Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. Circular Cladogram of 2753 BP from codon 1
  2. Circular Cladogram - 2753 BP from Codon 1
  3. 1 McCarthy M. Zika virus was transmitted by sexual contact in Texas, health officials report. BMJ 2016;352:i720-i720 CrossRef | Web of Science | Medline 2 Hill SL, Russell K, Hennessey M, et al. Transmission of Zika virus through sexual contact with travelers to areas of ongoing transmission — continental United States, 2016. MMWR Morb Mortal Wkly Rep 2016;65:215-216 CrossRef | Web of Science | Medline 3 Mansuy JM, Dutertre M, Mengelle C, et al. Zika virus: high infectious viral load in semen, a new sexually transmitted pathogen? Lancet Infect Dis 2016;16:405-405 CrossRef | Web of Science | Medline 4 Atkinson B, Hearn P, Afrough B, et al. Detection of Zika virus in semen. Emerg Infect Dis 2016 (in press) (http://dx.doi.org/10.3201/eid2205.160107). 5 Barzon L, Pacenti M, Berto A, et al. Isolation of infectious Zika virus from saliva and prolonged viral RNA shedding in a traveller returning from the Dominican Republic to Italy, January 2016. Euro Surveill 2016;21). CrossRef | Medline
  4. Phylogenetic Tree http://www.nejm.org/action/showImage?doi=10.1056%2FNEJMc1604449&iid=f01
  5. To the Editor:Zika virus (ZIKV), an emerging flavivirus, generally causes mild infection in humans but is associated with severe neurologic complications and adverse fetal outcomes. ZIKV is transmitted to humans primarily by aedes mosquitoes. However, there is some evidence of sexual transmission.1,2 Two studies have shown the presence of infectious ZIKV in semen.3 A recent article described detection of ZIKV RNA in semen 62 days after the onset of illness, but infectious virus was not cultured.4 We report a case of ZIKV infection in a previously healthy 24-year-old woman (Patient 1) who was living in Paris and in whom acute fever, myalgia, arthralgia, and pruritic rash developed on February 20, 2016. She was not receiving any medication, had not received any blood transfusions, and had never traveled to a region where Zika was epidemic or to tropical or subtropical areas. Her last trip outside France was to Okinawa, Japan, from December 21, 2015, to January 1, 2016. A clinical examination on February 23 showed a maculopapular rash on the patient’s abdomen, arms, and legs and a temperature of 36.6°C. The illness lasted approximately 7 days. Patient 1 reported sexual contact between February 11 and February 20, 2016, with a man (Patient 2, the index patient) who had stayed in Brazil from December 11, 2015, through February 9, 2016. The sexual contact involved seven episodes of both vaginal sexual intercourse, without ejaculation and without the use of a condom, and oral sex with ejaculation. Patient 2, a 46-year-old man, reported fever, asthenia, myalgia, chills, and a cutaneous rash that began on February 7, while he was in Rio de Janeiro. The symptoms had resolved on the day he arrived in France on February 10. The clinical examination of Patient 2 was normal on February 23 (details are provided in the Supplementary Appendix, available with the full text of this letter at NEJM.org). Populations of Aedes aegypti and A. albopictus mosquitoes are not established in the city of Paris. Moreover, in France, the diapause period of aedes species extends from December to May. Three days after the onset of her symptoms, on February 23, samples of urine and saliva were obtained from Patient 1. The urine sample tested positive for ZIKV RNA by reverse-transcriptase polymerase chain reaction (RT-PCR) at a viral count of 3.5×103 copies per milliliter, and the saliva tested positive at a viral count of 2.1×104 copies per milliliter. A plasma sample tested negative for ZIKV RNA by RT-PCR, but serum IgM antibodies to ZIKV were detected (see the Supplementary Appendix). A vaginal swab obtained on March 1 was negative for ZIKV RNA by RT-PCR. In Patient 2, a urine sample obtained 16 days after the onset of symptoms tested positive for ZIKV RNA by RT-PCR with a viral count of 4×103 copies per milliliter, but plasma and saliva samples tested negative. The first and second urine stream samples obtained on day 24 were positive for ZIKV RNA with a viral count of 2.1×104 copies per milliliter. Semen samples tested positive for ZIKV RNA by RT-PCR with a high viral load of 2.9×108 copies per milliliter in the sample obtained on day 18 and 3.5×107 copies per milliliter in the sample obtained on day 24. ZIKV was isolated by means of culture from semen samples on days 18 and 24. Timelines are shown in Figure 1AFIGURE 1Clinical Events and Phylogenetic Analysis of Zika Virus in the Patients.. A complete ZIKV genome was sequenced from saliva samples obtained from Patient 1 and semen samples obtained from Patient 2 (see theSupplementary Appendix). Only four mutations, all of them synonymous, differentiate the sequences of the two patients. The complete nucleotide coding sequences of ZIKV identified in these semen and saliva samples cluster together within the phylogenetic tree (Figure 1B). These data support the hypothesis of sexual transmission (either oral or vaginal) of ZIKV from Patient 2 to Patient 1. We cannot rule out the possibility that transmission occurred not through semen but through other biologic fluids, such as pre-ejaculate secretions or saliva exchanged through deep kissing. The saliva of Patient 2 tested negative on day 10 after the onset of his symptoms, but it was not tested earlier. ZIKV has been detected in saliva,5 but, to our knowledge, no cases of transmission through saliva have been documented. The current outbreaks of ZIKV infection should be an opportunity to conduct studies to understand the natural history of ZIKV. We need to better define recommendations to prevent transmission of the virus. In particular, guidelines regarding how long men who are returning from an area where active ZIKV transmission is occurring should continue to use condoms during sexual contact with pregnant women and those of child-bearing age are lacking. In addition, recommendations regarding the possibility of oral transmission of the virus through semen are needed.
  6. Eric D’Ortenzio, M.D. Institut National de la Santé et de la Recherche Médicale, Paris, France Sophie Matheron, M.D. Hôpital Bichat Assistance Publique–Hôpitaux de Paris, Paris, France Xavier de Lamballerie, M.D., Ph.D. Université Aix-Marseille, Marseille, France Bruno Hubert, M.D. Institut de Veille Sanitaire, Saint Maurice, France Géraldine Piorkowski, Ph.D. Institut National de la Santé et de la Recherche Médicale, Paris, France Marianne Maquart, Ph.D. French Armed Forces Biomedical Research Institute, Marseille, France Diane Descamps, M.D., Ph.D. Florence Damond, Pharm.D., Ph.D. Yazdan Yazdanpanah, M.D., Ph.D. Institut National de la Santé et de la Recherche Médicale, Paris, France [email protected] Isabelle Leparc-Goffart, Ph.D. French Armed Forces Biomedical Research Institute, Marseille, France Supported in part by the European Virus Archive Goes Global project, which received a grant (653316) from the European Union Horizon 2020 Framework Program for Research and Innovation. Disclosure forms provided by the authors are available with the full text of this letter at NEJM.org. Drs. D’Ortenzio and Matheron contributed equally to this letter. This letter was published on April 13, 2016, at NEJM.org.
  7. CORRESPONDENCE Evidence of Sexual Transmission of Zika VirusN Engl J Med 2016; 374:2195-2198June 2, 2016DOI: 10.1056/NEJMc1604449 http://www.nejm.org/doi/full/10.1056/NEJMc1604449
  8. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  9. FINDLAY — The first travel-related Zika virus case in northwest Ohio has been confirmed by tests sent to the Centers for Disease Control. A 50-year old Hancock County man has the virus and recently returned from a trip to the Caribbean, said Karim Baroudi, Hancock County Health Commissioner. “He is doing fine,” Mr. Baroudi said. “ It was not transmitted locally and there are no cases that were transmitted here in Ohio.” According to the Ohio Department of Health, there are now 13 travel-related cases of the virus in the state. State health leaders informed Hancock County officials late Thursday afternoon that the test was positive for Zika. The health department has reached out to the man to inform him that the virus can be transmitted sexually to other people, Mr. Baroudi said. Zika is virus transmitted to people through a mosquito bite. The primary mosquito, Aedes aegypti, is found in the tropics and southern United States., but it is not known to be established in Ohio. A “relative” of the mosquito, Aedes albopictus, called the Asian tiger mosquito is found in parts of Ohio and may potentially transmit Zika virus. Health officials urge anyone returning from Zika affected areas to take precautions such as abstaining from sex or using a condoms for a period of 8 weeks following travel. Some of the symptoms of the virus in men are fever, rash, joint pain, and muscle pain, said Mr. Baroudi. Health officials are also recommending that pregnant women consider postponing travel to any area where Zika virus transmission is ongoing. Zika is linked to cases of microcephaly, a condition in which the baby is born with an abnormally small head and an underdeveloped brain. Contact Marlene Harris-Taylor at: [email protected], 419-724-6091, or on Twitter@marlenetaylor48. http://www.toledoblade.com/Medical/2016/06/03/The-first-travel-related-Zika-virus-case-in-northwest-Ohio-has-been-confirmed-by-tests-sent-to-the-Centers-for-Disease-Control.html
  10. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  11. Third Confirmed Case of Travel-Acquired Zika Virus InfectionJune 3, 2016 - Zoonotic Diseases - DiseaseThe New Mexico Department of Health announced today a third travel-related case of Zika in the state in a 41-year-old Chaves County man. The man acquired the virus while traveling to Central America. The Department of Health’s Scientific Laboratory Division, which recently began Zika testing, confirmed the case. One of the mosquito species that can transmit the Zika virus has been found in Chaves County in the summer and fall; however, in this case, there was no risk of local transmission because there was no mosquito activity when the case occurred. “This case should serve as a reminder to people in Chaves County to start taking precautions to reduce mosquito breeding sites on their property,” said Paul Ettestad, the department’s public health veterinarian. “The Aedes albopictus mosquito that can transmit Zika virus has been found in Chaves County in past years. Everyone in Chaves County should be looking around their home and emptying out and scrubbing containers that have water in them to reduce breeding sites for this mosquito.” The CDC has issued travel warnings for anyone headed to specific countries where there is active mosquito-borne transmission of Zika virus. The latest list of affected countries can be found at the Zika Virus Travel Information webpage. Most people infected with Zika virus won’t even know they have the disease because they won’t have symptoms; however, in infected pregnant women the virus has been linked to birth defects including microcephaly and other poor birth outcomes. Zika virus can be passed from a pregnant woman to her fetus during pregnancy or at delivery. While the virus is mainly transmitted by mosquitos, it can also be transmitted through semen. CDC recommends pregnant women avoid travel to an area with Zika and that men traveling to areas where virus is actively transmitted by mosquitoes to either abstain from having sex with a pregnant partner, or properly use a condom for the duration of the pregnancy. To avoid Zika and other viruses like West Nile Virus, which are spread by mosquitos, take the following steps: Wear long-sleeved shirts and long pants.Stay in places with air conditioning or that use window and door screens to keep mosquitoes outside.Sleep under a mosquito bed net if you are overseas or outside and are not able to protect yourself from mosquito bites.Use Environmental Protection Agency (EPA)-registered insect repellents. When used as directed, EPA registered insect repellents are proven safe and effective, even for children and pregnant or breast-feeding women.Always follow the product label instructionsReapply insect repellent as directedDo not spray repellent on the skin under clothingIf you are also using sunscreen, apply sunscreen before applying insect repellentIf you have a baby or child:Do not use insect repellent on babies younger than 2 months of age (follow label instructions)Dress your child in clothing that covers arms and orCover crib, stroller, and baby carrier with mosquito netting.Do not apply insect repellent onto a child’s hands, eyes, mouth, or cut or irritated skin.Adults: Spray insect repellent onto your hands and then apply to a child’s face.Treat clothing and gear with perethrin or purchase permethrin-treated items.Treated clothing remains protective after multiple washings. See product information to learn how long the protection will last.If treating items yourself, follow the product instructions carefully.Do NOT use permethrin products directly on skin. They are intended to treat clothing.The CDC reports that as of June 1, 2016, there have been 618 cases of Zika virus infection reported in the United States, all travel-related, with an additional 1,114 in US territories. For more information, please visit the Zika Virus and Zika Virus Information for Pregnant Women pages. Media ContactWe would be happy to provide additional information about this press release. Simply contact Kenny Vigil at 505-827-2619 (Office) or 505-470-2290 (Mobile) with your questions.
  12. The New Mexico Department of Health announced today a third travel-related case of Zika in the state in a 41-year-old Chaves County man. The man acquired the virus while traveling to Central America. The Department of Health’s Scientific Laboratory Division, which recently began Zika testing, confirmed the case. https://nmhealth.org/news/disease/2016/6/?view=426
  13. niman replied to niman's topic in Texas
    Zika Virus – June 3, 2016. Texas has had 40 reported cases of Zika virus disease. Of those, 39 were in travelers who were infected abroad and diagnosed after they returned home; one of those travelers was a pregnant woman. One case involved a Dallas County resident who had sexual contact with someone who acquired the Zika infection while traveling abroad. Case counts by county: Bexar – 6 Collin – 1 Dallas – 6 Denton – 2 Fort Bend – 2 Grayson – 1Harris – 13 Tarrant – 4 Travis – 2 Val Verde – 1 Williamson – 1 Wise – 1
  14. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  15. Zika virus cases in Ohio: https://www.odh.ohio.gov/odhprograms/bid/zdp/diseases/zika.aspx Quote Edit Options
  16. niman replied to niman's topic in Ohio
    Zika virus cases in Ohio:
  17. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  18. Newborn in Bergen Co not included in updated table Zika Cases in New Jerseyhttp://www.nj.gov/health/cd/zika/case_count.shtml New Jersey County Confirmed Travel-Related Cases Bergen 7 Passaic 3 Morris 2 Hudson 1 Camden 1 Burlington 3 Union 1 Essex 1 TOTAL 19 Last Updated: June 3, 2016
  19. Zika Cases in New Jersey New Jersey County Confirmed Travel-Related Cases Bergen 7 Passaic 3 Morris 2 Hudson 1 Camden 1 Burlington 3 Union 1 Essex 1 TOTAL 19 Last Updated: June 3, 2016
  20. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  21. Map Update https://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU
  22. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX212103.1|Zika virus isolate BRZIKV_AB_ES polyprotein gene, partial cds50665066100%0.0100%KX212103.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds50435043100%0.099%KU729218.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome50395039100%0.099%KU940228.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome50395039100%0.099%KU707826.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds50395039100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds50395039100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds50395039100%0.099%KU365777.1Select seq gb|KX280026.1|Zika virus isolate Paraiba_01, complete genome50345034100%0.099%KX280026.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome50345034100%0.099%KU509998.3Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome50345034100%0.099%KU940224.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome50345034100%0.099%KU321639.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome50305030100%0.099%KX197192.1Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome50255025100%0.099%KX087101.2Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome50255025100%0.099%KU926310.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome50255025100%0.099%KU501215.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds50255025100%0.099%KJ776791.1Select seq gb|KU758877.1|Zika virus isolate 17271 polyprotein gene, complete cds50215021100%0.099%KU758877.1Select seq gb|KX262887.1|Zika virus isolate 103451, complete genome50215021100%0.099%KX262887.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome50215021100%0.099%KX198135.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds50215021100%0.099%KU955590.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds50215021100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds50215021100%0.099%KU501216.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds50215021100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds50215021100%0.099%KU312312.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome50165016100%0.099%KX051563.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds50165016100%0.099%KX056898.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome50165016100%0.099%KU926309.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome50165016100%0.099%KU853013.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome50165016100%0.099%KU497555.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome50145014100%0.099%KU853012.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds50125012100%0.099%KX247632.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds50125012100%0.099%KU991811.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome50125012100%0.099%KU870645.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds50125012100%0.099%KU729217.2Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome50075007100%0.099%KX156776.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome50075007100%0.099%KX156775.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome50075007100%0.099%KX117076.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds50075007100%0.099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds50075007100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds50075007100%0.099%KU761564.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds50075007100%0.099%KU647676.1Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome50035003100%0.099%KX253996.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome50035003100%0.099%KX247646.1Select seq gb|KU820897.2|Zika virus isolate FLR polyprotein gene, complete cds50035003100%0.099%KU820897.2Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds50035003100%0.099%KX185891.1Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds50035003100%0.099%KU937936.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome50035003100%0.099%KX156774.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome50035003100%0.099%KX087102.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds50035003100%0.099%KU963796.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds50035003100%0.099%KU955589.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome50035003100%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome50035003100%0.099%KU922923.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome50035003100%0.099%KU820899.2Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds49984998100%0.099%KU866423.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome49944994100%0.099%KU527068.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome49714971100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome49174917100%0.099%KU681081.3Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds48864886100%0.099%KF993678.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome48324832100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds48324832100%0.098%JN860885.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome47824782100%0.098%KU681082.3Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds47804780100%0.098%EU545988.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds44864486100%0.095%HQ234499.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome4464464894%0.098%KU940227.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds36363636100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds36333633100%0.089%KF268948.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds36263626100%0.089%KF268950.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds36153615100%0.089%KF383115.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds35973597100%0.088%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome35973597100%0.088%KU955594.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds35973597100%0.088%KU720415.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds35973665100%0.088%KF383118.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds35973597100%0.088%HQ234498.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID35913591100%0.088%LC002520.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds35913591100%0.088%DQ859059.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome35913591100%0.088%AY632535.2Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds35883588100%0.088%KF383121.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds35883588100%0.088%KF383119.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds35483548100%0.088%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds35433543100%0.088%HQ234501.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome35373537100%0.088%KU955595.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome35373537100%0.088%KU955592.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome35373537100%0.088%KU955591.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome35344016100%0.088%KX198134.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds35253525100%0.088%HQ234500.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds35193627100%0.088%KU963574.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds34983498100%0.088%KF383117.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence3047304799%0.084%KF383120.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds2576257651%0.099%KU646827.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds2571257151%0.099%KU646828.1Select seq gb|KX101064.1|Zika virus isolate Bahia11, partial genome2277350778%0.092%KX101064.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds1925192538%0.099%KU740199.1Select seq gb|KX101066.1|Zika virus isolate Bahia01, partial genome1786381376%0.099%KX101066.1Select seq gb|KX101061.1|Zika virus isolate Bahia03, partial genome1573334978%0.091%KX101061.1Select seq gb|KU758875.1|Zika virus isolate 15042 polyprotein gene, partial cds1375137527%0.099%KU758875.1Select seq gb|KU758871.1|Zika virus isolate 17170 polyprotein gene, partial cds1353135326%0.099%KU758871.1Select seq gb|KU758873.1|Zika virus isolate 18246 polyprotein gene, partial cds1350135026%0.099%KU758873.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds1350135026%0.099%KU312315.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds1350135026%0.099%KU312314.1Select seq gb|KU758872.1|Zika virus isolate 01170 polyprotein gene, partial cds1346134626%0.099%KU758872.1Select seq gb|KU758870.1|Zika virus isolate 17160 polyprotein gene, partial cds1346134626%0.099%KU758870.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds1346134626%0.099%KU312313.1Select seq gb|KU758876.1|Zika virus isolate 21068 polyprotein gene, partial cds1335133526%0.099%KU758876.1Select seq gb|KU758869.1|Zika virus isolate 05211 polyprotein gene, partial cds1310131026%0.099%KU758869.1Select seq gb|KU758874.1|Zika virus isolate 20114 polyprotein gene, partial cds1290129025%0.099%KU758874.1Select seq gb|KU758868.1|Zika virus isolate 27229 polyprotein gene, partial cds1285128525%0.099%KU758868.1Select seq gb|KX101063.1|Zika virus isolate Bahia05, partial genome1180264553%0.099%KX101063.1Select seq gb|KX101060.1|Zika virus isolate Bahia02, partial genome991265053%0.097%KX101060.1Select seq gb|KX247638.1|Zika virus isolate Dominican_Rep-Rus-3-2016 polyprotein gene, partial cds88388317%0.0100%KX247638.1Select seq gb|KU978616.1|Zika virus isolate Dominican_Rep-Rus-2-2016 polyprotein gene, partial cds87787717%0.099%KU978616.1Select seq gb|KX101065.1|Zika virus isolate Bahia15, partial genome852253360%0.085%KX101065.1Select seq gb|KX101062.1|Zika virus isolate Bahia04, partial genome820238949%0.096%KX101062.1Select seq gb|KU872850.1|Zika virus isolate Dominican Rep-Rus-2016, NS2 partial cds82082016%0.099%KU872850.1Select seq gb|KX101067.1|Zika virus isolate Bahia12, partial genome809287761%0.091%KX101067.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds691109983%0.070%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds63063012%5e-17699%KJ634273.1
  23. LOCUS KX212103 2809 bp RNA linear VRL 01-JUN-2016 DEFINITION Zika virus isolate BRZIKV_AB_ES polyprotein gene, partial cds. ACCESSION KX212103 VERSION KX212103.1 GI:1029979765 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 2809) AUTHORS Garcez,P., Nascimento,J.M., Vasconcelos,J.M., da Costa,R.M., Delvecchio,R., Trindade,P., Loiola,E.C., Higa,L.M., Cassoli,J., Vitoria,G., Sequeira,P., Sochacki,J., Aguiar,R., Fuzii,H.T., de Filippis,A.M.B., Vianez,J.L.S.G. Jr., Martins-de-Souza,D., Tanuri,A. and Rehen,S.K. TITLE Zika virus alters molecular fingerprinting in neural progenitors JOURNAL Unpublished REFERENCE 2 (bases 1 to 2809) AUTHORS Vasconcelos,J.M., Sequeira,P.C., Higa,L.M., Lemos,P.S., de Oliveira,R.S., Silva,S.P., de Filippis,A.M.B. and Tanuri,A. TITLE Direct Submission JOURNAL Submitted (03-MAY-2016) Center for Technological Innovation, Evandro Chagas Institute, BR-316 KM 7, Ananindeua, PA 67030-000, Brazil FEATURES Location/Qualifiers source 1..2809 /organism="Zika virus" /mol_type="genomic RNA" /isolate="BRZIKV_AB_ES" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="01-Sep-2015" CDS <1..>2809 /codon_start=1 /product="polyprotein" /protein_id="ANF29038.1" /db_xref="GI:1029979766" /translation="IVIGVGEKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWD FGSVGGALNSLGKGIHQIFGAAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMC LALGGVLIFLSTAVSADVGCSVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRL AAAVKQAWEDGICGISSVSRMENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRG PQRLPVPVNELPHGWKAWGKSYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDH GFGVFHTSVWLKVREDYSLECDPAVIGTAVKGREAVHSDLGYWIESEKNDTWRLKRAH LIEMKTCEWPKSHTLWTDGIEESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHGEELE IRFEECPGTKVHVEETCGTRGPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYG MEIRPRKEPESNLVRSMVTAGSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSM AVLVAMILGGFSMSDLAKLAILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFR ANWTPRESMLLALASCLLQTAISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAI LAALTPLARGTLLVAWRAGLATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPI NVVGLLLLTRSGKRSWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVV SGKSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVV LMTICGMNPIAIPFAAGAWYVYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRL LGSTQVGVGVMQEGVFHTMWHVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAA WDGHSEVQLLAVPPGERARNIQ" ORIGIN 1 attgtcatag gagtcgggga gaagaagatc acccaccact ggcacaggag tggcagcacc 61 attggaaaag catttgaagc cactgtgaga ggtgccaaga gaatggcagt cttgggagac 121 acggcctggg actttggatc agttggaggc gctctcaact cattgggcaa gggcatccat 181 caaatttttg gagcagcttt caaatcattg tttggaggaa tgtcctggtt ctcacaaatt 241 ctcattggaa cgttgctgat gtggttgggt ctgaacacaa agaatggatc tatttccctt 301 atgtgcttgg ccttaggggg agtgttgatc ttcttatcca cagccgtctc tgctgatgtg 361 gggtgctcgg tggacttctc aaagaaggag acgagatgcg gtacaggggt gttcgtctat 421 aacgacgttg aagcctggag ggacaggtac aagtaccatc ctgactcccc ccgtagattg 481 gcagcagcag tcaagcaagc ctgggaagat ggtatctgcg ggatctcctc tgtttcaaga 541 atggaaaaca tcatgtggag atcagtagaa ggggagctca acgcaatcct ggaagagaat 601 ggagttcaac tgacggtcgt tgtgggatct gtaaaaaacc ccatgtggag aggtccacag 661 agattgcccg tgcctgtgaa cgagctgccc cacggctgga aggcttgggg gaaatcgtac 721 ttcgtcagag cagcaaagac aaataacagc tttgtcgtgg atggtgacac actgaaggaa 781 tgcccactca aacatagagc atggaacagc tttcttgtgg aggatcatgg gttcggggta 841 tttcacacta gtgtctggct caaggttaga gaagattatt cattagagtg tgatccagcc 901 gttattggga cagctgttaa gggaagggag gctgtacaca gtgatctagg ctactggatt 961 gagagtgaga agaatgacac atggaggctg aagagggccc atctgatcga gatgaaaaca 1021 tgtgaatggc caaagtccca cacattgtgg acagatggaa tagaagagag tgatctgatc 1081 atacccaagt ctttagctgg gccactcagc catcacaata ccagagaggg ctacaggacc 1141 caaatgaaag ggccatggca cggtgaagag cttgaaattc ggtttgagga atgcccaggc 1201 actaaggtcc acgtggagga aacatgtgga acaagaggac catctctgag atcaaccact 1261 gcaagcggaa gggtgatcga ggaatggtgc tgcagggagt gcacaatgcc cccactgtcg 1321 ttccgggcta aagatggctg ttggtatgga atggagataa ggcccaggaa agaaccagaa 1381 agcaacttag taaggtcaat ggtgactgca ggatcaactg atcacatgga tcacttctcc 1441 cttggagtgc ttgtgattct gctcatggtg caggaagggc tgaagaagag aatgaccaca 1501 aagatcatca taagcacatc aatggcagtg ctggtagcta tgatcctggg aggattttca 1561 atgagtgacc tggctaagct tgcaattttg atgggtgcca ccttcgcgga aatgaacact 1621 ggaggagatg tagctcatct ggcgctgata gcggcattca aagtcagacc agcgttgctg 1681 gtatctttca tcttcagagc taattggaca ccccgtgaaa gcatgctgct ggccttggcc 1741 tcgtgtcttt tgcaaactgc gatctccgcc ttggaaggcg acctgatggt tctcatcaat 1801 ggttttgctt tggcctggtt ggcaatacga gcgatggttg ttccacgcac tgataacatc 1861 accttggcaa tcctggctgc tctgacacca ctggcccggg gcacactgct tgtggcgtgg 1921 agagcaggcc ttgctacttg cggggggttt atgctcctct ctctgaaggg aaaaggcagt 1981 gtgaagaaga acttaccatt tgtcatggcc ctgggactaa ccgctgtgag gctggtcgac 2041 cccatcaacg tggtgggact gctgttgctc acaaggagtg ggaagcggag ctggccccct 2101 agcgaagtac tcacagctgt tggcctgata tgcgcattgg ctggagggtt cgccaaggca 2161 gatatagaga tggctgggcc catggccgcg gtcggtctgc taattgtcag ttacgtggtc 2221 tcaggaaaga gcgtggacat gtacattgaa agagcaggtg acatcacatg ggaaaaagat 2281 gcggaagtca ctggaaacag tccccggctc gatgtggcgc tagatgagag tggtgatttc 2341 tccctggtgg aggatgacgg tccccccatg agagagatca tactcaaggt ggtcctgatg 2401 accatctgtg gcatgaaccc aatagccata ccctttgcag ctggagcgtg gtacgtatac 2461 gtgaagactg gaaaaaggag tggtgctcta tgggatgtgc ctgctcccaa ggaagtaaaa 2521 aagggggaga ccacagatgg agtgtacaga gtaatgactc gtagactgct aggttcaaca 2581 caagttggag tgggagttat gcaagagggg gtctttcaca ctatgtggca cgtcacaaaa 2641 ggatccgcgc tgagaagcgg tgaagggaga cttgatccat actggggaga tgtcaagcag 2701 gatctggtgt catactgtgg tccatggaag ctagatgccg cctgggacgg gcacagcgag 2761 gtgcagctct tggccgtgcc ccccggagag agagcgagga acatccaga

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.