Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. MEXICO CITY Mexico has 80 confirmed cases of Zika virus infection cases , transmitted by the mosquito Aedes aegypti, and six of them are pregnant women , reported the Ministry of Health.The majority of cases were recorded in two entities South Chiapas and Oaxaca, with 45 and 25 people respectively, said the General Directorate of Epidemiology of the Ministry of Health in a statement. in the case of pregnant women , four were recorded in Chiapas, one in Oaxaca and one in the Veracruz state. The report includes indigenous cases confirmed until 12 February. The World Health Organization (WHO) declared the Zika virus as a global health emergency and considered that could affect up to four million people in America. The virus has been linked to an increase in birth defects in Brazil, the most affected country in the region, although no concrete evidence has been found.
  2. Mexico reported 80 cases of Zika, including six pregnant: SSAMost cases occur in Chiapas and Oaxaca, with 45 and 25, respectively; cases of pregnant women, 4 are recorded in Chiapas, one in Oaxaca and one in Veracruz, according to the Directorate General of Epidemiology, SSA.Reuters 8:17 a.m. Last updated 8:18 a.m.http://www.elfinanciero.com.mx/nacional/mexico-reporta-80-casos-de-zika-incluidas-seis-embarazadas-ssa.html
  3. http://rense.gsradio.net:8080/rense/special/rense_021516_hr2.mp3
  4. Map update https://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kT4qLMXp3SLU&hl=en
  5. Feb. 15, 2016 SURGEON GENERAL DR. JOHN ARMSTRONG'S DAILY ZIKA UPDATE: ONE NEW CASE CONFIRMED IN BROWARD COUNTY Contact:Communications [email protected](850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, State Surgeon General and Secretary of Health Dr. John Armstrong will issue a Zika virus update each week day at 2 p.m. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. As of today, one new Zika case has been confirmed in Broward County. County Number of Cases (all travel related) Alachua 1 Broward 4 Hillsborough 3 Lee 3 Miami-Dade 7 Osceola 1 Santa Rosa 1 St. Johns 1 Total 21 Last week, Governor Rick Scott directed State Surgeon General Dr. John Armstrong to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 274 callers since Friday. The number for the Zika Virus Information Hotline is 1-855-622-6735. All cases are travel-associated. There have been no locally-acquired cases of Zika in Florida. None of the confirmed cases involve pregnant women. For more information on the Zika virus, click here. State Surgeon General and Secretary of Health Dr. John Armstrong urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. More Information on DOH action on Zika: On Feb. 3, Governor Scott directed State Surgeon General and Secretary of Health Dr. John Armstrong to issue a Declaration of Public Health Emergency for the counties of residents with travel-associated cases of Zika.The Declaration currently includes the eight effected counties – Alachua, Broward, Hillsborough, Lee, Miami-Dade, Osceola, Santa Rosa and St. Johns – and will be updated as needed. According to the CDC, Zika illness is generally mild with a rash, fever and joint pain. CDC researchers are examining a possible link between the virus and harm to unborn babies exposed during pregnancy.DOH has a robust mosquito-borne illness surveillance system and is working with the CDC, the Florida Department of Agriculture and Consumer Services and local county mosquito control boards to ensure that the proper precautions are being taken to protect Florida residents and visitors.DOH encourages Florida residents and visitors to protect themselves from all mosquito-borne illnesses by draining standing water; covering their skin with repellent and clothing; and covering windows with screens.Florida currently has the capacity to test 5,039 people for active Zika virus and 1,402 for Zika antibodies.For more information on Zika virus, click here.About the Florida Department of Health The department works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  6. http://www.floridahealth.gov/_documents/newsroom/press-releases/2016/02/021516-zika-update-8.pdf County Number of Cases (all travel related) Alachua 1 Broward 4 Hillsborough 3 Lee 3 Miami-Dade 7 Osceola 1 Santa Rosa 1 St. Johns 1 Total 21
  7. WHO advice: conventional and newer tools for mosquito controlWHO has issued advice on mosquito control as part of the response to Zika virus disease. As noted, well-implemented mosquito control can effectively reduce the transmission of mosquito-borne viruses, including Zika. However, mosquito control is complex, costly, and blunted by the spread of insecticide resistance. Few developing countries outside sub-Saharan Africa have dedicated well-funded programmes for mosquito control. Moreover, some control measures are not readily accepted by the public. Integrated approaches that tackle all life stages of the mosquito and fully engage communities are recommended. Although fogging to kill adult mosquitoes provides the most visible evidence that a government is taking action, WHO stresses that the elimination of mosquito breeding sites is the most effective intervention for protecting populations. Fogging, which is recommended for emergency situations only, is most effective when conducted in the hours around dawn and dusk, when mosquito activity is most intense. Measures for personal protection against mosquito bites, including repellents that are safe for use during pregnancy, are also covered. Given the seriousness of the dengue and now the Zika crises and the need for a broader range of control techniques, a WHO Vector Control Advisory Group has evaluated some newer tools, including a genetically modified prototype mosquito submitted for WHO review. For genetically modified mosquitoes, the WHO Advisory Group has recommended further field trials and risk assessment to evaluate the impact of this new tool on disease transmission. Trials previously conducted in the Cayman Islands showed significant reductions in the Ae. aegypti population. Another technique being developed involves the mass release of male insects that have been sterilized by low doses of radiation. When sterile males mate, the female’s eggs are not viable, and the insect population dies out. The sterile insect technique has been successfully used, on a large scale, by the International Atomic Energy Agency and FAO to control agriculturally important insect pests. A promising biological method of control uses male mosquitoes carrying the naturally occurring Wolbachia bacteria, which are found in 60% of common insects, including butterflies and fruit flies. These bacteria do not infect humans or other mammals. When females mate with males carrying the bacteria, the eggs do not hatch, thus suppressing mosquito populations. Another strain of Wolbachia under investigation establishes the bacteria in the mosquito population and reduces the mosquitoes’ ability to transmit dengue. The mosquitoes are not genetically modified as the technique involves no tampering with or modifications of genes. Mosquitoes carrying Wolbachia bacteria have been released in several places, including Australia, Brazil, Indonesia, and Viet Nam as part of control strategies for dengue. Large-scale field trials of Wolbachia bacteria will be initiated soon. Some countries affected by Zika are using biological methods as part of an integrated approach to mosquito control. El Salvador, for example, with strong support from fishing communities, is introducing larvae-devouring fish into water storage containers. Given the magnitude of the Zika crisis, WHO encourages affected countries and their partners to boost the use of both old and new approaches to mosquito control as the most immediate line of defence.
  8. The rise and fall of mosquito controlAfter the discovery and effective use of residual insecticides in the 1940s, large-scale and systematic control programmes succeeded in bringing most of the important mosquito-borne diseases under control in many parts of the world. Aedes aegypti was virtually eliminated from the Americas. By the late 1960s, most mosquito-borne diseases were no longer considered to be major public health problems outside Africa. As so often happens in public health, when a health threat subsides, the control programme dies. Resources dwindled, control programmes collapsed, infrastructures dismantled, and fewer specialists were trained and deployed. The mosquitoes – and the diseases they transmit –roared back with a vengeance. They returned to an environment with few defences left intact. Nearly 2 decades of diminishing interest and dwindling expertise severely weakened national capacities to implement programmes for mosquito control. Previously successful control programmes were replaced by the reactive space spraying of insecticides during emergencies, a measure with high visibility and political appeal but low impact unless integrated with other control strategies. The weakness – sometimes disappearance – of control capacity coincided with trends, like accelerating population growth, rapid unplanned urbanization, and changes in patterns of land use, which made environments even more hospitable for flourishing Aedes aegypti populations. In addition, the arsenal of effective insecticides shrank as mosquitoes developed resistance. The consequences of this dramatic comeback are best illustrated by the recent history of dengue. Compared with the situation 50 years ago, the worldwide incidence of dengue has risen 30-fold. More countries are reporting their first outbreaks. More outbreaks are explosive in ways that severely disrupt societies and drain economies. The continuing increase in dengue outbreaks prompts some experts to ask: if countries cannot defend themselves against disruptive and recurring outbreaks of a well-known disease like dengue, what hope is there that mosquito control will help stop Zika?
  9. Females: aggressive biting and “sneak attacks”Aedes aegypti is an aggressive daytime biting mosquito. Only the females bite. Biting is most intense in the hours around dawn and dusk. Indoors, the mosquitoes can bite at night in well-lit homes. They are adept at hiding in closets and under beds. Adult mosquitoes of both sexes feed on sweet things, like nectar and fruit, but females need the protein in blood to develop their eggs. Over the years, females have evolved to show distinct preferences: for human blood over that from other mammals, for shady resting places, for stagnant as opposed to fresh water, and for small artificial containers as the best place to lay their eggs, with this last preference extending to dark-coloured containers as opposed to lighter-coloured ones. Females often use “sneak attacks”, approaching victims from behind and biting on ankles and elbows, which likely protects them from being noticed and getting slapped. Aedes aegypti females are so-called “sip feeders”. Instead of drawing sufficient blood for a meal in a single bite, they take multiple little sips during multiple bites, thus increasing the number of people a single mosquito carrying the virus can infect. After a blood meal, females produce an average batch of 100 to 200 eggs, depending on the size of the blood meal. Unlike most other mosquito species, a female Aedes aegypti can produce up to 5 batches of eggs during her lifetime. As yet another survival tactic, a single female lays her batches of eggs at several different sites. All of these features make Aedes aegypti populations extremely difficult to control. They also make the diseases they spread a much larger menace.
  10. Aedes aegypti: an “opportunistic” and tenacious menaceAedes aegypti is the principal mosquito species that transmits Zika, dengue, chikungunya, and yellow fever to humans. More than half of the world’s population lives in areas where this mosquito species is present. Experts describe Aedes aegypti as “opportunistic”, as it shows a remarkable ability to adapt to changing environments, especially those created by changes in the way humanity inhabits the planet. Over the years, it has exploited these opportunities, which include phenomenal increases in international travel and trade and rapid unplanned urbanization, with striking efficiency. Most ominously, Aedes aegyptimosquitoes, which long bred in water collected in tree holes and the axils of plant leaves in forests, have adapted to breed in urban areas, flourishing in impoverished crowded areas with no piped water and poorly collected garbage and trash. These adaptations classify the Aedes aegypti species as a “container breeder”. The mosquitoes can breed wherever rain collects or water is stored, with preference for outdoor breeding sites. Larvae have been found in a host of artificial containers, like discarded plastic cups and bottle caps, plates under potted plants, birdbaths, vases in cemeteries, and water bowls for pets. The mosquitoes can also breed in the microbial stew found in septic tanks, toilet tanks, and shower stalls. Construction sites, used tyres, and clogged rain gutters offer additional opportunities to breed in large numbers. Laid eggs can survive for very long periods of time in a dry state, often for more than a year. Once submerged in water, they hatch immediately. If temperatures are cool, mosquitoes can remain in the larval stage for months so long as the water supply is sufficient. The eggs are sticky, virtually gluing themselves to the insides of containers. International trade in used tyres is the best documented vehicle for introducing the mosquito to distant places.
  11. The possibility that a mosquito bite during pregnancy could be linked to severe birth defects in newborns has alarmed the public and astonished scientists. Detection of an upsurge in cases of microcephaly, associated in time and place with Zika virus circulation, has been accompanied by findings of additional congenital malformation of the brain, detected in fetuses (by ultrasound), stillbirths, and newborns, and evidence of damage to eyesight and hearing. For women of childbearing age living in or visiting affected countries, the prospect of giving birth to a baby with such severe defects is terrifying. The association of virus circulation with an increased detection of Guillain-Barré syndrome adds to the concern. GBS is an autoimmune disorder with various causes, including infections with some viruses and bacteria, most commonly Campylobacter jejuni. To date, an association between Zika virus circulation and an increased incidence of GBS has been reported in 8 countries: French Polynesia, Brazil, El Salvador, the French territory of Martinique, Colombia, Suriname, the Bolvarian Republic of Venezuela, and Honduras. In some of these countries, the fact that Zika is the only circulating flavivirus adds weight to this presumed association. Even in countries with advanced health systems, around 5% of patients with the syndrome die, despite immunotherapy. Many require treatment, including ventilatory support, in an intensive care unit, sometimes for months up to a year, adding to the burden on health services. If these presumed associations are confirmed, the human and social consequences for the over 30 countries with recently detected Zika outbreaks will be staggering. In the large outbreaks that affected some Pacific island nations, first in 2007 and again in 2013-2014, and then spread to the Americas, Zika virus has frequently co-circulated with dengue and chikungunya viruses. These viruses cross-react in diagnostic tests, making test results unreliable and putting better tests at the top of the list of most-needed new medical tools. Moreover the currently available PCR test can detect infection only during the period of illness when the virus is replicating, a weakness further compounded by the fact that 80% of infections cause no symptoms. Although at least 15 groups are working on Zika vaccines, WHO estimates that it will be at least 18 months before vaccines could be tested in large-scale trials. For all these reasons, WHO recommends stepped-up personal and population-wide measures for mosquito control as the best immediate line of defense.
  12. esEmergenciesMosquito control: can it stop Zika at source?Aedes aegypti, the principal mosquito species that transmits the Zika, dengue, and chikungunya viruses, has a number of breeding and behavioural quirks that make it extremely difficult to control.This article looks at conventional and new techniques for control and summarizes WHO guidance. http://www.who.int/emergencies/zika-virus/articles/mosquito-control/en/
  13. http://www.renseradio.com/listenlive.htm
  14. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds12291229100%0.0100%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds12291229100%0.0100%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome12231223100%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome12231223100%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds12231223100%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds12231223100%0.099%KJ776791.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1221122199%0.099%KJ873160.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds12191219100%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds12181218100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds12181218100%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome12181218100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds12181218100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds12181218100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds12181218100%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds12181218100%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds12141214100%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds12141214100%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds12141214100%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds12121212100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds12121212100%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds12121212100%0.099%KM078929.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds12011201100%0.099%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds11621162100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds11571157100%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1140114093%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds1022102299%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds92692677%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds89889877%0.098%KM851038.1
  15. LOCUS KU232288 665 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232288 VERSION KU232288.1 GI:987894975 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 665) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 665) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..665 /organism="Zika virus" /mol_type="genomic RNA" /isolate="001ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>665 /codon_start=3 /product="NS5 protein" /protein_id="AME17073.1" /db_xref="GI:987894976" /translation="LNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDT AGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDI ISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSN GWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPF CSH" ORIGIN 1 tcttgaacga ggatcactgg atggggagag agaactcagg aggtggtgtt gaagggctgg 61 gattacaaag actcggatat gtcctagaag agatgagtcg cataccagga ggaaggatgt 121 atgcagatga cactgctggc tgggacaccc gcatcagcag gtttgatctg gagaatgaag 181 ctctaatcac caaccaaatg gagaaagggc acagggcctt ggcattggcc ataatcaagt 241 acacatacca aaacaaagtg gtaaaggtcc ttagaccagc tgaaaaaggg aaaacagtta 301 tggacattat ttcgagacaa gaccaaaggg ggagcggaca agttgtcact tacgctctta 361 acacatttac caacctagtg gtgcaactca ttcggaatat ggaggctgag gaagttctag 421 agatgcaaga cttgtggctg ctgcggaggt cagagaaagt gaccaactgg ttgcagagca 481 acggatggga taggctcaaa cgaatggcag tcagtggaga tgattgcgtt gtgaagccaa 541 ttgatgatag gtttgcacat gccctcaggt tcttgaatga tatgggaaaa gttaggaagg 601 acacacaaga gtggaaaccc tcaactggat gggacaactg ggaagaagtt ccgttttgct 661 cccachttp://www.ncbi.nlm.nih.gov/nuccore/KU232288.1
  16. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds12251225100%0.0100%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds12251225100%0.0100%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome12191219100%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome12191219100%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds12191219100%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds12191219100%0.099%KJ776791.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1218121899%0.099%KJ873160.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds12161216100%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds12141214100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds12141214100%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome12141214100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds12141214100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds12141214100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds12141214100%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds12141214100%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds12101210100%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds12101210100%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds12101210100%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds12081208100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds12081208100%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds12081208100%0.099%KM078929.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds11971197100%0.099%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds11581158100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds11531153100%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1136113693%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds10201020100%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds92292277%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds89489477%0.098%KM851038.1
  17. LOCUS KU232289 663 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232289 VERSION KU232289.1 GI:987894977 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 663) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 663) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..663 /organism="Zika virus" /mol_type="genomic RNA" /isolate="020ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>663 /codon_start=3 /product="NS5 protein" /protein_id="AME17074.1" /db_xref="GI:987894978" /translation="LNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDT AGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDI ISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSN GWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPF CS" ORIGIN 1 tcttgaacga ggatcactgg atggggagag agaactcagg aggtggtgtt gaagggctgg 61 gattacaaag actcggatat gtcctagaag agatgagtcg cataccagga ggaaggatgt 121 atgcagatga cactgctggc tgggacaccc gcatcagcag gtttgatctg gagaatgaag 181 ctctaatcac caaccaaatg gagaaagggc acagggcctt ggcattggcc ataatcaagt 241 acacatacca aaacaaagtg gtaaaggtcc ttagaccagc tgaaaaaggg aaaacagtta 301 tggacattat ttcgagacaa gaccaaaggg ggagcggaca agttgtcact tacgctctta 361 acacatttac caacctagtg gtgcaactca ttcggaatat ggaggctgag gaagttctag 421 agatgcaaga cttgtggctg ctgcggaggt cagagaaagt gaccaactgg ttgcagagca 481 acggatggga taggctcaaa cgaatggcag tcagtggaga tgattgcgtt gtgaagccaa 541 ttgatgatag gtttgcacat gccctcaggt tcttgaatga tatgggaaaa gttaggaagg 601 acacacaaga gtggaaaccc tcaactggat gggacaactg ggaagaagtt ccgttttgct 661 ccchttp://www.ncbi.nlm.nih.gov/nuccore/KU232289.1
  18. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds1264126499%0.099%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1264126499%0.099%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1258125899%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1258125899%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds1258125899%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1258125899%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds1254125499%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1253125399%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1253125399%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1253125399%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1253125399%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1253125399%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1253125399%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds1253125399%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds1249124999%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds1249124999%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds1249124999%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1247124799%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1247124799%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds1247124799%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1240124098%0.099%KJ873160.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds1236123699%0.099%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds1197119799%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1192119299%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1158115892%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds1053105399%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds94494476%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds91391376%0.098%KM851038.1
  19. LOCUS KU232290 688 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232290 VERSION KU232290.1 GI:987894979 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 688) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 688) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..688 /organism="Zika virus" /mol_type="genomic RNA" /isolate="036ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>688 /codon_start=3 /product="NS5 protein" /protein_id="AME17075.1" /db_xref="GI:987894980" /translation="LGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYA DDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTV MDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWL QSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEE VPFCSHHFNK" ORIGIN 1 cccttggatt cttgaacgag gatcactgga tggggagaga gaactcagga ggtggtgttg 61 aagggctggg attacaaaga ctcggatatg tcctagaaga gatgagtcgc ataccaggag 121 gaaggatgta tgcagatgac actgctggct gggacacccg catcagcagg tttgatctgg 181 agaatgaagc tctaatcacc aaccaaatgg agaaagggca cagggccttg gcattggcca 241 taatcaagta cacataccaa aacaaagtgg taaaggtcct tagaccagct gaaaaaggga 301 aaacagttat ggacattatt tcgagacaag accaaagggg gagcggacaa gttgtcactt 361 acgctcttaa cacatttacc aacctagtgg tgcaactcat tcggaatatg gaggctgagg 421 aagttctaga gatgcaagac ttgtggctgc tgcggaggtc agagaaagtg accaactggt 481 tgcagagcaa cggatgggat aggctcaaac gaatggcagt cagtggagat gattgcgttg 541 tgaagccaat tgatgatagg tttgcacatg ccctcaggtt cttgaatgat atgggaaaag 601 ttaggaagga cacacaagag tggaaaccct caactggatg ggacaactgg gaagaagttc 661 cgttttgctc ccaccatttc aacaagca
  20. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds12161216100%0.099%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds12161216100%0.099%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome12101210100%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome12101210100%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds12101210100%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds12101210100%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds12061206100%0.099%KM078961.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1206120699%0.099%KJ873160.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds12051205100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds12051205100%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome12051205100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds12051205100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds12051205100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds12051205100%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds12051205100%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds12011201100%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds12011201100%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds12011201100%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds11991199100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds11991199100%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds11991199100%0.099%KM078929.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds11881188100%0.099%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds11491149100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds11441144100%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1131113193%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds1007100799%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds92292277%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds89489477%0.098%KM851038.1
  21. Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cdsGenBank: KU232291.1 FASTA Graphics Go to:LOCUS KU232291 667 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232291 VERSION KU232291.1 GI:987894981 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 667) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 667) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..667 /organism="Zika virus" /mol_type="genomic RNA" /isolate="051ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>667 /codon_start=1 /product="NS5 protein" /protein_id="AME17076.1" /db_xref="GI:987894982" /translation="FLNEDHWMGRENSGGGVEGLGLQKLGYVLEEMSRIPGGRMYADD TAGWDTRISRFDLENEALVTNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMD IISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQS NGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVP FCSH" ORIGIN 1 ttcttgaacg aggatcactg gatgggaaga gagaactcag gaggtggtgt tgaagggctg 61 ggattacaaa aactcggata tgtcctagaa gagatgagtc gcataccagg aggaaggatg 121 tatgcagatg acactgctgg ctgggacacc cgcatcagca ggtttgatct ggagaatgaa 181 gctctagtca ccaaccaaat ggagaaaggg cacagggcct tggcattggc cataatcaag 241 tacacatacc aaaacaaagt ggtaaaggtc cttagaccag ctgaaaaagg gaaaacagtt 301 atggacatta tttcgagaca agaccaaagg gggagcggac aagttgtcac ttacgctctt 361 aacacattta ccaacctagt ggtgcaactc attcggaata tggaggctga ggaagttcta 421 gagatgcaag acttgtggct gctgcggagg tcagagaaag tgaccaactg gttgcagagc 481 aacggatggg ataggctcaa acgaatggca gtcagtggag atgattgcgt tgtgaagcca 541 attgatgata ggtttgcaca tgccctcagg ttcttgaatg atatgggaaa agttaggaag 601 gacacacaag agtggaaacc ctcaactgga tgggacaact gggaagaagt tccgttttgc 661 tcccacc
  22. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds1251125199%0.099%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1251125199%0.099%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1245124599%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1245124599%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds1245124599%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1245124599%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds1242124299%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1240124099%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1240124099%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1240124099%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1240124099%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1240124099%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1240124099%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds1240124099%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds1236123699%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds1236123699%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds1236123699%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1234123499%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1234123499%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds1234123499%0.099%KM078929.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds1223122399%0.099%KF993678.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1219121997%0.099%KJ873160.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds1184118499%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1179117999%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1138113891%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds1044104499%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds92492475%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds89689675%0.098%KM851038.1
  23. LOCUS KU232292 682 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232292 VERSION KU232292.1 GI:987894983 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 682) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 682) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..682 /organism="Zika virus" /mol_type="genomic RNA" /isolate="054ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>682 /codon_start=3 /product="NS5 protein" /protein_id="AME17077.1" /db_xref="GI:987894984" /translation="EALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRM YADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGK TVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTN WLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNW EEVPFCSH" ORIGIN 1 ttgaagccct tggattcttg aacgaggatc actggatggg gagagagaac tcaggaggtg 61 gtgttgaagg gctgggatta caaagactcg gatatgtcct agaagagatg agtcgcatac 121 caggaggaag gatgtatgca gatgacactg ctggctggga cacccgcatc agcaggtttg 181 atctggagaa tgaagctcta atcaccaacc aaatggagaa agggcacagg gccttggcat 241 tggccataat caagtacaca taccaaaaca aagtggtaaa ggtccttaga ccagctgaaa 301 aagggaaaac agttatggac attatttcga gacaagacca aagggggagc ggacaagttg 361 tcacttacgc tcttaacaca tttaccaacc tagtggtgca actcattcgg aatatggagg 421 ctgaggaagt tctagagatg caagacttgt ggctgctgcg gaggtcagag aaagtgacca 481 actggttgca gagcaacgga tgggataggc tcaaacgaat ggcagtcagt ggagatgatt 541 gcgtcgtgaa gccaattgat gataggtttg cacatgccct caggttcttg aatgatatgg 601 gaaaagttag gaaggacaca caagagtgga aaccctcaac tggatgggac aactgggaag 661 aagttccgtt ttgctcccac ca
  24. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds1243124399%0.099%KU556802.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1243124399%0.099%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1238123899%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1238123899%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds1238123899%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1238123899%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds1234123499%0.099%KM078961.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1232123299%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1232123299%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1232123299%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1232123299%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1232123299%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1232123299%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds1232123299%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds1229122999%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds1229122999%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds1229122999%0.099%KM078933.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1227122799%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1227122799%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds1227122799%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1219121998%0.099%KJ873160.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds1216121699%0.099%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds1177117799%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1171117199%0.098%EU545988.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1138113891%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds1033103399%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds92492476%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds89689676%0.098%KM851038.
  25. LOCUS KU232293 679 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232293 VERSION KU232293.1 GI:987894985 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 679) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 679) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..679 /organism="Zika virus" /mol_type="genomic RNA" /isolate="057ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>679 /codon_start=3 /product="NS5 protein" /protein_id="AME17078.1" /db_xref="GI:987894986" /translation="LGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYA DDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTV MDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWL QSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEE VPFCSHH" ORIGIN 1 cccttggatt cttgaacgag gatcactgga tggggagaga gaactcagga ggtggtgttg 61 aagggctggg attacaaaga ctcggatatg tcctagaaga gatgagtcgc ataccaggag 121 gaaggatgta tgcagatgac actgctggct gggacacccg catcagcagg tttgatctgg 181 agaatgaagc cctaatcacc aaccaaatgg agaaagggca cagggccttg gcattggcca 241 taatcaagta cacataccaa aacaaagtgg taaaggtcct tagaccagct gaaaaaggga 301 aaacagttat ggacattatt tcgagacaag accaaagggg gagcggacaa gttgtcactt 361 acgctcttaa cacatttacc aacctagtgg tgcaactcat tcggaatatg gaggctgagg 421 aagttctaga gatgcaagac ttgtggctgc tgcggaggtc agagaaagtg accaactggt 481 tgcagagcaa cggatgggat aggctcaaac gaatggcagt cagtggagat gattgcgttg 541 tgaagccaat tgatgatagg tttgcacatg ccctcaggtt cttgaatgat atgggaaaag 601 ttaggaagga cacacaagag tggaaaccct caactggatg ggacaactgg gaagaagttc 661 cgttttgctc ccaccattt

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.