-
Posts
74,774 -
Joined
-
Last visited
-
Days Won
31
Content Type
Profiles
Forums
Articles
Events
Blogs
Everything posted by niman
-
The above sequence is for the Zhejiang case that returned from Fiji/Samoa (not Suriname).
-
Sequence map updated https://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en
-
Zika sequence map updated https://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en
-
Zika sequence map updated https://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en
-
INFECTIOUS DISEASE 03.02.20160 COMMENTSZika Outbreak Needs Intensive, Rapid ResearchInternational meeting outlines strategy for studySAVESAVED by Michael Smith North American Correspondent, MedPage Today The Zika virus outbreak -- with its possible link to neurological complications both in unborn children and adults -- is a "unique situation" that calls for rapid and intensive research into ways of bringing it under control, a U.S. scientist said. "We must move extremely quickly" to understand the virus, the consequences of infection, and methods of slowing or stopping transmission, according to Lyle Petersen, MD, of the CDC's division of vector borne-diseases in Fort Collins, Colo. Currently, "there are literally thousands of infections occurring every single day in the Americas," Petersen told reporters at the end of a two-day scientific meeting called by the Pan-American Health Organization (PAHO) to set a research agenda for the Zika epidemic. Petersen said in 20 years of studying vector-borne diseases, he has never seen one that appears to be able to infect fetuses and cause congenital malformations in the brain as well as causing neurological complications in adults. It's also the first, he said, that is "readily spread" by sexual means. "Because this is a unique situation it requires a unique response and this response has to be guided by research," he said. The meeting, including some 70 scientists from around the world, was intended to set research priorities to deal with the outbreak, according to Marcos Espinal, MD, of the PAHO's communicable diseases and health analysis department. Among the topics that need urgent attention, he said, are: Learning the absolute risk that a pregnant woman, infected with Zika, will see an adverse outcome for the babyFinding ways to detect the virus in the bloodUnderstanding the virus itself, as well as the consequences of infectionDeveloping new ways of controlling the main vector, the mosquito Aedes aegypti The World Health Organizationdeclared aninternational public health emergencyover the possible link between the expanding Zika outbreak in the Americas and reported spikes in cases of congenital brain malformations and Guillain-Barre syndrome in the region. Espinal told reporters that Zika has been associated with congenital brain malformations (which have been lumped together as microcephaly, although others have been reported) in Brazil and in French Polynesia, while increased rates of Guillain-Barré syndrome have been reported in both those regions as well as Suriname, Venezuela, Colombia, and El Salvador. So far, he said, 31 countries in the Americas are reporting Zika epidemics, with more than 135,000 cases reported and 3,000-odd confirmed in the lab. But that number underestimates the extent of the issue, he said, because in 80% of infections there are no signs or symptoms. Because it is usually mild or asymptomatic, Zika has been a "pretty obscure virus," Petersen noted, with only a handful of research papers since it was first discovered in the middle of the last century. It's not clear why the virus is now being associated with more serious outcomes, he said. But the outbreak illustrates the effect of neglecting public health measures and the need to be prepared, he said. In recent years, he said, responses to vector-borne disease -- such as mosquito control programs -- have been allowed to "deteriorate." But "new things happen and unexpected things happen and we have to be prepared," Petersen said. He added the evidence is becoming "extremely strong" for a link between Zika and neurological complications in newborns. For that reason, he said, there should also be research on ways to protect pregnant women, including such things as bednets to prevent mosquito bites, insect repellents, indoor mosquito spraying, and condoms to prevent sexual transmission. Such products are available, he said. "We just need to figure out is these are acceptable methods that women will actually use in their own countries and whether they actually work," Petersen said. http://www.medpagetoday.com/InfectiousDisease/GeneralInfectiousDisease/56515
-
Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1839018390100%0.099%KJ776791.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1834518345100%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1832118321100%0.099%KU321639.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1831218312100%0.099%KU729218.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1831218312100%0.099%KU707826.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1831218312100%0.099%KU365779.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1830018300100%0.099%KU501217.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1830018300100%0.099%KU365780.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1829418294100%0.099%KU647676.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1829418294100%0.099%KU501216.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1829418294100%0.099%KU365777.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome182871828799%0.099%KU497555.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1828518285100%0.099%KU527068.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1828218282100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1828218282100%0.099%KU312312.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1827318273100%0.099%KU501215.1Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1825418254100%0.099%KU761564.1Select seq gb|KU740184.1|Zika virus isolate GD01 polyprotein gene, complete cds1824518245100%0.099%KU740184.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1810518105100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1805118051100%0.099%KU681081.3Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177531775399%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds176881768898%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1760717607100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1744317443100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164331643399%0.095%HQ234499.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1327713277100%0.089%KU720415.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds132721327299%0.089%HQ234498.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1327013270100%0.089%KF383115.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1326613266100%0.089%KF268949.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1326613266100%0.089%DQ859059.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1325913259100%0.089%KF383119.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1325413254100%0.089%LC002520.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1324813248100%0.089%KF268948.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1324113241100%0.089%KF268950.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132141321499%0.089%HQ234501.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1321213212100%0.089%KF383116.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1319613196100%0.089%AY632535.2Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1314213142100%0.088%KF383117.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131201312099%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1294213010100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128551285597%0.089%KF383121.1Select seq gb|KU729217.1|Zika virus isolate BeH823339 polyprotein gene, complete cds119261692792%0.099%KU729217.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108681086897%0.084%KF383120.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4962496227%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4935493527%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4637463725%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4628462825%0.099%KU646827.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3431343118%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3202320217%0.099%KU740199.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds2856419795%0.071%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2695269514%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2042204211%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2008200811%0.099%KU179098.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds173717379%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds173617369%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds173417349%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds173017309%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds173017309%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds173017309%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds172817289%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds158815888%0.099%KJ873160.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds140614067%0.099%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds137013707%0.098%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds133313337%0.097%KM851038.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds132413247%0.099%KU556802.1Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds1283128310%0.088%AF013415.1Select seq gb|KT200609.1|Zika virus isolate BR/949/15 NS5 gene, partial cds123612366%0.099%KT200609.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds121612166%0.099%KU232300.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds120712076%0.099%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds120512056%0.099%KU232297.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds119811986%0.099%KU232294.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds119511956%0.099%KU232292.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds119111916%0.099%KU232298.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds118911896%0.099%KU232293.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds118711876%0.099%KU232296.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds118411846%0.099%KU232295.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds117311736%0.099%KU232288.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds116911696%0.099%KU232289.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds116611666%0.099%KU232299.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds116211626%0.099%KU232291.1Select seq gb|KU758878.1|Zika virus polyprotein gene, partial cds113011306%0.098%KU758878.
-
LOCUS KU820899 10272 bp RNA linear VRL 29-FEB-2016 DEFINITION Zika virus isolate ZJ03 polyprotein gene, complete cds. ACCESSION KU820899 VERSION KU820899.1 GI:1001904509 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10272) AUTHORS Zhang,Y., Sun,Y., Pan,J., Mao,H., Yan,H., Lou,X., Chen,Z. and Xia,S. TITLE Direct Submission JOURNAL Submitted (27-FEB-2016) Department of Microbiology, Zhejiang Provincial Center for Disease Control and Prevention, 3399 Binsheng Road, Hangzhou, Zhejiang 310051, P. R. China COMMENT ##Assembly-Data-START## Assembly Method :: Geneious v. 8.1.7 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10272 /organism="Zika virus" /mol_type="genomic RNA" /isolate="ZJ03" /host="Homo sapiens" /db_xref="taxon:64320" /country="China" /collection_date="17-Feb-2016" CDS 1..10272 /codon_start=1 /product="polyprotein" /protein_id="AMM39806.1" /db_xref="GI:1001904510" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTNVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGARRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFQAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPMLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRSMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVRPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 atgaaaaacc caaaaaagaa atccggagga ttccggattg tcaatatgct aaaacgcgga 61 gtagcccgtg tgagcccctt tgggggcttg aagaggctgc cagccggact tctgctgggt 121 catgggccca tcaggatggt cttggcgatt ctagccttct tgagattcac ggcaatcaag 181 ccatcactgg gtctcatcaa tagatggggt tcagtgggga aaaaagaggc tatggaaata 241 ataaagaagt tcaagaaaga tctggctgcc atgctgagaa taatcaatgc taggaaggag 301 aagaagagac gaggcgcaga tactaatgtc ggaattgttg gcctcctgct gaccacagct 361 atggcagcgg aggtcactag acgtgggagt gcatactata tgtacttgga cagaaacgat 421 gctggggagg ccatatcttt tccaaccaca ttggggatga ataagtgtta tatacagatc 481 atggatcttg gacacatgtg tgatgccacc atgagctatg aatgccctat gctggatgag 541 ggggtggaac cagatgacgt cgattgttgg tgcaacacga cgtcaacttg ggttgtgtac 601 ggaacctgcc atcacaaaaa aggtgaagca cggagatcta gaagagctgt gacgctcccc 661 tcccattcca ctaggaagct gcaaacgcgg tcgcaaactt ggttggaatc aagagaatac 721 acaaagcact tgattagagt cgaaaattgg atattcagga accctggctt cgcgttagca 781 gcagctgcca tcgcttggct tttgggaagc tcaacgagcc aaaaagtcat atacttggtc 841 atgatactgc tgattgcccc ggcatacagc atcaggtgca taggagtcag caatagggac 901 tttgtggaag gtatgtcagg tgggacttgg gttgatgttg tcttggaaca tggaggttgt 961 gtcaccgtaa tggcacagga caaaccgact gtcgacatag agctggttac aacaacagtc 1021 agcaacatgg cggaggtaag atcctactgc tatgaggcat caatatcgga catggcttcg 1081 gacagccgct gcccaacaca aggtgaagcc taccttgaca agcaatcaga cactcaatat 1141 gtctgcaaaa gaacgttagt ggacagaggc tggggaaatg gatgtggact ttttggcaaa 1201 gggagcctgg tgacatgcgc taagtttgca tgctccaaga aaatgaccgg gaagagcatc 1261 cagccagaga atctggagta ccggataatg ctgtcagttc atggctccca gcacagtggg 1321 atgatcgtta atgacacagg acatgaaact gatgagaata gagcgaaggt tgagataacg 1381 cccaattcac caagagccga agccaccctg gggggttttg gaagcctagg acttgattgt 1441 gaaccgagga caggccttga cttttcagat ttgtattact tgactatgaa taacaagcac 1501 tggttggttc acaaggagtg gttccacgac attccattac cttggcacgc tggggcagac 1561 accggaactc cacactggaa caacaaagaa gcactggtag agttcaagga cgcacatgcc 1621 aaaaggcaaa ctgtcgtggt tctagggagt caagaaggag cagttcacac ggcccttgct 1681 ggagctctgg aggctgagat ggatggtgca aagggaaggc tgtcctctgg ccacttgaaa 1741 tgtcgcctga aaatggataa acttagattg aagggcgtgt catactcctt gtgtaccgca 1801 gcgttcacat tcaccaagat cccggctgaa acactgcacg ggacagtcac agtggaggta 1861 cagtacgcag ggacagatgg accttgcaag gttccagctc agatggcggt ggacatgcaa 1921 actctgaccc cagttgggag gctgataacc gctaaccccg taatcactga aagcactgag 1981 aactccaaga tgatgctgga acttgatcca ccatttgggg actcttacat tgtcatagga 2041 gtcggggaga agaagatcac ccaccactgg cacaggagtg gcagcaccat tggaaaagca 2101 tttgaagcca ctgtgagagg tgccaggaga atggcagtct tgggagacac agcctgggac 2161 tttggatcag ttggaggcgc tctcaactca ttgggcaagg gcatccatca aatttttgga 2221 gcagctttca aatcattgtt tggaggaatg tcctggttct cacaaattct cattggaacg 2281 ttgctgatgt ggttgggtct gaacacaaag aatggatcta tttcccttat gtgcttggcc 2341 ttagggggag tgttgatctt cttatccaca gccgtctctg ctgatgtggg gtgctcggtg 2401 gacttctcaa agaaggagac gagatgcggt acaggggtgt tcgtctataa cgacgttgaa 2461 gcctggaggg acaggtacaa gtaccatcct gactcccccc gtagattggc agcagcagtc 2521 aagcaagcct gggaagatgg tatctgtggg atctcctctg tttcaagaat ggaaaacatc 2581 atgtggagat cagtagaagg ggagctcaac gcaatcctgg aagagaatgg agttcaactg 2641 acggtcgttg tgggatctgt aaaaaacccc atgtggagag gtccacagag attgcccgtg 2701 cctgtgaacg agctgcccca cggctggaag gcttggggga aatcgtactt cgtcagagca 2761 gcaaagacaa ataacagctt tgtcgtggat ggtgacacac tgaaggaatg cccactcaaa 2821 catagagcat ggaacagctt tcttgtggag gatcatgggt tcggggtatt tcacactagt 2881 gtctggctca aggttagaga agattattca ttagagtgtg atccagccgt tattggaaca 2941 gctgttaagg gaaaggaggc tgtacacagt gatctaggct actggattga gagtgagaag 3001 aatgacacat ggaggctgaa gagggcccat ctgatcgaga tgaaaacatg tgaatggcca 3061 aagtcccaca cattgtggac agatggaata gaagagagtg atctgatcat acccaagtct 3121 ttagctgggc cactcagcca tcacaatacc agagagggct acaggaccca aatgaaaggg 3181 ccatggcaca gtgaagagct tgaaattcgg tttgaggaat gcccaggcac caaggtccac 3241 gtggaggaaa catgtggaac aagaggacca tctctgagat caaccactgc aagcggaagg 3301 gtgatcgagg aatggtgctg cagggagtgc acaatgcccc cactgtcgtt ccaggctaaa 3361 gatggctgtt ggtatggaat ggagataagg cccaggaaag aaccagaaag taacttagta 3421 aggtcaatgg tgactgcagg atcaactgat cacatggatc acttctccct tggagtgctt 3481 gtgattctgc tcatggtgca ggaagggctg aagaagagaa tgaccacaaa gatcatcata 3541 agcacatcaa tggcagtgct ggtagctatg atcctgggag gattttcaat gagtgacctg 3601 gctaagcttg caattttgat gggtgccacc ttcgcggaaa tgaacactgg aggagatgta 3661 gctcatctgg cgctgatagc ggcattcaaa gtcagaccag cgttgctggt atctttcatc 3721 ttcagagcta attggacacc ccgtgaaagc atgctgctgg ccttggcctc gtgtcttttg 3781 caaactgcga tctccgcctt ggaaggcgac ctgatggttc tcatcaatgg ttttgctttg 3841 gcctggttgg caatacgagc gatggttgtt ccacgcactg ataacatcac cttggcaatc 3901 ctggctgctc tgacaccact ggcccggggc acactgcttg tggcgtggag agcaggcctt 3961 gctacttgcg gggggtttat gctcctctct ctgaagggaa aaggcagtgt gaagaagaac 4021 ttaccatttg tcatggccct gggactaacc gctgtgaggc tggtcgaccc catcaacgtg 4081 gtgggactgc tgttgctcac aaggagtggg aagcggagct ggccccctag cgaagtactc 4141 acagctgttg gcctgatatg cgcattggct ggagggttcg ccaaggcaga tatagagatg 4201 gctgggccca tggccgcggt cggtctgcta attgtcagtt acgtggtctc aggaaagagt 4261 gtggacatgt acattgaaag agcaggtgac atcacatggg aaaaagatgc ggaagtcact 4321 ggaaacagtc cccggcttga tgtggcgcta gatgagagtg gtgatttctc cctggtggag 4381 gatgacggtc cccccatgag agagatcata ctcaaggtgg tcctgatgac catctgtggc 4441 atgaacccaa tagccatacc ctttgcagct ggagcgtggt acgtatacgt gaagactgga 4501 aaaaggagtg gagctctatg ggatgtgcct gctcccaagg aagtaaaaaa gggggagacc 4561 acagatggag tgtacagagt gatgactcgt agactgctag gttcaacaca agttggagtg 4621 ggagttatgc aagagggggt ctttcacacc atgtggcacg tcacaaaagg atccgcgctg 4681 agaagcggtg aagggagact tgatccatac tggggagatg tcaagcagga tctggtgtca 4741 tactgtggtc catggaagct agatgccgcc tgggacgggc acagcgaggt gcagctcttg 4801 gccgtgcccc ccggagagag agcgaggaac atccagactc tgcccggaat atttaagaca 4861 aaggatgggg acattggagc ggttgcgctg gattacccag caggaacttc aggatctcca 4921 atcctagaca agtgtgggag agtgatagga ctttatggca atggggtcgt gatcaaaaat 4981 gggagttatg ttagtgccat cacccaaggg aggagggagg aagagactcc tgttgagtgc 5041 ttcgagcctt cgatgctgaa gaagaagcag ctaactgtct tagacttgca tcctggagct 5101 gggaaaacca ggagagttct tcctgaaata gtccgtgaag ccataaaaac aagactccgt 5161 actgtgatct tagctccaac cagggttgtc gctgccgaaa tggaggaagc ccttagaggg 5221 cttccagtgc gttatatgac aacagcagtc aatgtcaccc actctggaac agaaatcgtc 5281 gacttaatgt gccatgccac cttcacttca cgtctactac agccaatcag agtccccaac 5341 tataatctgt atattatgga tgaggcccac ttcacagatc cctcaagtat agcagcaaga 5401 ggatacattt caacaagggt tgagatgggc gaggcggctg ccatcttcat gaccgccacg 5461 ccaccaggaa cccgtgacgc atttccggac tccaactcac caattatgga caccgaagtg 5521 gaagtcccag agagagcctg gagctcaggc tttgattggg tgacggatca ttctggaaaa 5581 acagtctggt ttgttccaag cgtgaggaac ggcaatgaga tcgcagcttg tctgacaaag 5641 gctggaaaac gggtcataca gctcagcaga aagacttttg agacagagtt ccagaaaaca 5701 aaacatcaag agtgggactt tgtcgtgaca actgacattt cagagatggg cgccaacttt 5761 aaagctgacc gtgtcataga ttccaggaga tgcctaaagc cggtcatact tgatggcgag 5821 agagtcattc tggctggacc catgcctgtc acacatgcca gcgctgccca gaggaggggg 5881 cgcataggca ggaatcccaa caaacctgga gatgagtatc tgtatggagg tgggtgcgca 5941 gagactgacg aagaccatgc acactggctt gaagcaagaa tgctccttga caatatttac 6001 ctccaagatg gcctcatagc ctcgctctat cgacctgagg ccgacaaagt agcagccatt 6061 gagggagagt tcaagcttag gacggagcaa aggaagacct ttgtggaact catgaaaaga 6121 ggagatcttc ctgtttggct ggcctatcag gttgcatctg ccggaataac ctacacagat 6181 agaagatggt gctttgatgg cacgaccaac aacaccataa tggaagacag tgtgccggca 6241 gaggtgtgga ccagacacgg agagaaaaga gtgctcaaac cgaggtggat ggacgccaga 6301 gtttgttcag atcacgcggc cctgaagtca ttcaaggagt ttgccgctgg gaaaagagga 6361 gcggcttttg gagtgatgga agccttggga acactgccag gacacatgac agagagattc 6421 caggaagcca ttgacaacct cgctgtgctc atgcgggcag agactggaag caggccttac 6481 aaagccgcgg cggcccaatt gccggagacc ctagagacca ttatgctttt ggggttgctg 6541 ggaacagtct cgctgggaat ctttttcgtc ttgatgagga acaagggcat agggaagatg 6601 ggctttggaa tggtgactct tggggccagc gcatggctca tgtggctctc ggaaattgag 6661 ccagccagaa ttgcatgtgt cctcattgtt gtgttcctat tgctggtggt gctcatacct 6721 gagccagaaa agcaaagatc tccccaggac aaccaaatgg caatcatcat catggtagca 6781 gtaggtcttc tgggcttgat taccgccaat gaactcggat ggttggagag aacaaagagt 6841 gacctaagcc atctaatggg aaggagagag gagggggcaa ccataggatt ctcaatggac 6901 attgacctgc ggccagcctc agcttgggcc atctacgctg ccttgacaac tttcattacc 6961 ccagccgtcc aacatgcagt gaccacttca tacaacaact actccttaat ggcgatggcc 7021 acgcaagctg gagtgttgtt tggtatgggc aaagggatgc cattctacgc atgggacttt 7081 ggagtcccgc tgctaatgat aggttgctac tcacaattaa cacccctgac cctaatagta 7141 gccatcattt tgctcgtggc gcactacatg tacttgatcc cagggctgca ggcagcagct 7201 gcgcgtgctg cccagaagag aacggcagct ggcatcatga agaaccctgt tgtggatgga 7261 atagtggtga ctgacattga cacaatgaca attgaccccc aagtggagaa aaagatggga 7321 caggtgctac tcatagcagt agccgtctcc agcgccatac tgtcgcggac cgcctggggg 7381 tggggggagg ctggggccct gatcacagct gcaacttcca ctttgtggga aggctctccg 7441 aacaagtact ggaactcctc tacagccact tcactgtgta acatttttag gggaagttac 7501 ttggctggag cttctctaat ctacacagta acaagaaacg ctggcttggt caagagacgt 7561 gggggtggaa caggagagac cctgggagag aaatggaagg cccgcttgaa ccagatgtcg 7621 gccctggagt tctactccta caaaaagtca ggcatcaccg aggtgtgcag agaagaggcc 7681 cgccgcgccc tcaaggacgg tgtggcaacg ggaggccatg ctgtgtcccg aggaagtgca 7741 aagctgagat ggttggtgga gcggggatac ctgcagccct atggaaaggt cattgatctt 7801 ggatgtggca gagggggctg gagttactac gccgccacca tccgcaaagt tcaagaagtg 7861 aaaggataca caaaaggagg ccctggtcat gaagaaccca tgttggtgca aagctatggg 7921 tggaacatag tccgtcttaa gagtggggtg gacgtctttc atatggcggc tgagccgtgt 7981 gacacgttgc tgtgtgacat aggtgagtca tcatctagtc ctgaagtgga agaagcacgg 8041 acgctcagag tcctttccat ggtgggggat tggcttgaaa aaagaccagg agccttttgt 8101 ataaaagtgt tgtgcccata caccagcact atgatggaaa ccctggagcg actgcagcgt 8161 aggtatggag gaggactggt cagagtgcca ctctcccgca actctacaca tgagatgtac 8221 tgggtctctg gagcgaaaag caacaccata aaaagtgtgt ccaccacgag ccagctcctc 8281 ttggggcgca tggacgggcc caggaggcca gtgaaatatg aggaggatgt gaatctcggc 8341 tctggcacgc gggctgtggt aagctgcgct gaagctccca acatgaagat cattggtaac 8401 cgcattgaaa ggatccgcag tgagcacgcg gaaacgtggt tctttgacga gaaccaccca 8461 tataggacat gggcttacca tggaagctat gaggccccca cacaagggtc agcgtcctct 8521 ctaataaacg gggttgtcag gctcctgtca aaaccctggg atgtggtgac tggagtcaca 8581 ggaatagcca tgaccgacac cacaccgtat ggtcagcaaa gagttttcaa ggaaaaagtg 8641 gacactaggg tgccagatcc ccaagaaggc actcgtcagg ttatgagcat ggtctcttcc 8701 tggttgtgga aagagctagg caaacacaaa cggccacgag tctgtaccaa agaagagttc 8761 atcaacaagg ttcgtagcaa tgcagcatta ggggcaatat ttgaagagga aaaagagtgg 8821 aagactgcag tggaagctgt gaacgatcca aggttctggg ctctagtgga caaggaaaga 8881 gagcaccacc tgagaggaga gtgccagagt tgtgtgtaca acatgatggg aaaaagagaa 8941 aagaaacaag gggaatttgg aaaggccaag ggcagccgcg ccatctggta tatgtggcta 9001 ggggctagat ttctagagtt cgaagccctt ggattcttga acgaggatca ctggatgggg 9061 agagagaact caggaggtgg tgttgaaggg ctgggattac aaagactcgg atatgtccta 9121 gaagagatga gtcgcatacc aggaggaagg atgtatgcag atgacactgc tggctgggac 9181 acccgcatca gcaggtttga tctggagaat gaagctctaa tcaccaacca aatggagaaa 9241 gggcacaggg ccttggcatt ggccataatc aagtacacat accaaaacaa agtggtaaag 9301 gtccttagac cagctgaaaa agggaagaca gttatggaca ttatttcgag acaagaccaa 9361 agggggagcg gacaagttgt cacttacgct cttaacacat ttaccaacct agtggtgcaa 9421 ctcattcgga gtatggaggc tgaggaagtt ctagagatgc aagacttgtg gctgctgcgg 9481 aggtcagaga aagtgaccaa ctggctgcag agcaacggat gggataggct caaacgaatg 9541 gcagtcagtg gagatgattg cgttgtgagg ccaattgatg ataggtttgc acatgccctc 9601 aggttcttga atgatatggg gaaagttagg aaggacacac aagagtggaa accctcaact 9661 ggatgggaca actgggagga agttccgttt tgctcccacc acttcaacaa gctccatctc 9721 aaggacggga ggtccattgt ggttccctgc cgccaccaag atgaactgat tggccgggcc 9781 cgcgtctctc caggggcggg atggagcatc cgggagactg cttgcctagc aaaatcatat 9841 gcgcaaatgt ggcagctcct ttatttccac agaagggacc tccgactgat ggccaatgcc 9901 atttgttcat ctgtgccagt tgactgggtt ccaactggga gaactacctg gtcaatccat 9961 ggaaagggag aatggatgac cactgaagac atgcttgtgg tgtggaacag agtgtggatt 10021 gaggagaacg accacatgga agacaagacc ccagttacga aatggacaga cattccctat 10081 ttgggaaaaa gggaagactt gtggtgtgga tctctcatag ggcacagacc gcgcaccacc 10141 tgggctgaga acattaaaaa cacagtcaac atggtgcgca ggatcatagg tgatgaagaa 10201 aagtacatgg actacctatc cacccaagtt cgctacttgg gtgaagaagg gtctacacct 10261 ggagtgctgt aa
-
Zhejiang Provincial Center for Disease Control and Prevention has released a full sequence from Zhejiang ex-Suriname, ZJ03, collected Feb 17, 2016.Title changed to reflect travel history to Fiji/Samoa (not Suriname)
-
Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1843818438100%0.099%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1839018390100%0.099%KU509998.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1838418384100%0.099%KJ776791.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1837518375100%0.099%KU321639.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1836618366100%0.099%KU729218.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1836618366100%0.099%KU707826.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1836618366100%0.099%KU365779.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome183591835999%0.099%KU497555.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1835418354100%0.099%KU365780.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1834818348100%0.099%KU365777.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1834818348100%0.099%KU312312.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1834518345100%0.099%KU501217.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1834518345100%0.099%KU365778.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1833918339100%0.099%KU527068.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1833918339100%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1833618336100%0.099%KU501215.1Select seq gb|KU740184.1|Zika virus isolate GD01 polyprotein gene, complete cds1831818318100%0.099%KU740184.1Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1830918309100%0.099%KU761564.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1814118141100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1805118051100%0.099%KU681081.3Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177441774499%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds177121771298%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1758917589100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1743417434100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164151641599%0.095%HQ234499.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1331513315100%0.089%KF383115.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1331113311100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1331113311100%0.089%KF268948.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1330813308100%0.089%KU720415.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1330413304100%0.089%KF268950.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds133021330299%0.089%HQ234498.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1329013290100%0.089%KF383119.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1328613286100%0.089%LC002520.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1328413284100%0.089%DQ859059.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1324813248100%0.089%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132321323299%0.089%HQ234501.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1322713227100%0.089%AY632535.2Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1317313173100%0.088%KF383117.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131471314799%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1295413022100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128911289197%0.089%KF383121.1Select seq gb|KU729217.1|Zika virus isolate BeH823339 polyprotein gene, complete cds119301697692%0.099%KU729217.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108861088697%0.084%KF383120.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4962496227%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4940494027%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4673467325%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4673467325%0.099%KU646827.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3434343418%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3205320517%0.099%KU740199.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds2852417095%0.071%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2691269114%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2075207511%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2021202111%0.099%KU179098.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds175217529%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds174817489%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds174617469%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds174517459%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds174517459%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds174517459%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds174317439%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds160216028%0.099%KJ873160.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds142014207%0.099%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds138213827%0.099%KM851039.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds134613467%0.099%KU556802.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds134613467%0.098%KM851038.1
-
LOCUS KU820897 10800 bp RNA linear VRL 01-MAR-2016 DEFINITION Zika virus isolate FLR polyprotein gene, complete cds. ACCESSION KU820897 VERSION KU820897.1 GI:1001904507 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10800) AUTHORS Kneubehl,A.R. and Rico-Hesse,R.R. TITLE Direct Submission JOURNAL Submitted (26-FEB-2016) Molecular Virology and Microbiology, Baylor College of Medicine, One Baylor Plaza, Houston, TX 77030, USA COMMENT ##Assembly-Data-START## Assembly Method :: IVA v. 1.0.3 Coverage :: 7620 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10800 /organism="Zika virus" /mol_type="genomic RNA" /isolate="FLR" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Colombia: Barranquilla" /collection_date="Dec-2015" /note="passage details: C6/36 cells passage 1" 5'UTR <1..107 CDS 108..10379 /codon_start=1 /product="polyprotein" /protein_id="AMM39804.1" /db_xref="GI:1001904508" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGAETSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFWAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVAKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" mat_peptide 108..473 /product="capsid" misc_feature 420..473 /note="Region: hydrophobic anchor" mat_peptide 474..752 /product="Pr" mat_peptide 753..977 /product="M" mat_peptide 978..2489 /product="env" mat_peptide 2490..3545 /product="NS1" mat_peptide 3546..4223 /product="NS2A" mat_peptide 4224..4613 /product="NS2B" mat_peptide 4614..6464 /product="NS3" mat_peptide 6465..6845 /product="NS4A" mat_peptide 6846..6914 /product="peptide 2K" mat_peptide 6915..7667 /product="NS4B" mat_peptide 7668..10376 /product="NS5" 3'UTR 10380..>10800 ORIGIN 1 acctgttgat actgttgcta gctttcgctt caaactcgaa ctgtcgcagt ctgattcaca 61 cagatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa 121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga 181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca 241 ggatggtctt ggcgattcta gcctttttga gattcacggc aatcaagcca tcactgggtc 301 tcatcaatag atggggttca gtggggaaaa aagaggctat ggaaataata aagaagttca 361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag 421 gcgcagaaac tagtgtcgga attgttggcc tcctgctgac cacagctatg gcagcggagg 481 tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct ggggaggcca 541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac 601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag 661 atgacgtcga ttgttggtgc aacacgacgt caacttgggt tgtgtacgga acctgccatc 721 acaaaaaagg tgaagcacgg agatctagaa gagccgtgac gctcccctcc cattccacta 781 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcacttga 841 ttagagtcga aaattggata ttcaggaacc ctggtttcgc tttagcagca gctgccatcg 901 cttggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga 961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta 1021 tgtcaggtgg gacttgggtt gatgtcgtct tggaacatgg aggttgtgtc accgtaatgg 1081 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg 1141 aggtaagatc ctactgctat gaggcatcaa tatcagacat ggcttcggac agccgctgcc 1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtc tgcaaaagaa 1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga 1321 catgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc 1381 tggagtaccg gataatgttg tcagttcatg gctcccagca cagtgggatg atcgttaatg 1441 acacaggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa 1501 gagccgaagc caccctgggg ggctttggaa gcctaggact tgattgtgaa ccgaggacag 1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggttcaca 1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac 1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg 1741 tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga gctctggagg 1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa 1861 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca 1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga 1981 cagatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact ctgaccccag 2041 ttgggaggtt gataaccgct aaccccgtaa tcactgaaag cactgagaac tctaagatga 2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga 2161 agatcaccca ccactggcac aggagtggca gcaccattgg aaaagcattt gaagccactg 2221 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg 2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat 2341 cattgtttgg aggaatgtcc tggttctcac aaattctcat tggaacgttg ctgatgtggt 2401 tgggtctgaa cacaaagaat ggatctattt cccttatgtg cttggcctta gggggagtgt 2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga 2521 aggagacgag atgtggtaca ggggtgttcg tctataacga cgttgaagcc tggagggaca 2581 ggtacaagta ccatcctgac tccccccgta gattggcagc agcagtcaag caagcctggg 2641 aagatggtat ctgcgggatc tcctctgttt caagaatgga aaacatcatg tggagatcag 2701 tagaagggga gctcaacgca atcctggaag agaatggagt tcaactgacg gtcgttgtgg 2761 gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct gtgaacgagc 2821 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt cagagcagca aagacaaata 2881 acagctttgt cgtggatggt gacacactga aagaatgccc actcaaacat agagcatgga 2941 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg 3001 ttagagaaga ttattcatta gagtgtgatc cagccgttat tggaacagct gttaagggaa 3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga 3121 ggctgaagag ggcccatctg atcgagatga aaacatgtga atggccaaag tcccacacat 3181 tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttta gctgggccac 3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg 3301 aagagcttga aattcggttt gaggaatgcc caggcactaa ggtccacgtg gaggaaacat 3361 gtggaacaag aggaccatct ctgagatcaa ccactgcaag cggaagggtg atcgaggaat 3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttctg ggctaaagat ggctgttggt 3481 atggaatgga gataaggccc aggaaagaac cagaaagcaa cttagtaagg tcaatggtga 3541 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca 3601 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcaatgg 3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa 3721 tcttgatggg tgccaccttc gcggaaatga acactggagg agatgtagct catctggcgc 3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc cttcatcttc agagctaatt 3841 ggacaccccg tgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct 3901 ccgccttgga gggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa 3961 tacgagcgat ggttgttcca cgcactgaca acatcacctt ggcaatcctg gctgctctga 4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg 4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca 4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt 4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc 4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg 4321 ccgcggttgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca 4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc 4441 ggctcgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc 4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag 4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggtg 4621 cgctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt 4681 acagagtaat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag 4741 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag 4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat 4861 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg 4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca 4981 ttggagcggt tgcgctggat tacccagcag gaacttcagg atctccaatc ctagacaagt 5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg agttatgtta 5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga 5161 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga 5221 gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact gtgatcttag 5281 ctccaaccag ggttgtcgct gctgaaatgg aggaagccct tagagggctt ccagtgcgtt 5341 atatgacaac agcagtcaat gtcacccact ctggaacaga aatcgtcgac ttaatgtgcc 5401 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtata 5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcaa 5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc 5581 gtgacgcatt tccggactcc aactcaccaa ttatggacac cgaagtggaa gtcccagaga 5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg 5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg 5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt 5821 gggactttgt cgtgacaact gacatttcag agatgggcgc caactttaaa gctgaccgtg 5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattctgg 5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga 6001 atcccaataa acctggagat gagtatctgt atggaggtgg gtgcgcagag actgacgaag 6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc 6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca 6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg 6241 tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga agatggtgct 6301 ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag gtgtggacca 6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc 6421 atgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag 6481 tgatggaagc cctgggaaca ctgccaggac acatgacaga gagattccag gaagccattg 6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg 6601 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgt 6661 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg 6721 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg 6781 catgtgtcct cattgttgtg ttcctattgc tggtggtgct catacctgag ccagaaaagc 6841 aaagatctcc ccaggacaac caaatggcaa tcatcatcat ggtagcagta ggtcttctgg 6901 gcttgattac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc 6961 taatgggaag gagagaggag ggggcaacca taggattctc aatggacatt gacctgcggc 7021 cagcctcagc ttgggccatc tatgctgcct tgacaacttt cattacccca gccgtccaac 7081 atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg caagctggag 7141 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc 7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc 7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc 7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg 7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca 7441 tagcagtagc cgtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg 7501 gggccctgat cacagccgca acttccactt tgtgggaagg ctctccgaac aagtactgga 7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt 7621 ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag 7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct 7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca 7801 aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt 7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag 7921 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa 7981 aaggaggccc tggtcatgaa gaacccgtgt tggtgcaaag ctatgggtgg aacatagtcc 8041 gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt 8101 gtgacatagg tgagtcatca tctagtcctg aagtggaaga agcacggacg ctcagagtcc 8161 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt 8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag 8281 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag 8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg 8401 acgggcctag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg 8461 ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga 8521 tccgcagtga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg 8581 cttaccatgg aagctatgag gcccccacac aagggtcagc gtcctctcta ataaacgggg 8641 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga 8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc 8761 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag 8821 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc aacaaggtgc 8881 gtagcaatgc agcattaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg 8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga 9001 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg 9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc 9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag 9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc 9241 gcataccagg aggaaggatg tatgcagatg acactgctgg ctgggacacc cgcattagca 9301 ggtttgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg cacagggcct 9361 tggcattggc cataatcaag tacacatacc aaaacaaagt ggtaaaggtc cttagaccag 9421 ctgaaaaagg gaaaacagtt atggacatta tttcgagaca agaccaaagg gggagcggac 9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggaata 9541 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag 9601 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag 9661 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg 9721 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact 9781 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt 9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag 9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc 9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg 10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat 10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc 10141 acatggaaga caagacccca gttgcgaaat ggacagacat tccctatttg ggaaaaaggg 10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca 10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag tacatggact 10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctgga gtgctgtaag 10381 caccaatctt aatgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc 10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg 10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca 10561 cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg 10621 ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt agaggagacc 10681 ccccggaaaa cgcaaaacag catattgacg ctgggaaaga ccagagactc catggatttc 10741 caccacaccg gccgccgcta ttcggcgatc tgtgcctggc ggccagcgtg gggaaactca
-
Baylor College of Medicine released a full Zika sequence, FLR, from Barranquilla, Colombia collected in Dec 2015.
-
LOCUS KU820899 10272 bp RNA linear VRL 29-FEB-2016 DEFINITION Zika virus isolate ZJ03 polyprotein gene, complete cds. ACCESSION KU820899 VERSION KU820899.1 GI:1001904509 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10272) AUTHORS Zhang,Y., Sun,Y., Pan,J., Mao,H., Yan,H., Lou,X., Chen,Z. and Xia,S. TITLE Direct Submission JOURNAL Submitted (27-FEB-2016) Department of Microbiology, Zhejiang Provincial Center for Disease Control and Prevention, 3399 Binsheng Road, Hangzhou, Zhejiang 310051, P. R. China COMMENT ##Assembly-Data-START## Assembly Method :: Geneious v. 8.1.7 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10272 /organism="Zika virus" /mol_type="genomic RNA" /isolate="ZJ03" /host="Homo sapiens" /db_xref="taxon:64320" /country="China" /collection_date="17-Feb-2016"
-
Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1839318393100%0.099%KU509998.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1839018390100%0.099%KJ776791.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1838118381100%0.099%KU321639.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1837218372100%0.099%KU729218.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1837218372100%0.099%KU707826.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1837218372100%0.099%KU527068.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1837218372100%0.099%KU365779.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1835718357100%0.099%KU501217.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1835718357100%0.099%KU365780.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome183541835499%0.099%KU497555.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1835418354100%0.099%KU647676.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1835418354100%0.099%KU501216.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1835418354100%0.099%KU365777.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1833918339100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1833918339100%0.099%KU312312.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1833018330100%0.099%KU501215.1Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1831218312100%0.099%KU761564.1Select seq gb|KU740184.1|Zika virus isolate GD01 polyprotein gene, complete cds1830318303100%0.099%KU740184.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1814618146100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1804718047100%0.099%KU681081.3Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177391773999%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds176941769498%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1758517585100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1743817438100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164151641599%0.095%HQ234499.1
-
LOCUS KU729217 10645 bp RNA linear VRL 02-MAR-2016 DEFINITION Zika virus isolate BeH823339 polyprotein gene, complete cds. ACCESSION KU729217 VERSION KU729217.2 GI:1002394024 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10645) AUTHORS Faria,N.R., Azevedo,R.S.S., Kraemer,M.U.G., Souza,R., Cunha,M.S., Hill,S.C., Theze,J., Bonsall,M.B., Bodeng,T.A., Rissanen,I., Rocco,I.M., Nogueira,J.S., Maeda,A.Y., Vasami,F.G.S., Macedo,F.L.L., Suzuki,A., Rodrigues,S.G., Cruz,A.C.R., Diniz,B.T., Medeiros,D.B.A., Silva,E.V.P., Henriques,D.F., Travassos da Rosa,E.S., Oliveira,C.S., Martins,L.C., Vasconcelos,H.B., Casseb,L.M.N., Simith,D.B., Messina,J., Abade,L., Lourenco,J., Alcantara,L.C., Lima,M., Giovanetti,M., Hay,S.I., Oliveira,R.S., Lemos,P.S., Oliveira,L.F., Lima,C.P.S., Silva,S.P., Vasconcelos,J.M., Cardoso,J.F., Vianez-Junior,J.L.S.G., Mir,D., Bello,G., Delatorre,E., Khan,K., Creatore,M., Coelho,G.E., Oliveira,W.K., Tesh,R., Pybus,O.G., Nunes,M.R.T. and Vasconcelos,P.F.C. TITLE Zika virus in the Americas: early epidemiological and genetic findings JOURNAL Unpublished REFERENCE 2 (bases 1 to 10645) AUTHORS Nunes,M.R.T., Azevedo,R.S.S., Silva,S.P., Vasconcelos,J.M., Cardoso,J.F., Lemos,P.S., Lima,C.P.S., Oliveira,R.S., Faria,N.R., Vianez-Junior,J.L.S.G., Medeiros,D.B.A., Rodrigues,S.G., Diniz,B.T., Silva,E.V.P., Cruz,A.C.R. and Vasconcelos,P.F.C. TITLE Direct Submission JOURNAL Submitted (18-FEB-2016) Center for Technological Innovation, Evandro Chagas Institute, BR 316, Km 07, s/n, Ananindeua, Para 67030-000, Brazil REFERENCE 3 (bases 1 to 10645) AUTHORS Nunes,M.R.T., Azevedo,R.S.S., Silva,S.P., Vasconcelos,J.M., Cardoso,J.F., Lemos,P.S., Lima,C.P.S., Oliveira,R.S., Faria,N.R., Vianez-Junior,J.L.S.G., Medeiros,D.B.A., Rodrigues,S.G., Diniz,B.T., Silva,E.V.P., Cruz,A.C.R. and Vasconcelos,P.F.C. TITLE Direct Submission JOURNAL Submitted (02-MAR-2016) Center for Technological Innovation, Evandro Chagas Institute, BR 316, Km 07, s/n, Ananindeua, Para 67030-000, Brazil REMARK Sequence update by submitter COMMENT On Mar 2, 2016 this sequence version replaced gi:998491030. ##Assembly-Data-START## Assembly Method :: Mira 4.0 and Geneious 7.0 Sequencing Technology :: Ion and 454 ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10645 /organism="Zika virus" /mol_type="genomic RNA" /isolate="BeH823339" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="2015" CDS 76..10347 /codon_start=1 /product="polyprotein" /protein_id="AMK49164.2" /db_xref="GI:1002394025" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVSTTVSNMAEVRSYCYEATISDIASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTAVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKEKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSVVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPIAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGDRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 gttcgagttt gaagcgaaag ctagcaacag tatcaacagg ttttattttg gatttggaaa 61 cgagagtttc tggtcatgaa aaacccaaaa aagaaatccg gaggattccg gattgtcaat 121 atgctaaaac gcggagtagc ccgtgtgagc ccctttgggg gcttgaagag gctgccagcc 181 ggacttctgc tgggtcatgg gcccatcagg atggtcttgg cgattctagc ctttttgaga 241 ttcacggcaa tcaagccatc actgggtctc atcaatagat ggggttcagt ggggaaaaaa 301 gaggctatgg aaataataaa gaagttcaag aaagatctgg ctgccatgct gagaataatc 361 aatgctagga aggagaagaa gagacgaggc gcagatacta gtgtcggaat tgttggcctc 421 ctgctgacca cagctatggc agcggaggtc actagacgtg ggagtgcata ctatatgtac 481 ttggacagaa acgatgctgg ggaggccata tcttttccaa ccacattggg gatgaataag 541 tgttatatac agatcatgga tcttggacac atgtgtgatg ccaccatgag ctatgaatgc 601 cctatgctgg atgagggggt ggaaccagat gacgtcgatt gttggtgcaa cacgacgtca 661 acttgggttg tgtacggaac ctgccatcac aaaaaaggtg aagcacggag atctagaaga 721 gctgtgacgc tcccctccca ttccactagg aagctgcaaa cgcggtcgca aacctggttg 781 gaatcaagag aatacacaaa gcacttgatt agagtcgaaa attggatatt caggaaccct 841 ggcttcgcgt tagcagcagc tgccatcgct tggcttttgg gaagctcaac gagccaaaaa 901 gtcatatact tggtcatgat actgctgatt gccccggcat acagcatcag gtgcatagga 961 gtcagcaata gggactttgt ggaaggtatg tcaggtggga cttgggttga tgttgtcttg 1021 gaacatggag gttgtgtcac cgtaatggca caggacaaac cgactgtcga catagagctg 1081 gtttcaacaa cagtcagcaa catggcggag gtaagatcct actgctatga ggcaacaata 1141 tcagacatag cttcggacag ccgctgccca acacaaggtg aagcctacct tgacaagcaa 1201 tcagacactc aatatgtctg caaaagaacg ttagtggaca gaggctgggg aaatggatgt 1261 ggactttttg gcaaagggag cctggtgaca tgcgctaagt ttgcatgctc caagaaaatg 1321 accgggaaga gcatccagcc agagaatctg gagtaccgga taatgctgtc agttcatggc 1381 tcccagcaca gtgggatgat cgttaatgac acaggacatg aaactgatga gaatagagcg 1441 aaggttgaga taacgcccaa ttcaccaaga gccgaagcca ccctgggggg ttttggaagc 1501 ctaggacttg attgtgaacc gaggacaggc cttgactttt cagatttgta ttacttgact 1561 atgaataaca agcactggtt ggttcacaag gagtggttcc acgacattcc attaccttgg 1621 cacgctgggg cagacaccgg aactccacac tggaacaaca aagaagcact ggtagagttc 1681 aaggacgcac atgccaaaag gcaaactgcc gtggttctag ggagtcaaga aggagcagtt 1741 cacacggccc ttgctggagc tctggaggct gagatggatg gtgcaaaggg aaggctgtcc 1801 tctggccact tgaaatgtcg cctgaaaatg gataaactta gattgaaggg cgtgtcatac 1861 tccttgtgta ccgcagcgtt cacattcacc aagatcccgg ctgaaacact gcacgggaca 1921 gtcacagtgg aggtacagta cgcagggaca gatggacctt gcaaggttcc agctcagatg 1981 gcggtggaca tgcaaactct gaccccagtt gggaggttga taaccgctaa ccccgtaatc 2041 actgaaagca ctgagaactc taagatgatg ctggaacttg atccaccatt tggggactct 2101 tacattgtca taggagtcgg ggagaagaag atcacccacc actggcacag gagtggcagc 2161 accattggaa aagcatttga agccactgtg agaggtgcca agagaatggc agtcttggga 2221 gacacagcct gggactttgg atcagttgga ggcgctctca actcattggg caagggcatc 2281 catcaaattt ttggagcagc tttcaaatca ttgtttggag gaatgtcctg gttctcacaa 2341 atcctcattg gaacgttgct gatgtggttg ggtctgaaca caaagaatgg atctatttcc 2401 cttatgtgct tggccttagg gggagtgttg atcttcttat ccacagccgt ctctgctgat 2461 gtggggtgct cggtggactt ctcaaagaag gagacgagat gcggtacagg ggtgttcgtc 2521 tataacgacg ttgaagcctg gagggacagg tacaagtacc atcctgactc cccccgtaga 2581 ttggcagcag cagtcaagca agcctgggaa gatggtatct gcgggatctc ctctgtttca 2641 agaatggaaa acatcatgtg gagatcagta gaaggggagc tcaatgcaat cctggaagag 2701 aatggagttc aactgacggt cgttgtggga tctgtgaaaa accccatgtg gagaggtcca 2761 cagagattgc ccgtgcctgt gaacgagctg ccccacggct ggaaggcttg ggggaaatcg 2821 tacttcgtca gagcagcaaa gacaaataac agctttgtcg tggatggtga cacactgaag 2881 gaatgcccac tcaaacatag agcatggaac agctttcttg tggaggatca tgggttcggg 2941 gtatttcaca ctagtgtctg gctcaaggtt agagaagatt attcattaga gtgtgatcca 3001 gccgttattg gaacagctgt taaggaaaag gaggctgtac acagtgatct aggctactgg 3061 attgagagtg agaagaatga cacatggagg ctgaagaggg cccatctgat cgagatgaaa 3121 acatgtgaat ggccaaagtc ccacacattg tggacagatg gaatagaaga gagtgatctg 3181 atcataccca agtctttagc tgggccactc agccatcaca ataccagaga gggctacagg 3241 acccaaatga aagggccatg gcacagtgaa gagcttgaaa ttcggtttga ggaatgccca 3301 ggcactaagg tccacgtgga ggaaacatgt ggaacaagag gaccatctct gagatcaacc 3361 actgcaagcg gaagggtgat cgaggaatgg tgctgcaggg agtgcacaat gcccccactg 3421 tcgttccggg ctaaagatgg ctgttggtat ggaatggaga taagacccag gaaagaacca 3481 gaaagcaact tagtaaggtc agtggtgact gcaggatcaa ctgatcacat ggatcacttc 3541 tcccttggag tgcttgtgat tctgctcatg gtgcaggaag ggctgaagaa gagaatgacc 3601 acaaagatca tcataagcac atcaatggca gtgctggtag ctatgatcct gggaggattt 3661 tcaatgagtg acctggctaa gcttgcaatt ttgatgggtg ccaccttcgc ggaaatgaac 3721 actggaggag atgtagctca tctggcgctg atagcggcat tcaaagtcag accagcgttg 3781 ctggtatctt tcatcttcag agctaattgg acaccccgtg aaagcatgct gctggccttg 3841 gcctcgtgtc ttttgcaaac tgcgatctcc gccttggaag gcgacctgat ggttctcatc 3901 aatggttttg ctttggcctg gttggcaata cgagcgatgg ttgttccacg cactgataac 3961 atcaccttgg caatcctggc tgctctgaca ccactggccc ggggcacact gcttgtggcg 4021 tggagagcag gccttgctac ttgcgggggg tttatgctcc tctctctgaa gggaaaaggc 4081 agtgtgaaga agaacttacc atttgtcatg gccctgggac taaccgctgt gaggctggtc 4141 gaccccatca acgtggtggg actgctgttg ctcacaagga gtgggaagcg gagctggccc 4201 cctagcgaag tactcacagc tgttggcctg atatgcgcat tggctggagg gttcgccaag 4261 gcagatatag agatggctgg gcccatagcc gcggtcggtc tgctaattgt cagttacgtg 4321 gtctcaggaa agagtgtgga catgtacatt gaaagagcag gtgacatcac atgggaaaaa 4381 gatgcggaag tcactggaaa cagtccccgg ctcgatgtgg cgctagatga gagtggtgat 4441 ttctccctgg tggaggatga cggtcccccc atgagagaga tcatactcaa ggtggtcctg 4501 atgaccatct gtggcatgaa cccaatagcc ataccctttg cagctggagc gtggtacgta 4561 tacgtgaaga ctggaaaaag gagtggtgct ctatgggatg tgcctgctcc caaggaagta 4621 aaaaaggggg agaccacaga tggagtgtac agagtaatga ctcgtagact gctaggttca 4681 acacaagttg gagtgggagt tatgcaagag ggggtctttc acactatgtg gcacgtcaca 4741 aaaggatccg cgctgagaag cggtgaaggg agacttgatc catactgggg agatgtcaag 4801 caggatctgg tgtcatactg tggtccatgg aagctagatg ccgcctggga cgggcacagc 4861 gaggtgcagc tcttggccgt gccccccgga gagagagcga ggaacatcca gactctgccc 4921 ggaatattta agacaaagga tggggacatt ggagcggttg cgctggatta cccagcagga 4981 acttcaggat ctccaatcct agacaagtgt gggagagtga taggacttta tggcaatggg 5041 gtcgtgatca aaaatgggag ttatgttagt gccatcaccc aagggaggag ggaggaagag 5101 actcctgttg agtgcttcga gccttcgatg ctgaagaaga agcagctaac tgtcttagac 5161 ttgcatcctg gagctgggaa aaccaggaga gttcttcctg aaatagtccg tgaagccata 5221 aaaacaagac tccgtactgt gatcttagct ccaaccaggg ttgtcgctgc tgaaatggag 5281 gaagccctta gagggcttcc agtgcgttat atgacaacag cagtcaatgt cacccactct 5341 ggaacagaaa tcgtcgactt aatgtgccat gccaccttca cttcacgcct actacagcca 5401 atcagagtcc ccaactataa tctgtatatt atggatgagg cccacttcac agatccctca 5461 agtatagcag caagaggata catttcaaca agggttgaga tgggcgaggc ggctgccatc 5521 ttcatgaccg ccacgccacc aggaacccgt gacgcatttc cggactccaa ctcaccaatt 5581 atggacaccg aagtggaagt cccagagaga gcctggagct caggctttga ttgggtgacg 5641 gatcattctg gaaaaacagt ttggtttgtt ccaagcgtga ggaacggcaa tgagatcgca 5701 gcttgtctga caaaggctgg aaaacgggtc atacagctca gcagaaagac ttttgagaca 5761 gagttccaga aaacaaaaca tcaagagtgg gactttgtcg tgacaactga catttcagag 5821 atgggcgcca actttaaagc tgaccgtgtc atagattcca ggagatgcct aaagccggtc 5881 atacttgatg gcgagagagt cattctggct ggacccatgc ctgtcacaca tgccagcgct 5941 gcccagagga gggggcgcat aggcaggaat cccaacaaac ctggagatga gtatctgtat 6001 ggaggtgggt gcgcagagac tgacgaagac catgcacact ggcttgaagc aagaatgctc 6061 cttgacaata tttacctcca agatggcctc atagcctcgc tctatcgacc tgaggccgac 6121 aaagtagcag ccattgaggg agagttcaag cttaggacgg agcaaaggaa gacctttgtg 6181 gaactcatga aaagaggaga tcttcctgtt tggctggcct atcaggttgc atctgccgga 6241 ataacctaca cagatagaag atggtgcttt gatggcacga ccaacaacac cataatggaa 6301 gacagtgtgc cggcagaggt gtggaccaga cacggagaga aaagagtgct caaaccgagg 6361 tggatggacg ccagagtttg ttcagatcat gcggccctga agtcattcaa ggagtttgcc 6421 gctgggaaaa gaggagcggc ttttggagtg atggaagccc tgggaacact gccaggacac 6481 atgacagaga gattccagga agccattgac aacctcgctg tgctcatgcg ggcagagact 6541 ggaagcaggc cttacaaagc cgcggcggcc caattgccgg agaccctaga gaccattatg 6601 cttttggggt tgctgggaac agtctcgctg ggaatctttt tcgtcttgat gaggaacaag 6661 ggcataggga agatgggctt tggaatggtg actcttgggg ccagcgcatg gctcatgtgg 6721 ctctcggaaa ttgagccagc cagaattgca tgtgtcctca ttgttgtgtt cctattgctg 6781 gtggtgctca tacctgagcc agaaaagcaa agatctcccc aggacaacca aatggcaatc 6841 atcatcatgg tagcagtagg tcttctgggc ttgattaccg ccaatgaact cggatggttg 6901 gagagaacaa agagtgacct aagccatcta atgggaagga gagaggaggg agcaaccata 6961 ggattctcaa tggacattga cctgcggcca gcctcagctt gggccatcta tgctgccttg 7021 acaactttca ttaccccagc cgtccaacat gcagtgacca cttcatacaa caactactcc 7081 ttaatggcga tggccacgca agctggagtg ttgtttggta tgggcaaagg gatgccattc 7141 tacgcatggg actttggagt cccgctgcta atgataggtt gctactcaca attaacaccc 7201 ctgaccctaa tagtggccat cattttgctc gtggcgcact acatgtactt gatcccaggg 7261 ctgcaggcag cagctgcgcg tgctgcccag aagagaacgg cagctggcat catgaagaac 7321 cctgttgtgg atggaatagt ggtgactgac attgacacaa tgacaattga cccccaagtg 7381 gagaaaaaga tgggacaggt gctactcata gcagtagccg tctccagcgc catactgtcg 7441 cggaccgcct gggggtgggg ggaggctggg gccctgatta cagccgcaac ttccactttg 7501 tgggaaggct ctccgaacaa gtactggaac tcctctacag ccacttcact gtgtaacatt 7561 tttaggggaa gttacttggc tggagcttct ctaatctaca cagtaacaag aaacgctggc 7621 ttggtcaaga gacgtggggg tggaacagga gagaccctgg gagagaaatg gaaggcccgc 7681 ttgaaccaga tgtcggccct ggagttctac tcctacaaaa agtcaggcat caccgaggtg 7741 tgcagagaag aggcccgccg cgccctcaag gacggtgtgg caacgggagg ccatgctgtg 7801 tcccgaggaa gtgcaaagct gagatggttg gtggagcggg gatacctgca gccctatgga 7861 aaggtcattg atcttggatg tggcagaggg ggctggagtt actacgccgc caccatccgc 7921 aaagttcaag aagtgaaagg atacacaaaa ggaggccctg gtcatgaaga acccgtgttg 7981 gtgcaaagct atgggtggaa catagtccgt ctcaagagtg gggtggacgt ctttcatatg 8041 gcggctgagc cgtgtgacac gttgctgtgt gacataggtg agtcatcatc tagtcctgaa 8101 gtggaagaag cacggacgct cagagtcctc tccatggtgg gggattggct tgaaaaaaga 8161 ccaggagcct tttgcataaa agtgttgtgc ccatacacca gcactatgat ggaaaccttg 8221 gagcgactgc agcgtaggta tgggggagga ctggtcagag tgccactctc ccgcaactct 8281 acacatgaga tgtactgggt ctctggagcg aaaagcaaca ccataaaaag tgtgtccacc 8341 acgagccagc tcctcttggg gcgcatggac gggcctagga ggccagtgaa atatgaggag 8401 gatgtgaatc tcggctctgg cacgcgggct gtggtaagct gcgctgaagc tcccaacatg 8461 aagatcattg gtgaccgcat tgaaaggatc cgcagtgagc acgcggaaac gtggttcttt 8521 gacgagaacc acccatatag gacatgggct taccatggaa gctatgaggc ccccacacaa 8581 gggtcagcgt cctctctaat aaacggggtt gtcaggctcc tgtcaaaacc ctgggatgtg 8641 gtgactggag tcacaggaat agccatgacc gacaccacac cgtatggtca gcaaagagtt 8701 ttcaaggaaa aagtggacac tagggtgcca gacccccaag aaggcactcg tcaggttatg 8761 agcatggtct cttcctggtt gtggaaagag ctaggcaaac acaaacggcc acgagtctgt 8821 accaaagaag agttcatcaa caaggttcgt agcaatgcag cattaggggc aatatttgaa 8881 gaggaaaaag agtggaagac tgcagtggag gctgtgaacg atccaaggtt ctgggctcta 8941 gtggacaagg aaagagagca ccacctgaga ggagagtgcc agagttgtgt gtacaacatg 9001 atgggaaaaa gagaaaagaa acaaggggaa tttggaaagg ccaagggcag ccgcgccatc 9061 tggtatatgt ggctaggggc tagatttcta gagttcgaag cccttggatt cttgaacgag 9121 gatcactgga tggggagaga gaactcagga ggtggtgttg aagggctggg attacaaaga 9181 ctcggatatg tcctagaaga gatgagtcgc ataccaggag gaaggatgta tgcagatgac 9241 actgctggct gggacacccg catcagcagg tttgatctgg agaatgaagc tctaatcacc 9301 aaccaaatgg agaaagggca cagggccttg gcactggcca taatcaagta cacataccaa 9361 aacaaagtgg taaaggtcct tagaccagct gaaaaaggga aaacagttat ggacattatt 9421 tcgagacaag accaaagggg gagcggacaa gttgtcactt acgctcttaa cacatttacc 9481 aacctagtgg tgcaactcat tcggaatatg gaggctgagg aagttctaga gatgcaagac 9541 ttgtggctgc tgcggaggtc agagaaagtg accaactggt tgcagagcaa cggatgggat 9601 aggctcaaac gaatggcagt cagtggagat gattgcgttg tgaagccaat tgatgatagg 9661 tttgcacatg ccctcaggtt cttgaatgat atgggaaaag ttaggaagga cacacaagag 9721 tggaaaccct caactggatg ggacaactgg gaagaagttc cgttttgctc ccaccacttc 9781 aacaagctcc atctcaagga cgggaggtcc attgtggttc cctgccgcca ccaagatgaa 9841 ctgattggcc gggcccgcgt ctctccaggg gcgggatgga gcatccggga gactgcttgc 9901 ctagcaaaat catatgcgca aatgtggcag ctcctttatt tccacagaag ggacctccga 9961 ctgatggcca atgccatttg ttcatctgtg ccagttgact gggttccaac tgggagaact 10021 acctggtcaa tccatggaaa gggagaatgg atgaccactg aagacatgct tgtggtgtgg 10081 aacagagtgt ggattgagga gaacgaccac atggaagaca agaccccagt tacgaaatgg 10141 acagacattc cctatttggg aaaaagggaa gacttgtggt gtggatctct catagggcac 10201 agaccgcgca ccacctgggc tgagaacatt aaaaacacag tcaacatggt gcgcaggatc 10261 ataggtgatg aagaaaagta catggactac ctatccaccc aagttcgcta cttgggtgaa 10321 gaagggtcta cacctggagt gctgtaagca ccaatcttaa tgttgtcagg cctgctagtc 10381 agccacagct tggggaaagc tgtgcagcct gtgacccccc caggagaagc tgggaaacca 10441 agcctatagt caggccgaga acgccatggc acggaagaag ccatgctgcc tgtgagcccc 10501 tcagaggaca ctgagtcaaa aaaccccacg cgcttggagg cgcaggatgg gaaaagaagg 10561 tggcgacctt ccccaccctt caatctgggg cctgaactgg agatcagctg tggatctcca 10621 gaagagggac tagtggttag aggag
-
Pregnant Zika case in Napa County California increases the US total to 12 HI ex-Brazil (baby delivered with severe microcephaly) IL ex-Honduras (miscarriage) IL ex-Haiti DC NY FL FL FL CA FL WA (baby delivered and negative for Zika) CA ex-Central America
-
Are Culex Mosquitoes Potential Vectors of the Zika Virus?Author: Kathy Keatley GarveyPublished on: March 2, 2016 Aedes aegypti seeking blood. (Photograph by James Gathany, Center for Disease Control Public Health Image Library.)Scientists throughout the world targeted the Zika virus, transmitted by the yellow fever mosquito, Aedes aegypti, at a major symposium today in Recife, Brazil, epicenter of the Zika virus outbreak. Native Brazilian Walter Leal, chemical ecologist and professor in the UC Davis Department of Molecular and Cellular Biology, is there. So is the mosquito. At the symposium today, Constancia Ayres, research coordinator of the Oswaldo Cruz Foundation (Centro de Pesquisa Aggeu Magalhaes/FIOCRUZ, considered one of the oldest and most prestigious scientific research institutes in South America), reported that the common southern house mosquito, Culex quinquefasciatus, may be a potential vector of the Zika virus. Studies in the Ayres lab confirmed that Culex quinquefasciatus infected with Zika (isolated from local patients) showed high transmission rate (as determined by virus replication in the salivary glands). Culex quinquefasciatus filled with blood. (Photo by Kathy Keatley Garvey)That raises all kinds of questions and concerns. "This is very important for us--California and both nations--because we haveCulex mosquitoes (vectors of West Nile virus), and so does Brazil," said Leal, whose UC Davis lab collaborates with the Ayres lab. Of course, these studies were done in the lab, not the field, and this is the beginning of the research. We asked medical entomologist William Reisen, editor of the Journal of Medical Entomology, and professor emeritus, Department of Pathology, Microbiology and Immunology, UC Davis School of Veterinary Medicine, about this. "In California less than 3 percent of the Culex including Cx. quinquefasciatus have been found to feed on humans, even in cities like Los Angeles, where humans are the most numerous host," Reisen said in an email. "Therefore, even if they are susceptible to infection, the probability of a female feeding on humans to acquire and then refeed on humans to transmit would be 0.03 x 0.03 = 0.0009 or a rare event indeed. That said, there are areas of the world where quinquefasciatus feeds predominantly on humans in domestic settings. (See his research paper, Host Selection Patterns of Some Pakistan Mosquitoes (U.S. National Library of Medicine, National Institutes of Health). In his research paper on Pakistan mosquitoes, Reisen mentions Culex pipiens fatigans, now known as Culex quinquefasciatus. Its feeding patterns "varied opportunistically with host availability," he wrote in the abstract. Resting in cattle sheds during the winter, it "fed on birds and bovids, changing to man and bovids during the spring and then to man and birds during summer." Medical entomologist Thomas Scott, distinguished professor of entomology (now emeritus) of the UC Davis Department of Entomology and Nematology, is a global authority on Aedes aegypti, which transmits dengue, yellow fever, chikungunya and the Zika viruses. "Vector competence studies in the lab is valuable information, but before we come to the conclusion that Culex quinquefasciatus is an important contributor to transmission of Zika virus, the lab results would need to be confirmed," Scott told us. "Other laboratories and appropriate field studies would need to be carried out in areas where Zika virus is being transmitted to confirm that this species is naturally infected and is regularly biting people. Although it is a potentially important discovery that would change they way we think about Zika virus transmission, it would be wise to carefully explore all of the details necessary to incriminate a mosquito vector before coming to a strong conclusion." An article by Priscilla Moraes of Rio de Janeiro in the Jan. 27, 2016 edition of the Telegraph News, London, touched on whether Culex can transmit the Zika virus. "Brazil could be facing a greater fight against the zika virus than previously feared as researchers investigate whether the common mosquito is transmitting the disease," Moraes wrote in the article, headlined "Brazilian Experts Investigate if 'Common Mosquito' is Transmitting Zika Virus." "The Aedes aegypti species of mosquito was thought to be solely responsible for spreading the virus," Moraes pointed out. "But scientists are now studying whether the Culex mosquito--the variety (species) most commonly found in Brazil--could also be passing on the infection." Constancia Ayres was quoted as saying: "This may be the reason for the virus replicating faster. The interaction of the mosquito with the virus may explain the epidemiological profile of disease transmission.” Meanwhile, the headlines continue as research proceeds. The Outbreak News Today related that researchers in the Ayres lab "are now investigating the possibility that other, non-Aedes mosquito species, might carry and spread Zika and Chikungunya." "The concern is that the Culex mosquito--which is 20 times more prevalent than the Aedes variety in Brazil-- might also play some role in the rapid spread of these viruses," Outbreak News Todaynoted. "Researchers hope to have some answers in a few weeks," Valor.com.br is hot on the story as well. Reporter Marina Hawk emphasized that the work was done in the lab, but field collection is underway. UC Davis chemical ecologist and mosquito researcher Walter Leal (front), is attending the Zika conference in Recife, Brazil. In this image, taken March 2, he confers with mosquito researchers Constancia Ayres (far right, in black) and Rosângela Barbosa (center) of the Ayres lab. The Leal lab collaborates with the Ayres lab.Tags: Aedes aegypti (9), Constancia Ayres (0), culex (1), Rosângela Barbosa(0), UC Davis (75), Walter Leal (36), zika virus (0)Comments: 0 http://ucanr.edu/blogs/blogcore/postdetail.cfm?postnum=20369
-
02/03/2016 17h36 - Updated 03/02/2016 17h36 Fiocruz research shows virus zika in salivary gland stiltStill can not confirm that the common mosquito transmits the disease. The end result of the research will be known within eight months. G1 PE FACEBOOKResearcher Constance Ayres studying transmission zika by stilt (Photo: Bruno Marinho / G1)The ease of spread of zika virus in Culex mosquitoes infected in the laboratory was confirmed on Wednesday (2) by the researcher Constance Ayres, of vector design of the Oswaldo Cruz Foundation institution ( Fiocruz ) in Pernambuco . "This means that, in the laboratory, the virus managed to escape some barriers in the mosquito and reached the salivary gland," the researcher explained. The Culex is the common mosquito, popularly known as muriçoca or stilt. During the second day of the workshop A, B, C, D, E Zika virus, held in Recife , the biologist presented the preliminary results of research showing the spread of the virus to the mosquito 'ssalivary gland, where happen to transmission disease to humans. After performing three infections in 200 Culex mosquitoes (the first two in December last year and the third in February), research shows the vector competence of mosquito in the laboratory. ZIKAVirus is a global concernunderstand the viruszika and microcephalywhat is already knowndiscoverymyths and truthsaffected countriesThe survey results are still partial, it is still not possible to say whether the mosquito is capable of transmitting the virus to zika people. "To complete this, lack identify in the field the species of mosquito infected with the virus zika," says the biologist. What researchers know is that we need to further study and see if common mosquitoes found in areas where the virus circulates, are contaminated. According to Constance Ayres, the next step of the research is to analyze the field of material being collected."In the houses and where happen zika case records are being collected mosquitoes of two species (Aedes aegypti and Culex). We bring this material to the laboratory and do molecular tests to detect the virus in these species. A large number of samples having done, we can get an idea if the Aedes is the unique vector, if there are other vectors and the importance of each in the role of transmission, "he says. It will take 6-8 months for the search come to a conclusion. "It will probably take a while to have the end result. The ideal is to analyze the largest possible number of mosquitoes around 10 thousand, to get an idea of the dispersion, compare different neighborhoods and see if it coincides with the cases of microcephaly zika and disease, "he added. http://g1.globo.com/pernambuco/noticia/2016/03/pesquisa-da-fiocruz-mostra-virus-da-zika-em-glandula-salivar-do-pernilongo.html
-
Brazilian experts investigate if 'common mosquito' is transmitting zika virusBrazil would face an even greater struggle against zika If the common "culex" mosquito is passing on the virus 260 0 8 268 Email A common 'culex' mosquito Photo: Alamy By Priscilla Moraes, Rio de Janeiro 5:13PM GMT 27 Jan 2016 Brazil could be facing a greater fight against the zika virus than previously feared as researchers investigate whether the common mosquito is transmitting the disease. ADVERTISING The Aedes aegypti species of mosquito was thought to be solely responsible for spreading the virus. But scientists are now studying whether the “culex” mosquito – the variety most commonly found in Brazil - could also be passing on the infection. "This may be the reason for the virus replicating faster,” said Constancia Ayres, the research coordinator of the Oswaldo Cruz Foundation. “The interaction of the mosquito with the virus may explain the epidemiological profile of disease transmission.” Local workers disinfect the Sambadrome in Rio de Janeiro, Brazil Photo: EPA/MARECELO SAYAO The study is expected to last three weeks and aims to understand precisely how quickly the epidemic is spreading. Mrs Ayres pointed out that the culex mosquito “transmits other viruses close to zika” and asked: “What's to say that it could not transmit Zika?" The disease caused by the zika virus is linked to a large number of cases of cranial malformations in babies, especially in north-eastern Brazil, known as microcephaly. A government report revealed more than 4,000 suspected cases where babies have been born with a brain deformity since last year. President Dilma Rousseff of Brazil promised that her government would wage war against the mosquitos responsible for spreading the virus. The Zika virus is thought to cause microcephaly, a condition that leads to exceptionally small infant head size "The best vaccine against the zika virus is every one of us fighting: government and society,” she said. “The more standing water, the more the mosquito breeds. So we cannot let them be born. It will be a fight house-to-house and the government will make a serious commitment to that.” In Brazil, the authorities are expected to announce more help for low-income families with babies born with malformations. They will receive a minimum salary per month to help provide necessary care to children with microcephaly. • Zika virus outbreak spreads across South and Central America, in pictures The government plans to distribute insect repellent to all pregnant women who already receive the state’s “Bolsa Familia” family allowance. The zika virus has already spread elsewhere in South America. Switzerland and Denmark have become the latest European countries to report infections among their citizens returning from the continent. One Swiss national was infected in Colombia; another caught the virus as far away from Brazil as Haiti. Only pregnant women generally require hospital treatment for the disease, which poses the greatest threat to unborn children. So far, five cases have been confirmed in Britain, all among people who had travelled in South America. Five people have also been recorded with the virus in Portugal, which has the greatest number of European travellers to Brazil. President Barack Obama was briefed on the situation on Tuesday by scientists from the US Centre for Disease Control. The White House said that Mr Obama “emphasised the need to accelerate research efforts to make available better diagnostic tests, to develop vaccines and therapeutics, and to ensure that all Americans have information about the zika virus”. There is no vaccine or specific cure for zika, which has symptoms similar to influenza and often causes a rash. http://www.telegraph.co.uk/news/worldnews/southamerica/brazil/12125647/Brazilian-experts-investigate-if-common-mosquito-is-transmitting-zika-virus.html
-
Zika Scientists are investigating the possibility of transmitting viruses muriçocaResearch has identified the presence of virus in salivary gland specimens Culex quinquefasciatus Published on 02/03/2016 at 20h35 Hypothesis that the mosquito Aedes aegypti is not the only virus zika vector is stronger than everBobby Fabisak / JC Picturecinthya Milk It is stronger the hypothesis that the mosquito Aedes aegypti is not the only vector zika virus, which already can be spread in about 40 countries. Preliminary results of a study conducted by Fiocruz Pernambuco suggest that Culex quinquefasciatus (popularly known as muriçoca), which lays its eggs in breeding polluted, it is probably a potential zika vector. The study, led by biologist Constancia Ayres Lopes, could detect the presence of zika in high viral load in the salivary gland of Culex after holding three infections in the laboratory at about 200 mosquitoes. http://jconline.ne10.uol.com.br/canal/cidades/geral/noticia/2016/03/02/zika-cientistas-investigam-possibilidade-de-muricoca-transmitir-virus-224021.php
-
Zika virus are the common mosquito in BrazilBrazilian public laboratory researchers Oswaldo Cruz Foundation (Fiocruz) made the discovery.2 0 comments RELATED NEWS In the last week, rose 30% cases zika 'Zika can trigger Guillain-Barre syndrome' 4 deaths recorded first by chikungunya in Mexico Michoacan records first death from influenza AH1N1EDITOR RECOMMENDSRaul Cervantes a PRI with disreputableGermán Martínez, policy making CalderonPresent initiative to 'lock step' to friends in courtManlio is said against party-politicizing the Supreme CourtSenator Cervantes¿Party-politicizing the Court?(Taken from Twitter)(Taken from Twitter)(Taken from Twitter) EDITORIAL | WORLD | 02/03/2016 17:07:00In the salivary glands of the common mosquito or mosquito (Culex) he found the virus zika, indicating that this species may also transmit the disease , according to a group of Brazilian researchers. Brazilian public laboratory researchers Oswaldo Cruz Foundation (Fiocruz) made the discovery, which was announced during a seminar on the zika in Recfe state capital of Pernambuco, a region that has been most affected by the virus in Brazil. The experiment was conducted in the laboratory, with about 200 Culex mosquitoes, the biologist Constância Ayres said, but cautioned that these results are not conclusive, so you can not say that this species can infect humans. "There is a great likelihood" that the common mosquito transmitted virus zika humans, in the same way that also infects other arboviruses, Ayres said. Mosquitoes that have been used for research Fiocruz are being caught in their natural habitat in areas affected by the virus, in order to identify whether the Culex carries the virus. This research will last six to eight months before finding a final result, said the biologist. Until now had been considered the mosquito Aedes aegypti was the main transmitter zika, and other viral diseases such as dengue and chikungunya. With information from El Universal. http://lasillarota.com/encuentran-virus-del-zika-en-mosquito-comun#.VteKJ_krKdt
-
March 2, 2016 Brazilian researchers analyzed the results indicating the presence of the Zika virus in the mosquito or common mosquito, which could mean that any species could spread the disease. A group of researchers in Brazil found Zika virus in the salivary glands of the mosquito or mosquito common, reported in the news Paola Rojas. This discovery is an indication that other species could spread the disease. It is clear that just about laboratory tests that should be valued. With information from Jaime Nuñez.
-
Zika virus found in the saliva of common (Culex) mosquito http://www.radioformula.com.mx/notas.asp?Idn=574953&idFC=2016
-
GOP Congressmen Question The Need For $2 Billion To Fight Zika VirusUpdated March 2, 20166:02 PM ETPublished March 2, 20165:48 PM ETRAE ELLEN BICHELLA microbiologist sorts mosquitoes collected in Hutchins, Texas, to test for Zika virus. LM Otero/APRepublican representatives continue to question the need for about $2 billion in emergency funding requested by the Obama administration to respond to the Zika virus. Congressmen including Dr. Michael Burgess, R-Texas, asked in a hearing of an Energy and Commerce subcommittee Wednesday whether funds earmarked for combating the Ebola virus couldn't be transferred to the fight against Zika virus. But federal health officials said there's only $9 million left of the original $238 million in funding the National Institutes of Health received for Ebola virus research. "We don't have any really substantial money that's left on Ebola," saidDr. Anthony Fauci, director of the National Institute of Allergy and Infectious Diseases. Taking that money away could cripple the effort to develop an Ebola vaccine and to continue studies on thousands of survivors in West Africa. "Ebola is not over," said Dr. Tom Frieden, director of the Centers for Disease Control and Prevention. "As of today, 84 CDC top staff are in West Africa responding to the Ebola outbreak. Last month, labs in West Africa tested approximately 10,000 samples for Ebola. It was only in January that we had the most recent Ebola case in Sierra Leone. So we're still actively responding and tracking." Still, some remain skeptical of the need for emergency supplemental funding. "You're asking us for more money and you're saying it's an emergency. I might believe you more that it's an emergency if you would be willing to say, 'And we really don't want you to go down there,' " said Burgess, referring to the fact that the CDC has not told travelers to avoid countries with Zika transmission. At this point, the CDC recommends that women who are pregnant or who could become pregnant limit travel to places with ongoing virus transmission. "We need to give people information and allow them to make the choices," said Frieden. The concern is primarily for developing fetuses. In most adults, the virus is brief and mild. Based on other research on similar viruses, one scientist said, a woman would likely only have to wait four weeks after having the virus to conceive a baby without worrying about the potential effects of Zika on the fetus. "It's about the only good news here," said Dr. Jeanne Sheffield, director of the Division of Maternal-Fetal Medicine, Johns Hopkins University School of Medicine. In Florida, where the mosquito that transmits the virus is abundant, one company is gearing up to test genetically engineered mosquitoes. When these genetically engineered mosquitoes mate with wild mosquitoes, the resulting offspring can't reproduce. Fewer Aedes aegypti mosquitoes means less chance for Zika to spread. Dr. Luciana Borio, acting chief scientist at the Food and Drug Administration, told the subcommittee that a British company, Oxitec, has done extensive field testing of the mosquitoes in Brazil, the Cayman Islands, Panama and Malaysia. They're now preparing for a test in Key Haven, Fla. "What we don't know right now is where the public stands," Borio said. "So, what I can tell you right now is we are prepared to move very quickly on this." As Shots has reported, despite aggressive efforts at mosquito control, which do not yet include genetically engineered insects, the Florida Keys Mosquito Control District has only been able to halve its population of Aedes aegypti. "The data seems to be promising in terms of reducing the mosquito populations in those small field trials and we are greatly expediting the process," Borio said. The trial in Florida can only start after a period of public comment on the potential environmental impact of releasing genetically modified mosquitoes. After the test, Oxitec would then need to get FDA approval for further use. http://www.npr.org/sections/health-shots/2016/03/02/468936361/gop-congressmen-question-the-need-for-2-billion-to-fight-zika-virus?utm_source=twitter.com&utm_campaign=health&utm_medium=social&utm_term=nprnews
-
Zika case confirmed in Fort Bend CountyKHOU Staff, KHOU.com4:46 p.m. CST March 2, 2016(Photo: KHOU) CONNECTTWEET 1LINKEDINCOMMENTEMAILMOREFORT BEND COUNTY – Health officials here confirmed one case of the Zika virus. The patient was diagnosed Tuesday, officials with the Fort Bend County Health Department said. Officials didn’t give any details on the patient or what country he or she might have traveled to. Another Zika case was confirmed in the Houston area Monday. Four patients in both Houston and Harris County have tested positive for the virus. http://www.khou.com/story/news/health/2016/03/02/zika-case-confirmed-fort-bend-county/81234638/
-
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU