Jump to content

niman

Super Administrators
  • Posts

    74,774
  • Joined

  • Last visited

  • Days Won

    31

Everything posted by niman

  1. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  2. Travel-associated Zika cases confirmed in Arizona: 4http://www.azdhs.gov/preparedness/epidemiology-disease-control/mosquito-borne/index.php#zika-home
  3. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  4. June 2, 2016 DEPARTMENT OF HEALTH DAILY ZIKA UPDATE: THREE NEW TRAVEL-RELATED CASES TODAY Contact:Communications [email protected](850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the Florida Department of Health will issue a Zika virus update each week day at 2 p.m. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. There are three new travel-related cases today with one in Miami-Dade County and two in Broward County. Of the cases confirmed in Florida, seven cases are still exhibiting symptoms. According to CDC, symptoms associated with the Zika virus last between seven to 10 days. CDC recommends that women who are pregnant or thinking of becoming pregnant postpone travel to Zika affected areas. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms since January. The total number of pregnant women who have been monitored is 38, with 9 having met the previous CDC case definition. County Number of Cases (all travel related) Alachua 4 Brevard 3 Broward 19 Clay 2 Collier 2 Hillsborough 3 Lee 5 Martin 1 Miami-Dade 50 Orange 10 Osceola 5 Palm Beach 7 Pasco 1 Pinellas 4 Polk 3 Santa Rosa 1 Seminole 3 St. Johns 2 Volusia 2 Total cases not involving pregnant women 127 Cases involving pregnant women regardless of symptoms* 38 *Counties of pregnant women will not be shared. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 1,931 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. All cases are travel-associated. There have been no locally-acquired cases of Zika in Florida. For more information on the Zika virus, click here. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. More Information on DOH action on Zika: On Feb. 3, Governor Scott directed the State Surgeon General to issue a Declaration of Public Health Emergency for the counties of residents with travel-associated cases of Zika.There have been 19 counties included in the declaration– Alachua, Brevard, Broward, Clay, Collier, Hillsborough, Lee, Martin, Miami-Dade, Orange, Osceola, Palm Beach, Pasco, Pinellas, Polk, Santa Rosa, Seminole, St. Johns and Volusia – and will be updated as needed. DOH encourages Florida residents and visitors to protect themselves from all mosquito-borne illnesses by draining standing water; covering their skin with repellent and clothing; and covering windows with screens.DOH has a robust mosquito-borne illness surveillance system and is working with CDC, the Florida Department of Agriculture and Consumer Services and local county mosquito control boards to ensure that the proper precautions are being taken to protect Florida residents and visitors.On April 6, Governor Rick Scott and Interim State Surgeon General Dr. Celeste Philip hosted a conference call with Florida Mosquito Control Districts to discuss ongoing preparations to fight the possible spread of the Zika virus in Florida. There were 74 attendees on the call.On May 11, Governor Scott met with federal leaders on the importance of preparing for Zika as we would a hurricane. Governor Scott requested 5,000 Zika preparedness kits from HHS Secretary Sylvia Burwell as well as a plan from FEMA on how resources will be allocated to states in the event an emergency is declared.On June 1, Governor Scott requested President Obama to provide preparedness items needed in order to increase Florida’s capacity to be ready when Zika becomes mosquito-borne in our state.Florida currently has the capacity to test 6,142 people for active Zika virus and 1,843 for Zika antibodies.Federal Guidance on Zika: According to CDC, Zika illness is generally mild with a rash, fever and joint pain. CDC researchers have concluded that Zika virus is a cause of microcephaly and other birth defects.The FDA released guidance regarding donor screening, deferral and product management to reduce the risk of transfusion-transmission of Zika virus. Additional information is available on the FDA website here.CDC has put out guidance related to the sexual transmission of the Zika virus. This includes CDC recommendation that if you have traveled to a country with local transmission of Zika you should abstain from unprotected sex.Based on CDC guidance released, DOH will now report pregnant women with evidence of Zika virus regardless of symptoms. Prior to new guidance, CDC guidance was only to report cases of Zika if the pregnant women was symptomatic.For more information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov. http://www.floridahealth.gov/newsroom/2016/06/060216-zika-update.html
  5. County Number of Cases (all travel related) Alachua 4 Brevard 3 Broward 19 Clay 2 Collier 2 Hillsborough 3 Lee 5 Martin 1 Miami-Dade 50 Orange 10 Osceola 5 Palm Beach 7 Pasco 1 Pinellas 4 Polk 3 Santa Rosa 1 Seminole 3 St. Johns 2 Volusia 2 Total cases not involving pregnant women 127 Cases involving pregnant women regardless of symptoms* 38 *Counties of pregnant women will not be shared.
  6. As CDC tracks 341 pregnant women with Zika, doctors detail story of devastated mom of first baby born with infection in N.Y. area By Ariana Eunjung Cha June 2 at 2:30 PM Officials at Hackensack University Medical Center say a 31-year-old woman from Honduras delivered a baby girl impacted by Zika virus on Tuesday. (AP Photo/Frank Franklin II)Across the United States, more than 340 pregnant women infected with Zika virus are waiting to find out what fate holds for their unborn children. The odds are not encouraging. Researchers estimate that the chances that a fetus will develop a severe brain defect known as microcephaly are as high as 13 percent for those who contracted the pathogen during the first trimester. Little is known about this forced sisterhood except that they all appear to have acquired Zika while abroad and that federal health officials, in conjunction with state and local authorities, are monitoring each woman closely. On Wednesday, doctors treating one of those women in the New York area announced the heartbreaking news that her child — a girl and the first to be born to a Zika-infected mother on the U.S. mainland — has severe birth defects. Not only does the baby have microcephaly, they said, but she is also suffering from intestinal issues and “structural abnormalities of the eye.” Get Zika news by email We will update you when news breaks about the virus. Sign up Abdulla Al-Khan, a specialist in maternal and fetal medicine at Hackensack University Medical Center in New Jersey, described the mother as sad. “She is trying her best to cope with this emotionally,” Al-Khan said at a news conference. The unidentified 31-year-old woman’s story began in Honduras in December when she was pregnant and developed a rash. She immediately went to see her doctor. [For Zika-infected pregnancies, microcephaly risk may be as high as 13 percent] “I told my gynecologist that I had an allergic episode,” she recounted in Spanish to Fox News from her hospital bed before the birth. “He said, ‘Don’t worry, everything will be fine. I don’t think you will be affected.' Then I had an ultrasound, and everything looked fine.” But her grandmother, a microbiologist, remained concerned. She sent a blood sample to the Centers for Disease Control and Prevention, which found that the woman was infected with the Zika virus, according to the local paper, the Record. The woman has said she believes she contracted the virus through a mosquito bite but isn’t sure. She traveled to the United States, where she has relatives, to seek better care for herself and her child, and on Friday and Monday she met with the team from the Hackensack center. Manny Alvarez, one of her physicians and a health editor for Fox, said she told them that “something is wrong with my baby’s brain.” Further imaging appeared to confirm her suspicions that the baby was likely to have microcephaly and that she was underweight. They advised her to have the baby as soon as possible. The delivery, via Caesarean section at 35 weeks, was without complications, and the baby came out crying, which was a good sign. The doctor described the baby as “relatively stable” but said the mother is distraught by the child’s prognosis. She’s “hanging in there,” Al-Khan told Fox. “But, of course, what human being isn’t going to be devastated by this news?” Al-Khan said that “you don't appreciate the magnitude of this problem until you see [an affected infant] and share the pain of what the mother is going through,” ABC News reported. Another baby with microcephaly was born to a Zika-infected mother in Hawaii earlier this year, but little information is available about that case. As of May 26, the CDC said is tracking 341 women in the United States and its territories who are pregnant and have been confirmed to have Zika infections regardless of whether they could recall any symptoms. Health officials have created surveillance systems that will look at numerous aspects of the pregnancies and the condition of their babies. U.S. officials have warned that Zika-carrying mosquitoes are likely to arrive in the southern part of the country in as soon as a few weeks as warmer weather arrives. Many local jurisdictions have begun spraying and warning residents to wear repellent and dress in long sleeves to try to minimize bites.World health officials recommended on Monday that women who are seeking to become pregnant should wait at least eight weeks after their return from an area where the Zika virus is active. Several thousand cases of suspected microcephaly have been reported in Brazil and other parts of Latin America in recent months. This post has been updated. https://www.washingtonpost.com/news/to-your-health/wp/2016/06/02/doctors-detail-story-of-devastated-mom-of-zika-affected-baby-born-in-ny-area-trying-her-best-to-cope-with-this-emotionally/
  7. Registration Date: 06/01/2016 15:06:28 the amended 06/01/2016 15:06:06 theREPORT CARD Ministry of Health confirmed 1,489 cases of microcephaly in the countrySince the beginning of the investigation, in October 2015, 7,723 suspected cases were reported, of which 3,072 were discarded and 3,162 remain in research The new epidemiological report released, on Wednesday (1), the Ministry of Health confirmed 1,489 cases of microcephaly and other nervous system disorders, suggestive of congenital infection throughout the country.The new report refers to the epidemiological week No. 20, which corresponds to the 28th of May. The report gathers information sent weekly by state health departments. In total, they reported 7,723 suspected cases since the beginning of the investigation, in October 2015, and 3,162 remain under investigation. Other 3,072 were discarded because of normal tests, or because they have microcephaly and or malformations confirmed because no infectious or do not meet the case definition. The 1,489 confirmed cases in Brazil occurred in 539 municipalities located in 25 states of the federation. Of these cases, 223 were confirmed by specific laboratory criteria for Zika virus. The Ministry of Health, however, points out that this figure does not represent adequately the total number of cases related to the virus. The folder considers that there was infection Zika most of the mothers who had babies with a final diagnosis of microcephaly. In relation to deaths in the same period, there were 294 suspected deaths of microcephaly and / or alteration of the central nervous system after delivery or during pregnancy (miscarriage or stillbirth) in the country. Of these, 63 were confirmed to microcephaly and / or alteration of the central nervous system. Other 192 are still under investigation and 39 were discarded. The Ministry of Health says it is investigating all cases of microcephaly and other disorders of the central nervous system, informed by the states, and the possible relationship with the Zika virus and other congenital infections. Microcephaly may be caused by , various infectious agents beyond Zika as Syphilis, Toxoplasmosis, Other Infectious Agents, Rubella, Cytomegalovirus and Herpes Viral. The folder guides pregnant women adopt measures to reduce the presence of Aedes aegypti, with the elimination of breeding sites, and protect themselves from mosquito exposure, keeping doors and closed or screened windows, wear pants and long sleeved shirts and use allowed repellents for pregnant women. Distribution of reported cases of microcephaly by UF until May 28, 2016 Regions and Federative Units Microcephaly cases and / or malformations suggestive of congenital infection Total accumulated 1of reported cases from 2015 to 2016 research confirmed 2.3 discarded 4 Brazil 3,162 1,489 3,072 7,723 Alagoas 63 72 165 300 Bahia 647 249 211 1,107 Ceará 186 110 194 490 Maranhão 80 126 55 261 Paraíba 311 129 442 882 Pernambuco 491 358 1,133 1,982 Piauí 11 85 71 167 large northern river 253 113 62 428 Sergipe 114 77 43 234 Northeast 2,156 1,319 2,376 5,851 Holy Spirit 88 12 49 149 Minas Gerais 54 3 55 112 Rio de Janeiro 275 64 116 455 Sao Paulo 198 to 8 b 123 329 Southeast region 615 87 343 1,045 Acre 21 0 17 38 Amapá two 8 1 11 Amazon 11 4 5 20 For 29 1 0 30 Rondônia 4 4 7 15 Roraima 9 8 7 24 Tocantins 93 11 33 137 North region 169 36 70 275 Federal district 4 5 35 44 Goiás 63 14 59 136 Mato Grosso 118 16 93 227 Mato Grosso do Sul two two 14 18 Midwest region 187 37 201 425 Paraná 6 4 27 37 Santa Catarina 1 1 5 7 Rio Grande do Sul 28 5 50 83 South region 35 10 82 127 Source: Health Departments of the States and the Federal District (updated data until 05/28/2016). 1.Cumulative number of reported cases that met the definition of previous operating case (33 cm), and the definitions adopted in Surveillance Protocol (from 12/09/2015) that defined the Head Circumference 32 cm for newborns to 37 or more weeks of gestation and other protocol definitions. 2. Present typical changes: indicative of congenital infection, such as intracranial calcifications, dilation of cerebral ventricles or changes in posterior fossa and other clinical signs observed by any imaging method or identification of Zika virus in laboratory tests. 3. 223 cases were confirmed by specific laboratory criteria for Zika virus (PCR and serology technique). 4.Discarded have normal exams by presenting microcephaly and / or congenital malformations confirmed by non -infectious causes or does not meet the case definitions. a) As reported by the Epidemiological Surveillance Center "Prof. Alexandre Vranjac ", the State Secretary of Health of São Paulo 198 cases are under investigation for congenital infection. Of these, 39 are possibly associated with infection by Zika virus, but have not yet been finalized investigations. b) 01 confirmed case of microcephaly Virus Zika in newborn with suspected infection site in another UF. Agency HealthCare to the press (61) 3315-3580 / 2351 http://portalsaude.saude.gov.br/index.php/cidadao/principal/agencia-saude/23933-ministerio-da-saude-confirma-1-489-casos-de-microcefalia-no-pais
  8. Pregnant Women with Any Laboratory Evidence of Possible Zika Virus InfectionUS States and the District of Columbia Pregnant women with any laboratory evidence of possible Zika virus infection: 195**This update includes aggregated data reported to the US Zika Pregnancy Registry as of May 26, 2016. US Territories Pregnant women with any laboratory evidence of possible Zika virus infection: 146**This update includes data from the US territories reported to the US Zika Pregnancy Registry and data from Puerto Rico reported to the Zika Active Pregnancy Surveillance System as of May 26, 2016.
  9. Zika virus disease in the United States, 2015–2016Language:EnglishEspañolPortuguêsRecommend on FacebookTweet Pregnant women with any laboratory evidence of possible Zika virus infection in the United States and territories Information for Blood and Tissue Collection Centers As of June 01, 2016 (5 am EST) Zika virus disease and Zika virus congenital infection are nationally notifiable conditions.This update from the CDC Arboviral Disease Branch includes provisional data reported to ArboNET for January 01, 2015 – June 01, 2016.US States Travel-associated cases reported: 618Locally acquired vector-borne cases reported: 0Total: 618Sexually transmitted: 11Guillain-Barré syndrome: 1US Territories Travel-associated cases reported: 4Locally acquired cases reported: 1,110Total: 1,114Guillain-Barré syndrome: 8 Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of May 25, 2016) StatesTravel-associated cases* No. (%) (N=591)Locally acquired cases† No. (%) (N=0)Alabama2 (<1)0 (0)Arizona3 (1)0 (0)Arkansas3 (1)0 (0)California44 (7)0 (0)Colorado2 (<1)0 (0)Connecticut1 (<1)0 (0)Delaware3 (1)0 (0)District of Columbia4 (1)0 (0)Florida121 (20)0 (0)Georgia15 (3)0 (0)Hawaii9 (2)0 (0)Illinois16 (3)0 (0)Indiana6 (1)0 (0)Iowa6 (1)0 (0)Kansas2 (<1)0 (0)Kentucky5 (1)0 (0)Louisiana4 (1)0 (0)Maine5 (1)0 (0)Maryland17 (3)0 (0)Massachusetts16 (3)0 (0)Michigan4 (1)0 (0)Minnesota17 (3)0 (0)Mississippi3 (1)0 (0)Missouri3 (1)0 (0)Montana1 (<1)0 (0)Nebraska2 (<1)0 (0)Nevada6 (1)0 (0)New Hampshire3 (1)0 (0)New Jersey14 (2)0 (0)New Mexico1 (<1)0 (0)New York127 (22)0 (0)North Carolina12 (2)0 (0)Ohio12 (2)0 (0)Oklahoma4 (1)0 (0)Oregon6 (1)0 (0)Pennsylvania19 (3)0 (0)Rhode Island4 (1)0 (0)South Carolina1 (<1)0 (0)Tennessee3 (1)0 (0)Texas36 (6)0 (0)Utah2 (<1)0 (0)Vermont1 (<1)0 (0)Virginia15 (3)0 (0)Washington3 (1)0 (0)West Virginia6 (1)0 (0)Wisconsin2 (<1)0 (0) Territories(N=4)(N=935)American Samoa0 (0)17 (2)Puerto Rico3 (75)903 (96)US Virgin Islands1 (25)15 (2)*Travelers returning from affected areas, their sexual contacts, or infants infected in utero †Presumed local mosquito-borne transmission Page last reviewed: February 4, 2016Page last updated: June 2, 2016
  10. Public DomainDoctors detail story of mother of Zika-affected baby born in New York area Somewhere in the United States, more than 300 pregnant women infected with Zika virus are waiting to find out what fate holds for their unborn children. COMMENT 0 0 By Ariana Eunjung Cha The Washington Post Posted Jun. 2, 2016 at 12:30 PM Author Information: Ariana Eunjung Cha is a national reporter. She has previously served as the Post's bureau chief in Shanghai and San Francisco, and as a correspondent in Baghdad. @arianaeunjung
  11. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome1842918429100%0.099%KU509998.3Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1842918429100%0.099%KJ776791.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds1841718417100%0.099%KU991811.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1841718417100%0.099%KU321639.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome1841118411100%0.099%KX051563.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1840818408100%0.099%KU729218.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1840818408100%0.099%KU707826.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1840818408100%0.099%KU365779.1Select seq gb|KX262887.1|Zika virus isolate 103451, complete genome1840218402100%0.099%KX262887.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome1840218402100%0.099%KX197192.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1839918399100%0.099%KU729217.2Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1839918399100%0.099%KU527068.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome1839318393100%0.099%KX198135.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome1839318393100%0.099%KU940228.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome1839318393100%0.099%KU926309.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1839318393100%0.099%KU501217.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1839318393100%0.099%KU365780.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1839018390100%0.099%KU647676.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1839018390100%0.099%KU501216.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1839018390100%0.099%KU365777.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome1838418384100%0.099%KX247646.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome1838418384100%0.099%KX156776.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome1838418384100%0.099%KU926310.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome1838118381100%0.099%KX156774.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome183811838199%0.099%KU497555.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds1837518375100%0.099%KX247632.1Select seq gb|KU820897.2|Zika virus isolate FLR polyprotein gene, complete cds1837518375100%0.099%KU820897.2Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome1837518375100%0.099%KX156775.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome1837518375100%0.099%KX087102.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome1837518375100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome1837518375100%0.099%KU853012.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1837518375100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1837518375100%0.099%KU312312.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome1837218372100%0.099%KU922960.1Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds1836618366100%0.099%KU937936.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome1836618366100%0.099%KU922923.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1836618366100%0.099%KU501215.1Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome1836318363100%0.099%KX087101.2Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome1836318363100%0.099%KU870645.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds1834818348100%0.099%KU820898.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds1834518345100%0.099%KX056898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds1834518345100%0.099%KU955590.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome1833918339100%0.099%KX117076.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds1833918339100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1833918339100%0.099%KU761564.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds1833018330100%0.099%KX185891.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds1833018330100%0.099%KU963796.1Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome1832718327100%0.099%KX253996.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds1832718327100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1832718327100%0.099%KU820899.2Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome183001830099%0.099%KU940224.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds1821818218100%0.099%KU866423.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1818218182100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1809618096100%0.099%KU681081.3Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome1779517795100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177931779399%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds177421774298%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1763417634100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1747917479100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164481644899%0.096%HQ234499.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1329013290100%0.089%KU720415.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds132841328499%0.089%HQ234498.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1327913279100%0.089%KF383115.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1327513275100%0.089%KF268949.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1327213272100%0.089%KF383119.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1326813268100%0.089%LC002520.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1326613266100%0.089%KF268948.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1325913259100%0.089%KF268950.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds1325213252100%0.089%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome1325213252100%0.089%KU955594.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome1325013250100%0.089%KU955595.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1324813248100%0.089%DQ859059.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome1324113241100%0.089%KU955592.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome1322713709100%0.089%KX198134.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome1322313223100%0.089%KU955591.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1320913209100%0.089%AY632535.2Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1320713207100%0.089%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds131911319199%0.088%HQ234501.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1313713137100%0.088%KF383117.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds1312213224100%0.088%KU963574.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131201312099%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1294913017100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128701287097%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108531085397%0.084%KF383120.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome50611446587%0.095%KU940227.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4989498927%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4962496227%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4664466425%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4655465525%0.099%KU646827.1Select seq gb|KX101060.1|Zika virus isolate Bahia02, partial genome42311334175%0.095%KX101060.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3452345218%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3220322017%0.099%KU740199.1Select seq gb|KX101066.1|Zika virus isolate Bahia01, partial genome31311313374%0.099%KX101066.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2704270414%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2051205111%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2021202111%0.099%KU179098.1Select seq gb|KX101061.1|Zika virus isolate Bahia03, partial genome18401392778%0.099%KX101061.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds183818389%0.099%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds183818389%0.099%KX059013.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds174817489%0.099%KM078961.1
  12. LOCUS KX280026 10807 bp RNA linear VRL 31-MAY-2016 DEFINITION Zika virus isolate Paraiba_01, complete genome. ACCESSION KX280026 VERSION KX280026.1 GI:1032590576 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10807) AUTHORS Tsetsarkin,K.A., Kenney,H., Whitehead,S.S. and Pletnev,A.G. TITLE Full-length infectious cDNA clone of Zika virus from 2015 epidemic in Brazil: development and characterization of recombinant viruses in cell lines from human placenta, testis, and brain JOURNAL Unpublished REFERENCE 2 (bases 1 to 10807) AUTHORS Tsetsarkin,K.A., Kenney,H., Whitehead,S.S. and Pletnev,A.G. TITLE Direct Submission JOURNAL Submitted (24-MAY-2016) Neurotropic Flaviviruses Section; Laboratory of Infectious Diseases, National Institute of Allergy and Infectious Diseases, 3 North Dr Rm 3W10A, Bethesda, MD 20892-3203, USA COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10807 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Paraiba_01" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="2015" 5'UTR 1..107 CDS 108..10379 /codon_start=1 /product="polyprotein" /protein_id="ANH10698.1" /db_xref="GI:1032590577" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSVVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" 3'UTR 10380..10807 ORIGIN 1 agttgttgat ctgtgtgaat cagactgcga cagttcgagt ttgaagcgaa agctagcaac 61 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa 121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga 181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca 241 ggatggtctt ggcgattcta gcctttttga gattcacggc aatcaagcca tcactgggtc 301 tcatcaatag atggggttca gtggggaaaa aagaggctat ggaaataata aagaagttca 361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag 421 gcgcagatac tagtgtcgga attgttggcc tcctgctgac cacagctatg gcagcggagg 481 tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct ggggaggcca 541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac 601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag 661 atgacgtcga ttgttggtgc aacacgacgt caacttgggt tgtgtacgga acctgccatc 721 acaaaaaagg tgaagcacgg agatctagaa gagctgtgac gctcccctcc cattccacta 781 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcatttga 841 ttagagtcga aaattggata ttcaggaacc ctggcttcgc gttagcagca gctgccatcg 901 cttggctttt gggaagctca acaagccaaa aagtcatata cttggtcatg atactgctga 961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta 1021 tgtcaggtgg gacttgggtt gatgttgtct tggaacatgg aggttgtgtc accgtaatgg 1081 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg 1141 aggtaagatc ctactgctat gaggcatcaa tatcagacat ggcttcggac agccgctgcc 1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtc tgcaaaagaa 1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga 1321 catgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc 1381 tggagtaccg gataatgctg tcagttcatg gctcccagca cagtgggatg atcgttaatg 1441 acacaggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa 1501 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag 1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggttcaca 1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac 1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg 1741 tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga gctctggagg 1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa 1861 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca 1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga 1981 cagatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact ctgaccccag 2041 ttgggaggtt gataaccgct aaccccgtaa tcactgaaag cactgagaac tctaagatga 2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga 2161 agatcaccca ccactggcac aggagtggca gcaccattgg aaaagcattt gaagccactg 2221 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg 2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat 2341 cattgtttgg aggaatgtcc tggttctcac aaattctcat tggaacgttg ctgatgtggt 2401 tgggtctgaa cacaaagaat ggatctattt cccttatgtg cttggcctta gggggagtgt 2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga 2521 aggagacgag atgcggtaca ggggtgttcg tctataacga cgttgaagcc tggagggaca 2581 ggtacaagta ccatcctgac tccccccgta gattggcagc agcagtcaag caagcctggg 2641 aagatggtat ctgcgggatc tcctctgttt caagaatgga aaacatcatg tggagatcag 2701 tagaagggga gctcaacgca atcctggaag agaatggagt tcaactgacg gtcgttgtgg 2761 gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct gtgaacgagc 2821 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt cagagcagca aagacaaata 2881 acagctttgt cgtggatggt gacacactga aggaatgccc actcaaacat agagcatgga 2941 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg 3001 ttagagaaga ttattcatta gagtgtgatc cagccgttat tggaacagct gttaagggaa 3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga 3121 ggctgaagag ggcccacctg atcgagatga aaacatgtga atggccaaag tcccacacat 3181 tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttta gctgggccac 3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg 3301 aagagcttga aattcggttt gaggaatgcc caggcactaa ggtccacgtg gaggaaacat 3361 gtggaacaag aggaccatct ctgagatcaa ccactgcaag cggaagggtg atcgaggaat 3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttccg ggctaaagat ggctgttggt 3481 atggaatgga gataaggccc aggaaagaac cagaaagcaa cttagtaagg tcagtggtga 3541 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca 3601 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcaatgg 3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa 3721 ttttgatggg tgccaccttc gcggaaatga acactggagg agatgtagct catctggcgc 3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc tttcatcttc agagctaatt 3841 ggacaccccg tgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct 3901 ccgccttgga aggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa 3961 tacgagcgat ggttgttcca cgcactgata acatcacctt ggcaatcctg gctgctctga 4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg 4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca 4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt 4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc 4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg 4321 ccgcggtcgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca 4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc 4441 ggctcgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc 4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag 4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggtg 4621 ctctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt 4681 acagagtaat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag 4741 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag 4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat 4861 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg 4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca 4981 ttggagcggt tgcgctggat tacccagcag gaacttcagg atctccaatc ctagacaagt 5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg agttatgtta 5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga 5161 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga 5221 gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact gtgatcttag 5281 ctccaaccag ggttgtcgct gctgaaatgg aggaagccct tagagggctt ccagtgcgtt 5341 atatgacaac agcagtcaat gtcacccact ctggaacaga aatcgtcgac ttaatgtgcc 5401 atgccacctt cacttcacgt ctactacagc caatcagggt ccccaactat aatctgtata 5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcaa 5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc 5581 gtgacgcatt tccggactcc aactcaccaa ttatggacac cgaagtggaa gtcccagaga 5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg 5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg 5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt 5821 gggactttgt cgtgacaact gacatttcag agatgggcgc caactttaaa gctgaccgtg 5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattctgg 5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga 6001 atcccaacaa acctggagat gagtatctgt atggaggtgg gtgcgcagag actgacgaag 6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc 6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca 6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg 6241 tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga agatggtgct 6301 ttgatggcac gaccaacaat accataatgg aagacagtgt gccggcagag gtgtggacca 6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc 6421 atgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag 6481 tgatggaagc cctgggaaca ctgccaggac acatgacaga gagattccag gaagccattg 6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg 6601 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgc 6661 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg 6721 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg 6781 catgtgtcct cattgttgtg ttcctattgc tggtggtgct catacctgag ccagaaaagc 6841 aaagatctcc ccaggacaac caaatggcaa tcatcatcat ggtagcagta ggtcttctgg 6901 gcttgattac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccacc 6961 taatgggaag gagagaggag ggagcaacca taggattctc aatggacatt gacctgcggc 7021 cagcctcagc ttgggccatc tatgctgcct tgacaacttt cattacccca gccgtccaac 7081 atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg caagctggag 7141 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc 7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc 7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc 7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg 7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca 7441 tagcagtagc cgtctccagc gccatactgt cgcggaccgc ctgggggtgg ggagaggctg 7501 gggccctgat cacagccgca acttccactt tgtgggaagg ctctccgaac aagtactgga 7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt 7621 ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag 7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct 7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca 7801 aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt 7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag 7921 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa 7981 aaggaggccc tggtcatgaa gaacccgtgt tggtgcaaag ctatgggtgg aacatagtcc 8041 gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt 8101 gtgacatagg tgagtcatca tctagtcctg aagtggaaga agcacggacg ctcagagtcc 8161 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt 8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag 8281 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag 8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg 8401 acgggccaag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg 8461 ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga 8521 tccgcagtga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg 8581 cttaccatgg aagctatgag gcccccacac aagggtcagc gtcctctcta ataaacgggg 8641 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga 8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc 8761 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag 8821 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagtttatc aacaaggttc 8881 gtagcaatgc agcattaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg 8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga 9001 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg 9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc 9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag 9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc 9241 gcataccagg aggaaggatg tatgcagatg acactgctgg ctgggacacc cgcatcagca 9301 ggtttgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg cacagggcct 9361 tggcattggc cataatcaag tacacatacc aaaacaaagt ggtaaaggtc cttagaccag 9421 ctgaaaaagg gaaaacagtt atggacatta tttcgagaca agaccaaagg gggagcggac 9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggaata 9541 tggaggctga ggaagttctg gagatgcaag acttgtggct gctgcggagg tcagagaaag 9601 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag 9661 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg 9721 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact 9781 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt 9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag 9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc 9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg 10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat 10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc 10141 acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg ggaaaaaggg 10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca 10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag tacatggact 10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctgga gtgctgtaag 10381 caccaatctt aatgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc 10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg 10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca 10561 cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg 10621 ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt agaggagacc 10681 ccccggaaaa cgcaaaacag catattgacg ctgggaaaga ccagagactc catgagtttc 10741 caccacgctg gccgccaggc acagatcgcc gaatagcggc ggccggtgtg gggaaatcca 10801 tgggtct
  13. NIAID has released a full 2015 Zika sequence from Paraiba, Brazil, Paraiba_01 http://www.ncbi.nlm.nih.gov/nuccore/KX280026.1
  14. Summary As of 1 June 2016, 60 countries and territories report continuing mosquito-borne transmission (Fig. 1) of which:46 countries are experiencing a first outbreak of Zika virus since 2015, with no previous evidence of circulation, and with ongoing transmission by mosquitos (Table 1).14 countries reported evidence of Zika virus transmission between 2007 and 2014, with ongoing transmission.In addition, four countries or territories have reported evidence of Zika virus transmission between 2007 and 2014, without ongoing transmission: Cook Islands, French Polynesia, ISLA DE PASCUA – Chile and YAP (Federated States of Micronesia).Ten countries have reported evidence of person-to-person transmission of Zika virus, probably via a sexual route.In the week to 1 June 2016, no new country reported on mosquito-borne or person-to-person Zika virus transmission.As of 1 June 2016, microcephaly and other central nervous system (CNS) malformations potentially associated with Zika virus infection or suggestive of congenital infection have been reported by eleven countries or territories. Three of those reported microcephaly borne from mothers with a recent travel history to Brazil (Slovenia, United States of America) and Colombia (Spain), for one additional case the precise country of travel in Latin America is not determined.Two cases of microcephaly and other neurological abnormalities are currently under verification in the Bolivarian Republic of Venezuela and Costa Rica.In the context of Zika virus circulation, 13 countries and territories worldwide have reported an increased incidence of Guillain-Barré syndrome (GBS) and/or laboratory confirmation of a Zika virus infection among GBS cases.Zika infection was diagnosed in a patient with a severe neurological condition (myelitis) in Guadeloupe.Sequencing of the virus that causes the Zika outbreak in Cabo Verde showed that the virus is of the Asian lineage and the same as the one that circulates in Brazil. The precise implication of this finding is yet to be determined.Based on research to date, there is scientific consensus that Zika virus is a cause of microcephaly and GBS.The global Strategic Response Framework launched by the World Health Organization (WHO) in February 2016 encompasses surveillance, response activities and research. An interim report2 has been published on some of the key activities being undertaken jointly by WHO and international, regional and national partners in response to this public health emergency. A revised strategy for the period July 2016 to December 2017 is currently being developed with partners and will be published in mid-June.WHO has developed new advice and information on diverse topics in the context of Zika virus. WHO’s latest information materials, news and resources to support corporate and programmatic risk communication, and community engagement are available online. Download the image pdf, 3.49Mb
  15. Zika situation report http://www.who.int/emergencies/zika-virus/situation-report/2-june-2016/en/ 2 June 2016 Zika virus, Microcephaly and Guillain-Barré syndromeRead the full situation report
  16. Zika Virus – June 2, 2016. Texas has had 40 confirmed cases of Zika virus disease. Of those, 39 were in travelers who were infected abroad and diagnosed after they returned home; one of those travelers was a pregnant woman. One case involved a Dallas County resident who had sexual contact with someone who acquired the Zika infection while traveling abroad. Case counts by county: Bexar – 6 Collin – 1 Dallas – 6 Denton – 2 Fort Bend – 2 Grayson – 1Harris – 13 Tarrant – 4 Travis – 2 Val Verde – 1 Williamson – 1 Wise – 1
  17. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  18. Second Confirmed Case of Travel Acquired Zika Virus InfectionJune 1, 2016 - Zoonotic Diseases - InformationThe New Mexico Department of Health announced today a second travel-related case of Zika in the state in a 40-year-old Bernalillo County woman. The woman acquired the virus while traveling to the Caribbean. “As long as the outbreak continues in Central and South America and the Caribbean, we expect to see more travel-related Zika virus infections in our state," said Department of Health Secretary Designate Lynn Gallagher. “We continue to work closely with the CDC as the number of travel-related Zika cases are rising in the United States.” The CDC has issued travel warnings for anyone headed to specific countries where there is active mosquito-borne transmission of Zika virus. The latest list of affected countries can be found at the Zika Virus Travel Information page. Most people infected with Zika virus won’t even know they have the disease because they won’t have symptoms; however, in infected pregnant women the virus has been linked to birth defects including microcephaly and other poor birth outcomes. Zika virus can be passed from a pregnant woman to her fetus during pregnancy or at delivery. While the virus is mainly transmitted by mosquitos, it can also be transmitted through semen. CDC recommends pregnant women avoid travel to an area with Zika and that men traveling to areas where virus is actively transmitted by mosquitoes to either abstain from having sex with a pregnant partner, or properly use a condom for the duration of the pregnancy. To avoid Zika and other viruses like West Nile Virus, which are spread by mosquitos, take the following steps: Wear long-sleeved shirts and long pants.Stay in places with air conditioning or that use window and door screens to keep mosquitoes outside.Sleep under a mosquito bed net if you are overseas or outside and are not able to protect yourself from mosquito bites.Use Environmental Protection Agency (EPA)-registered insect repellents. When used as directed, EPA registered insect repellents are proven safe and effective, even for children and pregnant or breast-feeding women.Always follow the product label instructionsReapply insect repellent as directedDo not spray repellent on the skin under clothingIf you are also using sunscreen, apply sunscreen before applying insect repellentIf you have a baby or child:Do not use insect repellent on babies younger than 2 months of age (follow label instructions)Dress your child in clothing that covers arms and orCover crib, stroller, and baby carrier with mosquito netting.Do not apply insect repellent onto a child’s hands, eyes, mouth, or cut or irritated skin.Adults: Spray insect repellent onto your hands and then apply to a child’s face.Treat clothing and gear with perethrin or purchase permethrin-treated items.Treated clothing remains protective after multiple washings. See product information to learn how long the protection will last.If treating items yourself, follow the product instructions carefully.Do NOT use permethrin products directly on skin. They are intended to treat clothing.The CDC reports that as of May 25, 2016, there have been 591 cases of Zika virus infection reported in the United States, all travel-related, with an additional 939 in US territories. For more information, please visit the Get Educated About Zika Virus and Zika Virus Information for Pregnant Women pages. Media ContactWe would be happy to provide additional information about this press release. Simply contact Kenny Vigil at 505-827-2619 (Office) or 505-470-2290 (Mobile) with your questions.
  19. The New Mexico Department of Health announced today a second travel-related case of Zika in the state in a 40-year-old Bernalillo County woman. The woman acquired the virus while traveling to the Caribbean. https://nmhealth.org/news/information/2016/6/?view=425
  20. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  21. As of May 24, 2016, 20 persons infected Zika virus have been reported in Quebec. These people have all acquired their infection during a stay in a country where a transmission Zika mosquito is known. http://www.sante.gouv.qc.ca/chroniques/virus-zika/
  22. As of May 24, 2016, 20 persons infected Zika virus have been reported in Quebec. These people have all acquired their infection during a stay in a country where a transmission Zika mosquito is known.
  23. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  24. Laboratory-confirmed travel-related cases of Zika virus in Ontario^ as of May 31, 2016Number of laboratory-confirmed*casesCountries of Travel§65*Aruba, Barbados, Brazil, Columbia, Costa Rica, Dominican Republic, El Salvador, Guatemala, Guyana, Haiti, Honduras, Jamaica, Martinique, French West Indies, Mexico, Nicaragua, Panama, South Caribbean, Venezuela*Note: One of the 65 laboratory-confirmed cases of Zika virus in Ontario is non-travel related. http://health.gov.on.ca/en/public/publications/disease/zika.aspx
×
×
  • Create New...