – June 13, 2016. Texas has had 42 reported cases of Zika virus disease. Of those, 41 were in travelers who were infected abroad and diagnosed after they returned home; one of those travelers was a pregnant woman. One case involved a Dallas County resident who had sexual contact with someone who acquired the Zika infection while traveling abroad. Texas Zika Cases by County: CountyCasesBexar6Collin2Dallas6Denton2Ellis1Fort Bend2Grayson1Harris13Tarrant4Travis2Val Verde1Williamson1Wise1Total42
-
Pennsylvania Zika Tally Page
CDC Confirmed Cases: 23Pending Test Results: 216 Last update: 06/06/2016
-
Zika Cases In Georgia Increase To 20
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
-
Zika Cases In Georgia Increase To 20
As of June 13, 201620 confirmed travel-related Zika cases in Georgia http://dph.georgia.gov/
-
Georgia Zika Tally Page
As of June 13, 201620 confirmed travel-related Zika cases in Georgia
-
Zika Cases In Alabama Increase To 6
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
-
Zika Cases In Alabama Increase To 6
Alabama Residents Tested for Zika Virus as of June 13, 2016http://www.adph.org/mosquito/index.asp?id=7427 Number Tested PositiveNumber of SubmissionsNumber with Results Pending6 91 7
-
Alabama Zika Tally Sheet
Alabama Residents Tested for Zika Virus as of June 13, 2016 Number Tested PositiveNumber of SubmissionsNumber with Results Pending6 91 7
-
Zika In Dallas Traveler ex-Honduras
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
-
Zika In Dallas Traveler ex-Honduras
DCHHS Reports 7th Zika Virus Case in Dallas County DALLAS (June 13, 2016) – Dallas County Health and Human Services (DCHHS) is reporting the seventh case of Zika virus in Dallas County in 2016. The case was confirmed through testing in the DCHHS lab. DCHHS has submitted the case for review to the Texas Department of State Health Services. The 60-year-old patient is a resident of Dallas who was infected with the virus during recent travel to Honduras. For medical confidentiality and personal privacy reasons, DCHHS does not provide additional identifying information. While sexual transmission of Zika virus is possible, it is primarily transmitted to people by Aedes species mosquitoes. The most common symptoms of Zika virus are fever, rash, joint pain, and conjunctivitis (red eyes). The illness is usually mild with symptoms lasting several days to a week. DCHHS advises individuals with symptoms to see a healthcare provider if they visited an area where Zika virus is present or had sexual contact with a person who traveled to an area where Zika virus is present. There is no specific medication available to treat Zika virus and there is not a vaccine. The best ways to avoid Zika virus are to avoid mosquito bites and sexual contact with a person who has Zika virus. There are currently no reports of Zika virus being locally-transmitted by mosquitoes in Dallas County. However, imported cases make local spread by mosquitoes possible because the mosquitoes that can transmit the virus are found locally. DCHHS advises recent travelers with Zika virus symptoms as well as individuals diagnosed with the virus to protect themselves from further mosquito bites. For more information on Zika virus, including prevention, go to the DCHHS website. # For additional information, contact: Erikka D. Neroes, Public Information [email protected] 214.819.6329 (office) 214.394.8109 (cell) Zachary Thompson, Director 214.755.9299 (cell)
-
Zika In Dallas Traveler ex-Honduras
The 60-year-old patient is a resident of Dallas who was infected with the virus during recent travel to Honduras.
-
2015 Panama Zika Sequences
Sequence map update https://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU\
-
2015 Panama Zika Sequences
Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU758877.1|Zika virus isolate 17271 polyprotein gene, complete cds944944100%0.099%KU758877.1Select seq gb|KX262887.1|Zika virus isolate 103451, complete genome944944100%0.099%KX262887.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome944944100%0.099%KX247646.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds944944100%0.099%KX247632.1Select seq gb|KU820897.2|Zika virus isolate FLR polyprotein gene, complete cds944944100%0.099%KU820897.2Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome944944100%0.099%KX087101.2Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds944944100%0.099%KU937936.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome944944100%0.099%KX156776.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome944944100%0.099%KX156775.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome944944100%0.099%KX156774.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome944944100%0.099%KX087102.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds944944100%0.099%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds944944100%0.099%KX059013.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome944944100%0.099%KX051563.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome944944100%0.099%KU509998.3Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome944944100%0.099%KU870645.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome944944100%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome944944100%0.099%KU922923.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome944944100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome944944100%0.099%KU853012.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds944944100%0.099%KU729217.2Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome944944100%0.099%KU497555.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome944944100%0.099%KU707826.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome944944100%0.099%KU527068.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds944944100%0.099%KU647676.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome944944100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds944944100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds944944100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds944944100%0.099%KU365777.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds944944100%0.099%KM078961.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds944944100%0.099%KM078936.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds944944100%0.099%KM078933.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds944944100%0.099%KJ873161.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds944944100%0.099%KJ873160.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds944944100%0.099%KJ776791.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds942942100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds942942100%0.099%KU501216.1Select seq gb|KX280026.1|Zika virus isolate Paraiba_01, complete genome940940100%0.099%KX280026.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome940940100%0.099%KX198135.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome940940100%0.099%KX197192.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds940940100%0.099%KX056898.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds940940100%0.099%KU991811.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds940940100%0.099%KU955590.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome940940100%0.099%KU926310.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome940940100%0.099%KU926309.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds940940100%0.099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds940940100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds940940100%0.099%KU761564.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds940940100%0.099%KU312312.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome940940100%0.099%KU321639.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds940940100%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds940940100%0.099%KM078970.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds940940100%0.099%KM078930.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome935935100%0.099%KU940228.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome935935100%0.099%KU940224.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds935935100%0.099%KU729218.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds935935100%0.099%KU365778.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds935935100%0.099%KM078929.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome930930100%0.099%KU681081.3Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds930930100%0.099%KM851039.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome926926100%0.099%KX117076.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds924924100%0.099%KU179098.1Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome922922100%0.098%KX253996.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds922922100%0.098%KX185891.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds922922100%0.098%KU963796.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds922922100%0.098%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome922922100%0.098%KU820899.2Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome922922100%0.098%KU744693.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds921921100%0.098%KF993678.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds904904100%0.098%KU866423.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds902902100%0.098%EU545988.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome897897100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds897897100%0.098%JN860885.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome884884100%0.097%KU681082.3Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds884884100%0.097%KM851038.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds798798100%0.093%HQ234499.1Select seq gb|KU985087.1|Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds79679684%0.099%KU985087.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds78078082%0.099%KU556802.1Select seq gb|KU867812.1|Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds76576580%0.099%KU867812.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds704704100%0.089%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome704704100%0.089%KU955594.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds704704100%0.089%KU720415.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID704704100%0.089%LC002520.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds704704100%0.089%KF383118.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds704704100%0.089%KF268949.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds704704100%0.089%HQ234498.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome704704100%0.089%AY632535.2Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds704704100%0.089%AF013415.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds699699100%0.089%KF383121.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds699699100%0.089%KF383119.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds68868899%0.089%KU963574.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds68868899%0.089%HQ234500.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds68868899%0.089%DQ859059.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome68468499%0.089%KX198134.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds681681100%0.088%KF268950.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds681681100%0.088%KF268948.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome67967999%0.088%KU955595.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome67967999%0.088%KU955592.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome67967999%0.088%KU955591.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds67967971%0.099%KU232300.1
-
2015 Panama Zika Sequences
LOCUS KU724100 528 bp RNA linear VRL 11-JUN-2016 DEFINITION Zika virus isolate 259043_2015_Panama NS5B gene, partial cds. ACCESSION KU724100 VERSION KU724100.1 GI:998178894 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 528) AUTHORS Arauz,D., De Urriola,L., Jones,J., Castillo,M., Martinez,A., Murillo,E., Troncoso,L., Chen,M., Abrego,L., Armien,B., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Febrile or Exanthematous Illness Associated with Zika, Dengue, and Chikungunya Viruses, Panama JOURNAL Emerging Infect. Dis. 22 (8) (2016) In press PUBMED 27139219 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 528) AUTHORS Arauz,D. Sr., De Urriola,L., Castillo,M., Martinez,A.A., Murillo,E., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Direct Submission JOURNAL Submitted (17-FEB-2016) Departament of Research in Virology and Biotechnology, Gorgas Institute For Health Studies Memorial Institute, Ave. Justo Arosemena 35th Street, Panama, Panama 0816-02593, Panama COMMENT ##Assembly-Data-START## Assembly Method :: Sequencher v. 4.5 Coverage :: partial Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..528 /organism="Zika virus" /mol_type="genomic RNA" /isolate="259043_2015_Panama" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Panama" /collection_date="29-Nov-2015" CDS <1..>528 /codon_start=2 /product="NS5B" /protein_id="AMK26956.1" /db_xref="GI:998178895" /translation="MDIISRQDQXGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQD LWLLRRSEKVTNWLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDT QEWKPSTGWDNWEEVPFCSHHFNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIR ETACLAKSYAQMXQLL" ORIGIN 1 tatggacatt atttckagac aagaccaaar ggggagcgga caagttgtca cttacgctct 61 taacacattt accaacctag tggtgcaact cattcggaat atggaggctg aggaagttct 121 agagatgcaa gacttgtggc tgctgcggag gtcagagaaa gtgaccaact ggttgcagag 181 caacggatgg gataggctca aacgaatggc agtcagtgga gatgattgcg ttgtgaagcc 241 aattgatgat aggtttgcac atgccctcag gttcttgaat gatatgggaa aagttaggaa 301 ggacacacaa gagtggaaac cctcaactgg atgggacaac tgggaagaag ttccgttttg 361 ctcccaccac ttcaacaagc tccatctcaa ggacgggagg tccattgtgg ttccctgccg 421 ccaccaagat gaactgattg gccgggcccg cgtctctcca ggggcgggat ggagcatccg 481 ggagactgct tgcctagcaa aatcatatgc gcaaatgwgg cagctcct
-
2015 Panama Zika Sequences
Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU758877.1|Zika virus isolate 17271 polyprotein gene, complete cds11011101100%0.099%KU758877.1Select seq gb|KX262887.1|Zika virus isolate 103451, complete genome11011101100%0.099%KX262887.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome11011101100%0.099%KX247646.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds11011101100%0.099%KX247632.1Select seq gb|KU820897.2|Zika virus isolate FLR polyprotein gene, complete cds11011101100%0.099%KU820897.2Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome11011101100%0.099%KX087101.2Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds11011101100%0.099%KU937936.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome11011101100%0.099%KX156776.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome11011101100%0.099%KX156775.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome11011101100%0.099%KX156774.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome11011101100%0.099%KX087102.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome11011101100%0.099%KU870645.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome11011101100%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome11011101100%0.099%KU922923.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome11011101100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome11011101100%0.099%KU853012.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds11011101100%0.099%KU729217.2Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome11011101100%0.099%KU497555.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome11011101100%0.099%KU707826.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome11011101100%0.099%KU527068.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds11011101100%0.099%KU647676.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome11011101100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds11011101100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds11011101100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds11011101100%0.099%KU365777.1Select seq gb|KX280026.1|Zika virus isolate Paraiba_01, complete genome10971097100%0.099%KX280026.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome10971097100%0.099%KX198135.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome10971097100%0.099%KX197192.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds10971097100%0.099%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds10971097100%0.099%KX059013.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome10971097100%0.099%KX051563.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds10971097100%0.099%KX056898.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome10971097100%0.099%KU509998.3Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds10971097100%0.099%KU991811.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds10971097100%0.099%KU955590.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome10971097100%0.099%KU926310.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds10971097100%0.099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds10971097100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds10971097100%0.099%KU761564.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds10971097100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds10971097100%0.099%KU501216.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds10971097100%0.099%KU312312.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome10971097100%0.099%KU321639.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds10971097100%0.099%KM078961.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds10971097100%0.099%KM078936.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds10971097100%0.099%KM078933.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds10971097100%0.099%KJ873160.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds10971097100%0.099%KJ776791.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome10921092100%0.099%KU926309.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds10921092100%0.099%KU729218.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds10921092100%0.099%KU365778.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds10921092100%0.099%KM078971.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds10921092100%0.099%KM078930.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds10901090100%0.099%KM078970.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome10881088100%0.099%KU940228.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome10881088100%0.099%KU940224.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds10881088100%0.099%KM078929.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome10791079100%0.099%KX117076.1Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome10741074100%0.099%KX253996.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds10741074100%0.099%KX185891.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds10741074100%0.099%KU963796.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds10741074100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome10741074100%0.099%KU820899.2Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome10741074100%0.099%KU681081.3Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome10741074100%0.099%KU744693.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds10741074100%0.099%KU179098.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds10741074100%0.099%KM851039.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds10701070100%0.099%KF993678.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds10561056100%0.098%KU866423.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome10471047100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds10471047100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds10471047100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome10341034100%0.097%KU681082.3Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds10341034100%0.097%KM851038.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1029102993%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds939939100%0.094%HQ234499.1Select seq gb|KU985087.1|Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds86186178%0.099%KU985087.1Select seq gb|KU867812.1|Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds85485477%0.099%KU867812.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds84584576%0.099%KU556802.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds82582599%0.090%KF268949.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds82082099%0.090%KF383118.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds81681699%0.090%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome81681699%0.090%KU955594.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds81681699%0.090%KU720415.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID81681699%0.090%LC002520.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds81681699%0.090%KF383121.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds81681699%0.090%KF383119.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds81681699%0.090%HQ234498.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome81681699%0.090%AY632535.2Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds81681699%0.090%AF013415.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome81081099%0.089%KX198134.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds81081099%0.089%KU963574.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds81081099%0.089%HQ234500.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds81081099%0.089%DQ859059.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome80780799%0.089%KU955595.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome80780799%0.089%KU955592.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome80780799%0.089%KU955591.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds80180199%0.089%KF268950.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds80180199%0.089%KF268948.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds79879899%0.089%KF383116.1
-
2015 Panama Zika Sequences
LOCUS KU724099 612 bp RNA linear VRL 11-JUN-2016 DEFINITION Zika virus isolate 259032_2015_Panama NS5B gene, partial cds. ACCESSION KU724099 VERSION KU724099.1 GI:998178892 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 612) AUTHORS Arauz,D., De Urriola,L., Jones,J., Castillo,M., Martinez,A., Murillo,E., Troncoso,L., Chen,M., Abrego,L., Armien,B., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Febrile or Exanthematous Illness Associated with Zika, Dengue, and Chikungunya Viruses, Panama JOURNAL Emerging Infect. Dis. 22 (8) (2016) In press PUBMED 27139219 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 612) AUTHORS Arauz,D. Sr., De Urriola,L., Castillo,M., Martinez,A.A., Murillo,E., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Direct Submission JOURNAL Submitted (17-FEB-2016) Departament of Research in Virology and Biotechnology, Gorgas Institute For Health Studies Memorial Institute, Ave. Justo Arosemena 35th Street, Panama, Panama 0816-02593, Panama COMMENT ##Assembly-Data-START## Assembly Method :: Sequencher v. 4.5 Coverage :: partial Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..612 /organism="Zika virus" /mol_type="genomic RNA" /isolate="259032_2015_Panama" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Panama" /collection_date="29-Nov-2015" CDS <1..>612 /codon_start=1 /product="NS5B" /protein_id="AMK26955.1" /db_xref="GI:998178893" /translation="KVLRPAEKGKTVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIR NMEAEEVLEMQDLWLLRRSEKVTNWLQXNGWDRLKRMAVSGDDCVVKPIDDRFAHALR FLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHHFNKLHLKDGRSIVVPCRHQDELIGR ARVSPGAGWSIRETACLAKSYAQMWQLLYFHRRDLRLMANAICS" ORIGIN 1 aaggtcctta gaccagctga aaaagggaaa acagttatgg acattatttc gagacaagac 61 caaaggggga gcggacaagt tgtcacttac gctcttaaca catttaccaa cctagtggtg 121 caactcattc ggaatatgga ggctgaggaa gttctagaga tgcaagactt gtggctgctg 181 cggaggtcag agaaagtgac caactggttg cagarcaacg gatgggatag gctcaaacga 241 atggcagtca gtggagatga ttgcgttgtg aagccaattg atgataggtt tgcacatgcc 301 ctcaggttct tgaatgatat gggaaaagtt aggaaggaca cacaagagtg gaaaccctca 361 actggatggg acaactggga agaagttccg ttttgctccc accacttcaa caagctccat 421 ctcaaggacg ggaggtccat tgtggttccc tgccgccacc aagatgaact gattggccgg 481 gcccgcgtct ctccaggggc gggatggagc atccgggaga ctgcttgcct agcaaaatca 541 tatgcgcaaa tgtggcagct cctttatttc cacagaaggg acctccgact gatggccaat 601 gccatttgtt ca
-
2015 Panama Zika Sequences
Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU820897.3|Zika virus isolate FLR polyprotein gene, complete cds11661166100%0.099%KU820897.3Select seq gb|KU758877.1|Zika virus isolate 17271 polyprotein gene, complete cds11661166100%0.099%KU758877.1Select seq gb|KX262887.1|Zika virus isolate 103451, complete genome11661166100%0.099%KX262887.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome11661166100%0.099%KX247646.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds11661166100%0.099%KX247632.1Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome11661166100%0.099%KX087101.2Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds11661166100%0.099%KU937936.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome11661166100%0.099%KX156776.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome11661166100%0.099%KX156775.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome11661166100%0.099%KX156774.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome11661166100%0.099%KX087102.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome11661166100%0.099%KU870645.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome11661166100%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome11661166100%0.099%KU922923.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome11661166100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome11661166100%0.099%KU853012.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome11661166100%0.099%KU497555.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome11661166100%0.099%KU707826.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome11661166100%0.099%KU527068.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds11661166100%0.099%KU647676.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome11661166100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds11661166100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds11661166100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds11661166100%0.099%KU365777.1Select seq gb|KX280026.1|Zika virus isolate Paraiba_01, complete genome11621162100%0.099%KX280026.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome11621162100%0.099%KX198135.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome11621162100%0.099%KX197192.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds11621162100%0.099%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds11621162100%0.099%KX059013.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome11621162100%0.099%KX051563.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds11621162100%0.099%KX056898.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome11621162100%0.099%KU509998.3Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds11621162100%0.099%KU991811.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds11621162100%0.099%KU955590.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome11621162100%0.099%KU926310.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds11621162100%0.099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds11621162100%0.099%KU740184.2Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds11621162100%0.099%KU729217.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds11621162100%0.099%KU761564.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds11621162100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds11621162100%0.099%KU501216.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds11621162100%0.099%KU312312.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome11621162100%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds11621162100%0.099%KM078936.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds11621162100%0.099%KJ873160.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds11621162100%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds11591159100%0.099%KM078961.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome11571157100%0.099%KU940228.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome11571157100%0.099%KU940224.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome11571157100%0.099%KU926309.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds11571157100%0.099%KU365778.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds11571157100%0.099%KM078971.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds11571157100%0.099%KM078930.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds11551155100%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds11551155100%0.099%KM078933.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds11531153100%0.099%KU729218.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds11531153100%0.099%KM078929.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome11441144100%0.099%KX117076.1Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome11391139100%0.099%KX253996.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds11391139100%0.099%KX185891.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds11391139100%0.099%KU963796.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds11391139100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome11391139100%0.099%KU820899.2Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome11391139100%0.099%KU681081.3Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome11391139100%0.099%KU744693.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds11391139100%0.099%KM851039.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds11351135100%0.099%KU179098.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds11351135100%0.099%KF993678.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds11211121100%0.098%KU866423.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1113111395%0.099%KJ873161.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome11121112100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds11121112100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds11121112100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome10991099100%0.098%KU681082.3Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds10991099100%0.098%KM851038.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds1000100099%0.094%HQ234499.1Select seq gb|KU985087.1|Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds94694681%0.099%KU985087.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds93093079%0.099%KU556802.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds86586599%0.090%KF268949.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds85985999%0.089%KF383118.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds85485499%0.089%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome85485499%0.089%KU955594.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds85485499%0.089%KU720415.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID85485499%0.089%LC002520.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds85485499%0.089%KF383121.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds85485499%0.089%KF383119.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds85485499%0.089%HQ234498.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds85485499%0.089%DQ859059.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome85485499%0.089%AY632535.2Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds85485499%0.089%AF013415.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds85085099%0.089%KU963574.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds85085099%0.089%HQ234500.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome84584599%0.089%KX198134.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome84184199%0.089%KU955595.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome84184199%0.089%KU955592.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome84184199%0.089%KU955591.1Select seq gb|KU867812.1|Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds83883871%0.0100%KU867812.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds83283299%0.089%KF383116.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds82982971%0.099%KU232300.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds82782771%0.099%KU232290.1
-
2015 Panama Zika Sequences
LOCUS KU724098 648 bp RNA linear VRL 11-JUN-2016 DEFINITION Zika virus isolate 259060_2015_Panama NS5B gene, partial cds. ACCESSION KU724098 VERSION KU724098.1 GI:998178890 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 648) AUTHORS Arauz,D., De Urriola,L., Jones,J., Castillo,M., Martinez,A., Murillo,E., Troncoso,L., Chen,M., Abrego,L., Armien,B., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Febrile or Exanthematous Illness Associated with Zika, Dengue, and Chikungunya Viruses, Panama JOURNAL Emerging Infect. Dis. 22 (8) (2016) In press PUBMED 27139219 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 648) AUTHORS Arauz,D. Sr., De Urriola,L., Castillo,M., Martinez,A.A., Murillo,E., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Direct Submission JOURNAL Submitted (17-FEB-2016) Departament of Research in Virology and Biotechnology, Gorgas Institute For Health Studies Memorial Institute, Ave. Justo Arosemena 35th Street, Panama, Panama 0816-02593, Panama COMMENT ##Assembly-Data-START## Assembly Method :: Sequencher v. 4.5 Coverage :: partial Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..648 /organism="Zika virus" /mol_type="genomic RNA" /isolate="259060_2015_Panama" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Panama" /collection_date="29-Nov-2015" CDS <1..>648 /codon_start=3 /product="NS5B" /protein_id="AMK26954.1" /db_xref="GI:998178891" /translation="LALAIIKYXYQNKVVKVLRPAEKGKTVMDIISRQDQRGSGQVVT YALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDRLKRMAVSGDD CVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHHFNKLHLKDGR SIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRRDLRLMAN" ORIGIN 1 ccttggcatt ggccataatc aagtacrcat accaaaacaa agtggtaaag gtccttagac 61 cagctgaaaa agggaaaaca gttatggaca ttatttcgag acaagaccaa agggggagcg 121 gacaagttgt cacttacgct cttaacacat ttaccaacct agtggtgcaa ctcattcgga 181 atatggaggc tgaggaagtt ctagagatgc aagacttgtg gctgctgcgg aggtcagaga 241 aagtgaccaa ctggttgcag agcaacggat gggataggct caaacgaatg gcagtcagtg 301 gagatgattg cgttgtgaag ccaattgatg ataggtttgc acatgccctc aggttcttga 361 atgatatggg aaaagttagg aaggacacac aagagtggaa accctcaact ggatgggaca 421 actgggaaga agttccgttt tgctcccacc acttcaacaa gctccatctc aaggacggga 481 ggtccattgt ggttccctgc cgccaccaag atgaactgat tggccgggcc cgcgtctctc 541 caggggcggg atggagcatc cgggagactg cttgcctagc aaaatcatat gcgcaaatgt 601 ggcagctcct ttatttccac agaagggacc tccgactgat ggccaatg