Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. Map update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
  2. Four Zika virus cases reported in Bay AreaBy Tracy Seipel, [email protected]: 03/03/2016 07:44:32 PM PST | UPDATED: ABOUT 3 HOURS AGO Several more Bay Area cases of the Zika virus were either reported or confirmed Thursday, one day after Napa County public health officials confirmed a pregnant woman who had traveled to Central America had contracted the virus. The San Francisco Department of Public Health said Thursday that a San Francisco resident last month had tested positive for the Zika virus. Department spokeswoman Rachael Kagan said the state's public health department confirmed the case with the San Francisco's public health officials on Feb. 4. Kagan said the person is fully recovered and doing well. In Contra Costa County, public health department spokeswoman Victoria Balladares said two confirmed cases have been recorded -- one last Thursday and one in early February. Both women said all of the individuals with Zika had returned from traveling to a country where the Zika virus is present. But they said their health departments had not released the information before now because there was no risk of transmission to the local community. "The mosquitoes that carry the Zika virus are not present in Contra Costa County," Balladares said. The Alameda County Public Health Department website confirmed that an Alameda County resident, who had been traveling in a Zika affected country, had tested positive for the virus last month. But they have ruled that to be a 2015 case. San Mateo and Santa Clara County public health officials said there are no confirmed Zika cases. No information was available about Marin, Sonoma or Solano counties. The state's first confirmed Zika case was reported in Yolo County last month. The mosquito-borne virus has been linked to a rare birth defect that results in an abnormally small head. The U.S. Centers for Disease Control and Prevention said Brazil has reported that an increased number of people infected with the virus also have Guillain-Barré syndrome, an immune system disorder. State public health officials have confirmed six cases in the state, and update those numbers each Friday. Zika virus is primarily transmitted to people by Aedes aegypti and Aedes albopictus mosquitoes, the same mosquitoes that can transmit dengue and chikungunya viruses. These mosquitoes -- which are not native to California -- have been identified in 12 California counties, including San Mateo and Alameda counties, although there are no known cases where the mosquitoes were carrying the Zika virus in this state. The six confirmed cases of Zika virus in California were acquired in other countries. Contact Tracy Seipel at 408-920-5343. Follow her at Twitter.com/taseipel. http://www.mercurynews.com/health/ci_29593082/four-zika-virus-cases-reported-bay-area
  3. In Contra Costa County, public health department spokeswoman Victoria Balladares said two confirmed cases have been recorded -- one last Thursday and one in early February. Both women said all of the individuals with Zika had returned from traveling to a country where the Zika virus is present. http://www.mercurynews.com/health/ci_29593082/four-zika-virus-cases-reported-bay-area
  4. Map update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
  5. The Hawaii State Department of Health has confirmed the first imported case of Zika in Hawaiithis year. The individual had a history of travel in the Pacific and has since recovered and is nolonger infectious. The case was confirmed this week by the department’s State LaboratoriesDivision. http://health.hawaii.gov/news/files/2013/05/16-012-Statement-on-Zika-Virus.pdf
  6. Updated March 2, 2016As of 2/5/2016, many countries and territories in Latin America, the Caribbean, Oceania/Pacific Islands and Cape Verde in Africa have reported active Zika virus transmission. See http://www.cdc.gov/zika/geo/index.html for updated countries and http://wwwnc.cdc.gov/travel/notices/ for travel notices In California, six travel-associated Zika cases were reported between 2013 and 2015. On 2/9/16, ACPHD confirmed an Alameda County resident has preliminarily tested positive for the Zika virus. The person was infected with Zika virus while traveling in a Zika-affected country. Updated case counts will be available weekly on Fridays. For statewide case counts, see the CDPH Zika Website: https://www.cdph.ca.gov/HealthInfo/discond/Pages/Zika.aspx.Alameda County Public Health Department has issued a Public Health Zika Health Advisory Update for health care providers on 2/11/16 with updated guidance for exposures, clinical symptoms, and testing via public health laboratories. For additional details, and to see the full Advisory click on the following link: http://www.acphd.org/health-alerts.aspx
  7. Alameda County Zika Tally Page http://www.acphd.org/zika.aspx
  8. Sequence map updated https://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en
  9. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU844090.1|Zika virus isolate Moscow-2016 polyprotein gene, partial cds508508100%3e-140100%KU844090.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds508508100%3e-140100%KU729218.1Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds508508100%3e-140100%KU761564.1Select seq gb|KU740184.1|Zika virus isolate GD01 polyprotein gene, complete cds508508100%3e-140100%KU740184.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome508508100%3e-140100%KU527068.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds508508100%3e-140100%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome508508100%3e-140100%KU509998.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds508508100%3e-140100%KU365778.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds508508100%3e-140100%KU312315.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds508508100%3e-140100%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds508508100%3e-140100%KU312313.1Select seq gb|KM212966.1|Zika virus isolate NC13(FP)-26112013-22072 glycoprotein gene, partial cds508508100%3e-140100%KM212966.1Select seq gb|KJ579441.1|Zika virus isolate PF13-CP221013c polyprotein gene, partial cds508508100%3e-140100%KJ579441.1Select seq dbj|AB908162.1|Zika virus gene for polyprotein, partial cds, strain: ZIKV Hu/Tahiti/01u/2014NIID508508100%3e-140100%AB908162.1Select seq gb|KU820899.1|Zika virus isolate ZJ03 polyprotein gene, complete cds502502100%1e-13899%KU820899.1Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds502502100%1e-13899%KU820897.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome502502100%1e-13899%KU744693.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome502502100%1e-13899%KU497555.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome502502100%1e-13899%KU707826.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds502502100%1e-13899%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds502502100%1e-13899%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome502502100%1e-13899%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds502502100%1e-13899%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds502502100%1e-13899%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds502502100%1e-13899%KU365777.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds502502100%1e-13899%KU312312.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome502502100%1e-13899%KU321639.1Select seq gb|KM212965.1|Zika virus isolate NC13(FP)-20112013-22015 glycoprotein gene, partial cds502502100%1e-13899%KM212965.1Select seq gb|KM212964.1|Zika virus isolate NC14-17042014-4554 glycoprotein gene, partial cds502502100%1e-13899%KM212964.1Select seq gb|KM212963.1|Zika virus isolate NC14-23012014-250 glycoprotein gene, partial cds502502100%1e-13899%KM212963.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds502502100%1e-13899%KJ776791.1Select seq gb|KJ680134.1|Zika virus strain PF13-091213-121 polyprotein gene, partial cds502502100%1e-13899%KJ680134.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome499499100%2e-13799%KU681081.3Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds499499100%2e-13799%JN860885.1Select seq gb|KU729217.1|Zika virus isolate BeH823339 polyprotein gene, complete cds493493100%7e-13699%KU729217.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds49149199%2e-13599%KF993678.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome484484100%4e-13398%KU681082.3Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds48448495%4e-133100%KU646828.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds484484100%4e-13398%EU545988.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds480480100%4e-13298%KU686218.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds47947995%2e-13199%KU646827.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds47947995%2e-13199%KJ634273.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds439439100%1e-11995%HQ234499.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds417417100%4e-11393%KF268949.1Select seq gb|KT381874.1|Zika virus strain Zika1697_BR-RJ/2015 envelope protein gene, partial cds41641684%2e-11299%KT381874.1
  10. LOCUS KU844090 281 bp RNA linear VRL 01-MAR-2016 DEFINITION Zika virus isolate Moscow-2016 polyprotein gene, partial cds. ACCESSION KU844090 VERSION KU844090.1 GI:1002167045 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 281) AUTHORS Popova,A.Y., Maksyutov,R.A., Bodnev,S.A., Tregubchak,T.V., Pyankov,O.V., Demina,Y.V., Agafonov,A.P. and Miheev,V.N. TITLE Zika virus in a human, Russia, 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 281) AUTHORS Popova,A.Y., Maksyutov,R.A., Bodnev,S.A., Tregubchak,T.V., Pyankov,O.V., Demina,Y.V., Agafonov,A.P. and Miheev,V.N. TITLE Direct Submission JOURNAL Submitted (29-FEB-2016) Laboratory of Diagnosis and Repository of Variola Virus DNA, State Research Center of Virology and Biotechnology 'Vector', Koltsovo, Novosibirsk Region 630559, Russia COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..281 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Moscow-2016" /host="Homo sapiens" /db_xref="taxon:64320" /country="Russia" /collection_date="Feb-2016" CDS <1..>281 /codon_start=2 /product="polyprotein" /protein_id="AMM76159.1" /db_xref="GI:1002167046" /translation="PAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPT VDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQ" ORIGIN 1 cccggcatac agcatcaggt gcataggagt cagcaatagg gactttgtgg aaggtatgtc 61 aggtgggact tgggttgatg ttgtcttgga acatggaggt tgtgtcaccg taatggcaca 121 ggacaaaccg actgtcgaca tagagctggt tacaacaaca gtcagcaaca tggcggaggt 181 aagatcctac tgctatgagg catcaatatc agacatggct tcggacagcc gctgcccaac 241 acaaggtgaa gcctaccttg acaagcaatc agacactcaa t
  11. State Research Center of Virology and Biotechnology 'Vector' has released a partial February 2016 Zika sequence, Moscow-2016, from a Moscow traveler infected in the Dominican Republic.http://www.ncbi.nlm.nih.gov/nuccore/KU844090.1
  12. LOCUS KU844090 281 bp RNA linear VRL 01-MAR-2016 DEFINITION Zika virus isolate Moscow-2016 polyprotein gene, partial cds. ACCESSION KU844090 VERSION KU844090.1 GI:1002167045 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 281) AUTHORS Popova,A.Y., Maksyutov,R.A., Bodnev,S.A., Tregubchak,T.V., Pyankov,O.V., Demina,Y.V., Agafonov,A.P. and Miheev,V.N. TITLE Zika virus in a human, Russia, 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 281) AUTHORS Popova,A.Y., Maksyutov,R.A., Bodnev,S.A., Tregubchak,T.V., Pyankov,O.V., Demina,Y.V., Agafonov,A.P. and Miheev,V.N. TITLE Direct Submission JOURNAL Submitted (29-FEB-2016) Laboratory of Diagnosis and Repository of Variola Virus DNA, State Research Center of Virology and Biotechnology 'Vector', Koltsovo, Novosibirsk Region 630559, Russia COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..281 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Moscow-2016" /host="Homo sapiens" /db_xref="taxon:64320" /country="Russia" /collection_date="Feb-2016"
  13. County Number of Cases (all travel related) Alachua 1 Brevard 1 Broward 6 Hillsborough 3 Lee 3 Miami-Dade 22 Orange 3 Osceola 1 Santa Rosa 1 Seminole 1 St. Johns 1 Cases involving pregnant women* 4 Total 47 *Counties of pregnant women will not be shared. https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
  14. Bexar Co 3 Dallas Co 4 Fort Bend Co 1 Harris Co 10 Tarrant Co 1 Travis Co 2 Total 21 https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
  15. Map update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
  16. Age RangeGenderTravel MonthCountry of TravelStatus30-39M1/2016VenezuelaRecovered http://www.hcphes.org/publications/hcphes_responds/2016__zika_virus/
  17. niman replied to niman's topic in Texas
    *Please note, these are the most current number of confirmed cases. This list is updated every Thursday by 2pm CST. Age RangeGenderTravel MonthCountry of TravelStatus30-39M1/2016VenezuelaRecovered40-49F11/2015El SalvadorRecovered20-29M11/2015El SalvadorRecovered40-49F11/2015El SalvadorRecovered< 10M12/2015El SalvadorRecoveredNumber of pregnancy related cases: 0
  18. CDC Doctor Says There’s No Question Zika Is Linked to Microcephaly Written byKALEIGH ROGERSSTAFF WRITER 3 March 2016 // 06:40 PM CET As Zika continues to spread rapidly across Latin America, a US Centers for Disease Control doctor says there “isn’t any question” the virus is linked to microcephaly, a condition where a baby is born with an abnormally small head. “The link between the Zika virus and microcephaly is extremely strong,” said Dr. Lyle Petersen, the director of the division of vector-borne diseases at the CDC, during a press conference Wednesday. “There are numerous lines of evidence now that link Zika with microcephaly, so I don’t think there’s any question about that any longer.” That link is strong enough that Canada recently joined the list of countries urging women to delay pregnancy (in this case, only if they have travelled to a Zika-infected country). Meanwhile, Google has pledged $1 million towards Zika research, and has also updated search engine results to prioritize updated information about the virus in affected areas. The stronger language being used by experts to describe the relationship between Zika and microcephaly is a significant shift. Officials are always cautious when early reports of a potential link between two events emerge, because until we compile more evidence, it’s not always clear whether the two are actually related or just a coincidence. Gradually, evidence has been accumulating, making researchers more confident in their claims about the link between Zika and microcephaly. It’s still not known exactly what the risk is, but the evidence is convincing many doctors and scientists that the two are directly connected. What’s not as clear is the link between the virus and growing reports of Guillain-Barré syndrome: a disorder which can cause temporary, months-long paralysis and weaken muscles. An increase in cases have been reported in six countries where Zika is also present, and a a Lancet study study published this week showed there was also an increase in Guillain-Barré during a Zika outbreak in French Polynesia back in 2014. But Petersen said the evidence of a link isn’t as strong as with microcephaly. “It’s just because we don’t have the pathological evidence [that we do with microcephaly],” Petersen explained. “But there’s growing accumulation [of evidence] every day that that’s the case.” Still, the evidence of a link between Zika and Guillain-Barré is growing, in much the same pattern as microcephaly, and following a similar path from “this is a notable correlation” to “there is a definite link here.” In light of this, the Pan American Health Organization hosted more than 70 scientists this week for a summit in Washington, DC, to talk about what needs to be done as we learn more about the risks associated with this previously overlooked virus. There are multiple projects currently underway to fight the spread of the Zika: developing a more efficient test for the virus, creating a vaccine, determining the exact risk of microcephaly and Guillain-Barré, and improving vector control: avoiding and killing off the mosquitoes that spread the virus. These are all necessary actions but, with the exception of vector control, they’re actions that are going to take time. Early trials for a vaccine are still months, if not years, away. Newer, quicker tests for the virus have been developed, but distributing these tests across affected countries, particularly countries with underfunded healthcare systems, is no easy task. And even though control studies on both microcephaly and Guillain-Barré have begun, results won’t be available for months. In the meantime, public health agencies, governments, and NGOs need to also focus on getting information out so people can avoid getting infected, particularly pregnant women, Petersen said. Brazil has even enlisted its army to disseminate information and destroy mosquito breeding grounds. Petersen said there are several ways to prevent the spread, from bednets, to insecticides, window and door screens, bug repellant, and even condoms—because Zika has been shown to be sexually transmitted, as well. “All of these methods can be employed right now. We have products available that can be used,” Petersen said. “We just need to figure out whether these are acceptable methods that women will actually use in their own countries.” http://motherboard.vice.com/en_uk/read/cdc-doctor-says-theres-no-question-zika-is-linked-to-microcephaly-virus-brazil-guillain-barre
  19. Map update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
  20. Totals from Dept of Health (total corrected to 34 from 29 and back to 29)
  21. Map update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
  22. Mar. 3, 2016 Surgeon General Dr. John Armstrong’s Daily Zika Update - Three New Cases Today in Miami-Dade CountyContact:Communications [email protected](850) 245-4111 Tallahassee, Fla. - In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, State Surgeon General and Secretary of Health Dr. John Armstrong will issue a Zika virus update each week day at 2 p.m. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. There are three new cases today in Miami-Dade County. Of the travel-related cases confirmed in Florida, only four cases are still exhibiting symptoms. According to the CDC, symptoms associated with the Zika virus last between seven to 10 days. Based on CDC guidance, several pregnant women who have traveled to countries with local-transmission of Zika have received antibody testing, and of those, four have tested positive for the Zika virus. The CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. It is recommended that women who are pregnant or thinking of becoming pregnant postpone travel to Zika affected areas. County Number of Cases (all travel related) Alachua 1 Brevard 1 Broward 6 Hillsborough 3 Lee 3 Miami-Dade 22 Orange 3 Osceola 1 Santa Rosa 1 Seminole 1 St. Johns 1 Cases involving pregnant women* 4 Total 47 *Counties of pregnant women will not be shared. Yesterday, Governor Rick Scott announced that the Centers for Disease Control fulfilled the request he made last week for more antibody tests for the Zika virus and provided an additional 500 tests. On Feb. 12, Governor Scott directed State Surgeon General Dr. John Armstrong to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 886 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. All cases are travel-associated. There have been no locally-acquired cases of Zika in Florida. For more information on the Zika virus, click here. State Surgeon General and Secretary of Health Dr. John Armstrong urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. More Information on DOH action on Zika: On Feb. 3, Governor Scott directed State Surgeon General and Secretary of Health Dr. John Armstrong to issue a Declaration of Public Health Emergency for the counties of residents with travel-associated cases of Zika.The Declaration currently includes the 11 effected counties – Alachua, Brevard, Broward, Hillsborough, Lee, Miami-Dade, Orange, Osceola, Santa Rosa, Seminole and St. Johns – and will be updated as needed. DOH encourages Florida residents and visitors to protect themselves from all mosquito-borne illnesses by draining standing water; covering their skin with repellent and clothing; and covering windows with screens.DOH has a robust mosquito-borne illness surveillance system and is working with the CDC, the Florida Department of Agriculture and Consumer Services and local county mosquito control boards to ensure that the proper precautions are being taken to protect Florida residents and visitors.Florida currently has the capacity to test 4,592 people for active Zika virus and 1,527 for Zika antibodies.Federal Guidance on Zika: According to the CDC, Zika illness is generally mild with a rash, fever and joint pain. CDC researchers are examining a possible link between the virus and harm to unborn babies exposed during pregnancy.The FDA released guidance regarding donor screening, deferral and product management to reduce the risk of transfusion-transmission of Zika virus. Additional information is available on the FDA website here.For more information on Zika virus, click here. About the Florida Department of Health The department works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health please visit www.FloridaHealth.gov. http://www.floridahealth.gov/newsroom/2016/03/030316-zika-update.html
  23. County Number of Cases (all travel related) Alachua 1 Brevard 1 Broward 6 Hillsborough 3 Lee 3 Miami-Dade 22 Orange 3 Osceola 1 Santa Rosa 1 Seminole 1 St. Johns 1 Cases involving pregnant women* 4 Total 47
  24. Research indicates other mosquitoes may be able to carry ZikaResearch by scientists in Brazil indicates that a mosquito more common than the one primarily known to transmit Zika infections may possibly be able to carry the virus, a development that could further complicate efforts to limit its spread.Posted 04 Mar 2016 02:30PHOTOSAedes aegypti mosquitoes are seen inside Oxitec laboratory in Campinas, Brazil, February 2, 2016. Picture taken February 2, 2016. REUTERS/Paulo WhitakerENLARGECAPTION 2 Email More A A RIO DE JANEIRO: Research by scientists in Brazil indicates that a mosquito more common than the one primarily known to transmit Zika infections may possibly be able to carry the virus, a development that could further complicate efforts to limit its spread. The mosquito species Aedes aegypti has been identified as the primary transmitter of Zika infections, which have been linked to thousands of birth defects as the virus spreads rapidly in Brazil and other countries in Latin America and the Caribbean. But the scientists in Brazil announced on Wednesday that they were able to infect another species, Culex quinquefasciatus, with the virus in a laboratory, raising concerns that Zika could be carried by a species more prevalent than Aedes aegypti. They said much more research is needed to learn whether the Culex mosquitoes can transmit Zika infections. In Brazil, Culex quinquefasciatus is 20 times more common than Aedes aegypti, the researchers said. The research, conducted by scientists at the government-funded Oswaldo Cruz Foundation in the northeastern city of Recife, is part of an ongoing trial in which researchers injected 200 of the Culex quinquefasciatus mosquitoes with rabbit blood infected by Zika. The virus, they said, circulated through the mosquitoes' bodies and into their salivary glands, meaning they might be able to transmit a Zika infection by biting a person. "We saw an ease of infection and an ease of dissemination of the virus to the salivary glands," Constancia Ayres, the lead scientist in the study, told Globo, Brazil's leading television network. The research has yet to be published in a scientific journal or reviewed by scientific peers elsewhere. The foundation said more work was needed to determine whether Culex mosquitoes in the wild already are carrying the virus as well as whether they can transmit Zika infections. Foundation spokeswoman Fabiola Tavares on Thursday said the researchers, who will begin capturing Culex mosquitoes in areas near Recife where the virus is known to be circulating, will now proceed toward answering those questions. The additional research could take up to eight months, Tavares added. If a mosquito besides Aedes aegypti were found to transmit Zika infections, it could make it more difficult to contain the current Zika outbreak that the World Health Organization last month declared a global public health emergency. Much remains unknown about Zika, including whether the virus actually causes microcephaly in babies, a condition defined by unusually small heads that can result in developmental problems. Brazil said it has confirmed more than 640 cases of microcephaly, and considers most of them to be related to Zika infections in the mothers. Brazil is investigating more than 4,200 additional suspected cases of microcephaly. Traces of Zika virus have been found in the bodily fluids and tissue of mothers and babies affected by microcephaly. Culex quinquefasciatus also exists in more temperate climes, such as the southern United States, where it is known to carry the West Nile virus, and can survive winters. Unlike Aedes aegypti, Culex quinquefasciatus could keep a virus in circulation during cold months. Though the Culex mosquitoes prefer to feed on the blood of birds, they also commonly bite humans, especially in rural areas. That means that targeted pesticide use and other mosquito control efforts for that species, which rests in trees and other high areas, would need to be different from those for Aedes aegypti, which rests in low spots, often indoors. "You can't spray up high the way you can around buildings," said Grayson Brown, director of the University of Kentucky's public health entomology laboratory who was not involved in the Oswaldo Cruz Foundation research. If Culex mosquitoes were indeed proven to transmit Zika, Brown said, "it would really complicate the public health issue." (Reporting by Paulo Prada; Editing by Will Dunham) - Reuters http://www.channelnewsasia.com/news/health/research-indicates-other/2571240.html

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.