Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. Press Briefing TranscriptThursday, January 28, 2016. Please Note:This transcript is not edited and may contain errors. OPERATOR: Welcome, and thank you for standing by. At this time, all participants are in listen only mode. After the presentation, we'll conduct a question and answer session. To ask a question, please press the star and 1 and please record your name. Today’s conference is being recorded. If you have any objections, you may disconnect at this time. TOM SKINNER: We’ll be joined today by DR. Anne Schuchat, the Principal Deputy Director of the CDC and DR. Tony Fauci, Director of the National Institutes for Allergy and Infectious Diseases, both providing opening remarks about the current outbreak of Zika virus infection. We understand we are getting a lot of calls and a lot of interest in this story right now. We want to try to provide you all with as much information as we can, and so we're having this telebriefing. I’ll turn the call over now to Dr. Schuchat. DR. SCHUCHAT: Thank you so much, everyone, and thank you for joining the telebriefing. We’ll talk about what we know about the Zika virus, what we don't know, and what we're working hard to find out about. We know many people are concerned or scared, and we want to answer your questions with what we do know now. Zika is not a new virus, but what we are seeing in the Americas right now is new. Zika was first recognized in 1947, and it's caused occasional illness in Africa and Asia, but the first outbreak we know of occurred in 2007 in the small Pacific island Yap. Last May, the first local transmission of Zika in the Americas was reported by WHO in Brazil, and by the end of the year, Brazilian authorities estimated perhaps a million suspected cases of Zika occurred there. Substantial illness seems to have been occurring last spring, and by this fall, Brazil authorities recognized a concerning increase in the usually rare, serious condition among newborns, Microcephaly. Consistent with the idea that some of the mothers of these babies had been infected with the virus early in their pregnancy, potentially harming their developing baby. Zika is a mosquito-borne virus and causes mild illness. Unlike the virus, Dengue, causing life threatening disease or life threatening symptoms. About four or five people infected with Zika never have symptoms at all. Those who are sick have mild symptoms, fever, rash, joint pain, and red eyes or conjunctivitis. The symptoms last a couple days up to a week. It's very rare for a person with Zika to get seriously ill or die, but increasing lines of evidence suggest that some women who are infected with Zika during their pregnancy may go on to deliver a baby with a serious brain injury. Here is what we know. Brazilian health authorities initially reported more than 3500 cases of microcephaly, a serious birth defect in the past year following the Zika outbreak they experienced. Laboratory tests at CDC strongly suggest a link between Zika infection and some of the poor pregnancy outcomes. Brazil is continuing to verify findings on the birth defect. We don't yet know what other outcomes might be associated with Zika infection during pregnancy, and there may be other factors in addition to Zika infection that might have increased risk to the fetus. More lab testing and other studies are in progress to learn more about the results of -- sorry, about the risks of Zika virus infections during pregnancy. We understand this condition is devastating to the affected families, and that this ongoing outbreak is concerning to everyone, especially for pregnant women, their families who may travel or live in the infected areas. Zika virus spread in the Americas and its effect on pregnancy are new developments that we are working with partners to better understand. Health authorities in Brazil reported an increase in Guillain Barre syndrome, a rare neurologic disorder in which a person's own immune system damages nerve cells leading to nerve damage or paralysis that lasts for several weeks or several months. Most people fully recover, but it can take a few years to do so. CDC is currently working with public health officials in Brazil to investigate whether there's any link between Zika infection and Guillain Barre. Next, I want to turn to the epidemiologic situation. Zika cases are now confirmed in more than 20 countries within South and Central America and we've also seen a limited number of cases in the two U.S. territories, Puerto Rico and the U.S. Virgin Islands. The virus is spreading throughout the Americas and we expect more countries to be affected. All of the continental U.S. cases to date have been in people who traveled to a country where mosquitos carrying the Zika virus are circulating. We have not yet seen local transmission of Zika in the continental U.S., and by local transmission, we mean that a mosquito bites a person infected with Zika and that mosquito passes that infection on to another person through a mosquito bite. Zika is spread to people by the Aedes mosquito. They are common in parts of the United States, particularly southern states. It’s possible, even likely, that we will see limited Zika outbreaks in the U.S. The same kind of mosquito has caused limited U.S. outbreaks of Dengue and chikungunya virus, but no widespread outbreaks or epidemics in the continental U.S. as a result. Other factors work in our favor here. Our urban areas are not as densely populated as areas in central and South America, and we have widespread use of air-conditioning and stronger mosquito control. Our experience with Dengue and chikungunya and the different living conditions lead us to believe that any outbreaks of Zika in the continental U.S. will likely be limited. Of course this virus is fairly new to the Americas and we will remain vigilant. CDC experts are working intensively to learn more about the outbreak and providing people with the information they need to protect themselves. We issued travel alerts for the affected areas as confirmation of the virus comes in, and we'll keep you alert as the situation changes. We’ve provided guidance for doctors and other clinicians on pregnant women and infants including through our MMWR and additional clinician outreach efforts. Labs here at CDC are helping state health labs with diagnostic testing and provided training and materials for labs in Brazil and throughout the Latin American region. We’ve added Zika to the list of notifiable conditions so state health departments have to report to CDC so that we can track and respond to the spread of the illness, and we have a team on the ground in Brazil and are working with other international partners to learn more about this outbreak. We have two research partnerships one underway, and one is going to be starting soon. So we are doing a lot, but I do need to tell you, community mosquito control may be difficult. The methods that we have have shortcomings, and we have to work in the future to identify better options. However, for the general public, we want to make sure you know what you can do to protect yourself. If you are pregnant, we recommend you consider postponing travel to a region with ongoing Zika virus transmission. If you must travel to or you live in an affected area, talk to your doctor and strictly follow steps to prevent mosquito bites if you're pregnant. You can find more information on affected areas and on how to protect yourself on the CDC website. Reducing exposure to mosquitoes for anyone in areas where the virus is circulating is important. Wearing long sleeves, long pants, using repellents like Deet, which we think is safe to use in pregnancy, and other protections like screens and air-conditioning to reduce exposure to daytime mosquitoes. It’s important to remember that this is a rapidly changing situation. As we get new information, we may need to update our advice. At this stage in a relatively new health threat, information evolves quickly, and we expect that the situation will continue to change as we learn more. We are working very closely with colleagues in the infected areas as well as at home to get the information we need, and as we learn about the virus and health effects, we will share what we know so you have the information you need to protect yourself and your family. Now I want to turn things over to DR. Fauci. DR. FAUCI: Thank you very much. Good morning. Thank you, all, for joining us. Addressing the research efforts underway at the National Institutes of Health to combat Zika outbreak and its consequences. The NIH is working in industry to accelerate research in areas ranging from natural history of the disease, basic research on the virus itself, disease pathogens, diagnostics, vaccines, and therapeutics. Within NIH, we have long supported research on viruses and others, namely those viruses that are spread by mosquitoes, ticks, and other arthropods. The category included Dengue, West Nile, and chikungunya, all of which have emerged in the western hemisphere in the past few decades. With the emergence of the Zika virus, we are focusing efforts on several fronts into development of animal models and the virus on the body, especially in pregnancy. We are also supporting along with the CDC, the development of diagnostic platforms that can rapidly determine if a patient is infected with Zika or has been infected either recently or in the past, and distinguish it from other viruses, particularly Dengue infection. Such diagnostic tools will be critical to reassure the unaffected pregnant women in areas where Zika is occurring and pregnant women returning from such areas. At the same time, NIAID researchers are working on vaccine candidates to prevent Zika virus infection. It is to our advantage we already have existing vaccine platforms to use as a sort of jumping off point. NIAID is currently pursuing at least two approaches to a Zika vaccine. First, a DNA based vaccine using a strategy very similar to what we employed for another virus, the West Nile virus, as this vaccine was found in a phase one trial to be both safe and immunogenic, second, a live vaccine building on similar and highly immunogenic approaches used for the closely related Dengue virus. While these approaches are promising, it is important to understand we will not have a widely available safe and effective Zika vaccine this year and probably not in the next few years. Although, we may be able to begin an early phase one clinical trial actually within this calendar year. We need to look at Zika virus in its context as the latest in a series of mosquito-borne diseases that expanded their reach in the past 20 years or so. These include, as you heard, Dengue, West Nile virus just last year. There will be others. We need vaccine platforms that can be quickly modified for protection against emerging new threats and we need broad spectrum drugs effective against whole classes of viruses. This has been and will continue to be an important area of emphasis for NIAID. In the meantime, we have issued a call to the research community to highlight our interest in funding a number of vital areas of research that are specific to the current threat of Zika. In addition to accelerated research towards diagnostics, treatments, and vaccines, which I’ve already briefly discussed, we're calling for basic research to understand Zika virus infection; its replications, its pathogens and transmission, and we are developing animal models. We’re doing study on evolution and emergence of the virus including the identification of factors that affect host range and variance. Studies of the distribution and natural history in collaboration with the CDC will be done. Basic research on the mosquito vectors, competence studies for replications and transmission and host virus interactions as well as studies on novel vector control mechanisms. Also, a valuation of the immune response, both to infection and to vaccination as well as evaluating the relative immune responses to Zika and other viruses and to some extent yellow fever, and in addition, the interaction of the responses and impact on the disease itself. Clearly, there are very many important areas of scientific inquiry, and we at NIH are in constant communication with government, academia, and partners in the United States and internationally including our long term collaborators in Brazil and other South American countries. NIH is actively pursuing answers to the numerous scientific questions related to Zika infection, and we are sharing this information in real time, refining our avenues for accelerating research. Such findings in these endeavors inform the global health response. I want to thank you for the opportunity to speak with you today, and I would be very pleased to answer your questions. Thank you. TOM SKINNER: Kathy, I believe we are ready for questions. OPERATOR: Okay, thank you. At this time, we have a question and answer session. If you want to ask a question, press star 1 and record your name. We are taking questions only from the media at this time, and one question with one follow-up. Again, star 1 if you have a question. Our first question comes from Mike Stobbe at the associated press. MIKE STOBBE: Hi, thank you for taking my call. First, DR., you just talked about a call to the research community to highlight your interest. Could you tell me how much money NIH is going to be devoting to this and how much of it -- what you've been spending previously on Zika research, and then I have a follow-up. DR. FAUCI: Okay. That’s a good question. As you heard, as said, this is a brand new virus, so we, prior to this time, have not spent anything on Zika. however, we do have a substantial resource commitment to the virus class, so we spend about $97 million on the flavivirus research, and when you ask how much we're going to spend, it really depends on the kinds of requests coming in and the kinds of projects we're pursuing. So I can't put a number on it except to say we'll be utilizing the grantees and grants out there for the virus and immediately supplementing them. I imagine that this is going to require a considerable amount of resources, but right now, we're just going to fund what comes in with the money we have, and if additional money comes in, then we'll, I’m sure, utilize it well. We want the community to get actively involved, both with new ideas as well as tacking on to some of the other things we're doing with flavivirus. One of the things I’ll point out that we've actually already started in the intermural program with the vaccine research center, the cementer involved in the development of the Ebola vaccine and others, that we're using the same platforms that we used to develop the West Nile to already get started on making the material that we would get into GMP grade to be able to start reasonably soon this year on a phase one trial, so things are moving rapidly. MIKE STOBBE: Okay. Thank you. Doctor Schuchat, could you go over the latest numbers for the U.S.? How many cases, any pregnant women? How many gave birth, and the territories' numbers, Puerto Rico, the Virgin Islands, how many there, and how many believed to have been transmitted there versus acquired through travel? DR. SCHUCHAT: Thanks so much, Mike. The statistics for the U.S., first, let me talk about the travel-associated cases, there are 31 travel-associated cases detected in 11 states and the District of Columbia, from the period of 2015 to the present. And for the U.S. territories, there are 20 laboratory-confirmed cases that we are aware of, 19 from Puerto Rico, and one from the U.S. Virgin Islands. I think for the pregnancy numbers, we'll get back to you later, but that is based on what has come in. I would say that, you know, the issue of us making this nationally notifiable and laboratory testing for the lab confirmation with the PCR is just increasing, so we really do expect there to be a lot more travel-associated cases. The key thing for people to know and remember is that most of these are very mild illnesses. It’s really the circumstances of pregnant women who are traveling that we want to have heightened awareness of, and we really caution pregnant women to consider postponing travel. We hope to know more and give more guidance in the future, but there's the best recommendations right now. So, again, the issue for Puerto Rico and Virgin Islands is that that includes individuals who are laboratory confirmed. They may be locally acquired or have traveled, but that's been detected in two of the places. TOM SKINNER: next question, Kathy. OPERATOR: This is from Hellen Branswell with STAT News. HELLEN BRANSWELL: Thank you very much for the question. Before I ask it, I say that if you come up with numbers of U.S. cases that involve pregnant women, I’m interested in the numbers. Doctor, earlier, the CDC did some pretty important work on samples from Brazil, finding Zika virus in the brains of two babies who had microcephaly that died shortly after birth, and also in placenta tissues from women who miscarried fetuses with this. Are you testing additional samples from Brazil or elsewhere or found additional evidence? DR. SCHUCHAT: Thank you, Helen. Tthis is a really important issue, and what I can say is we're working very closely with Brazil and other affected countries, that we just had folks down in the area doing laboratory training so that better access to testing could be done close to where the action is, and we're working closely with the state health departments on laboratory testing. We did that initial MMWR when we had the lab findings. We thought that was very important information for the public to know about and are continuing to look at this. Now, a number of studies in Brazil are going to be looking at children with birth defects who were born quite a while ago, so testing will be challenging in those circumstances. I would just say this is a very active effort right now, and there's prospective studies recognizing the laboratory component of the conditions. TOM SKINNER: Helen, do you have a follow-up? HELEN BRANSWELL: I ask, are you saying that you currently don't have any additional cases that you could speak about in terms of finding viruses that would support this theory? DR. SCHUCHAT: I think we reported what we are able to report right now, but we can check back additional ones if those are able to be reported. I don't think we'll be surprised given the number of clinical episodes there's been and the extent of spread in the Americas for there to be additional confirmed cases in pregnant women. I think what we are really focusing in on more now is more detailed research understanding the factors that lead to increased risk of these condition, and, really, careful review of the clinical circumstances. Microcephaly is a complex condition, and the surveillance or detection of it is not examples, and so we are working in other areas as well. Putting together the clinical …. of such great concern and the laboratory findings is going to be a work in progress in the days and weeks ahead. TOM SKINNER: Next question, Kathy? OPERATOR: From Betsy McKay, Wall Street Journal. BETSY MCKAY: Thanks for taking my call. I have two questions. You mentioned a phase one clinical trial that may start later this year. could you clarify which vaccine approach that would be -- which one of the approaches you mentioned – I thought you said West Nile, but I was not sure, and then the second question for Dr. Schuchat or Dr. Fauci, I wanted to follow-up on what Helen asked about, you know, what's known about disease in pregnant women. Is there any way to know -- do you have findings showing whether pregnant women who are infected but don't get sick are at risk for their babies? Is there any way to know that at this point? BETSY MCKAY: Risk of microcephaly. DR. FAUCI: I was referring to the DNA construct in which we inserted a West Nile viral gene insert. That construct, when put into cells, makes virus-like particles. That is a study done that was done with West Nile and published in the Journal of Infectious Diseases in 2011, the first author, Julie Wedgewood, and saying modifying promoter produces neutralizing antibody in younger and older healthy adults in a phase one clinical trial. Since they are both flaviviruses and we can insert the mica gene insert, we feel we can get this construct reasonably soon ready to make enough to start going through the usual tox studies as well as getting into a phase one trial within the timeframe mentioned so there is a precedent for that. Now, the reason why the West Nile virus phase one did not turn into a vaccine approved, produced, and made widely available is we could not find pharmaceutical partners to partner with us to push it to the next stage of advanced development. I do not anticipate we'll have any problem partnering with pharmaceutical companies now because of the extraordinary attention and interest that is now put into Zika, and we're talking to companies to partner with us in advanced development. TOM SKINNER: do you have a follow-up? BETSY MCKAY: About the pregnancy. DR. SCHUCHAT: Yes, thanks. I’ll speak to that. Women who are infected with Zika virus without symptoms could have a baby with one of the birth defects. First thing to say is that we don't know for sure. We are working hard to find out. I would like to say that it's possible, and that there are other viral conditions that can do that. We’re taking it very seriously, and we know it's a difficult thing for women to hear. It’s one of the reasons that we've urged women who are pregnant to consider postponing travel to the affected areas. It is a possibility, but we don't have the strong evidence of how often it happens or what the risk is. TOM SKINNER: Next question, Kathy? OPERATOR: From Lisa Schnirring with CIDRAP News. LISA SCHNIRRING: Hey, thanks for the availability today. I’m wondering if anyone knows if you get infected with Zika, if that confers infection against possible infection in the future, and the question is during the WHO executive board briefing today, they mentioned a meeting in Washington to set research priorities, and I was wondering if that's something the U.S. government is involved in or maybe it's not. Thanks so much. DR. SCHUCHAT: Sure. I can begin. You know, based on what we know now, we do think that an infection with Zika virus will confer immunity. We don't actually know how long that'll last for. This is a fairly new virus in terms of what we understand of it, and so we try to keep an open mind. We also know that the tests for Zika are not as great as we'd like them to be in terms of availability or specificity, and so making sure that the -- that the immunity to Zika and not to something else takes additional testing. So based on what we know about the infection and immunity right now, we think it's likely that one is getting long term protection, but we just don't know how long it is and we caution everything with a new condition like this saying that we're keeping an open mind. TOM SKINNER: Dr. Fauci, do you want to talk about WHO and research priorities? DR. FAUCI: Yeah. There’s a number of meetings to take place over the next couple months in February over into March. Meetings from international collaborators getting together to get and compare the research agendas and trying to synergize on research. You’ll hear more of it. We have our own groups here in the department in which we look at the research agenda with the CDC, the FDA and other components of HHS, and also meeting within the U.S. government, but the U.S. Government will be participating in those international workshops that are going to be looking at a broad international research agenda. So the answer to the question is, yes, we know about it, and we will be participating. TOM SKINNER: Next question, Kathy. OPERATOR: All right. Next question comes from Sabrina Tavernise, the New York Times. SABRINA TAVERNISE: Hi, thanks for taking my question. I’m trying to piece together, the Brazilians had confusing numbers. They gave our reporter in Brazil the following numbers that only, like, six or seven of about 700 microcephaly cases analyzed had Zika or exposed to Zika. Is there a way to explain that or confusion? Leads one to the conclusion that, actually, there's little association to Zika and microcephaly. DR. SCHUCHAT: You know, thank you for the question. You know, what I can say at this point in an ongoing investigation, information is being gathered, and so the Brazilians are the best source on exactly what information they have right now. Remember, they are piecing together review of episodes that occurred quite a while ago. They are collecting specimens of those they find, may or may not have tested large numbers, and it's for us to decipher that, and there are many ways to study this kind of issue, and try to clarify how strong a risk factor of Zika virus infection would be for a pregnancy complication, and so both the experience the Brazilians have had and prospective studies are very important. CDC is working closely with Brazil and other countries and the rest of the community that works on birth defects day in and day out to try to really understand this. It’s a very difficult issue, really important, and I think we're going to have challenging information coming out over the weeks ahead until we can really clarify this situation. I’m sorry that I can't piece it out for you. SABRINA TAVERNISE: That’s okay. One follow-up. Could you speak directly to what the risk is for Americans in the United States? Everybody’s saying, oh, mosquitos are everywhere, and others say we have air-conditioners and window screens so the risk is low. Break it down into simple English. DR. FAUCI yes, are you referring to the risk now, for example, with mosquitos, as Ann said and should chime in, we don't have local transmission of the virus in the United States right now, so we are getting questions that are understandable. People are nervous saying I live here now and I was bit by a bunch of mosquitos. SABRINA TAVERNISE Exactly. What do you say? DR. FAUCI You say there's no risk at all because we don't have locally transmitted Zika virus in the United States. I mean, that's an understandable concern when they really read about the massive outbreak in South America and the Caribbean, and that's why Ann and I when I talked about this over the last week or so when we talk about it make sure we distinguish between a local transmission within a country and a traveler that just comes back and happens to have Zika infection. There’s a big difference there. SABRINA TAVERNISE Yeah. And what's the factors that are stopping local transmission? DR. SCHUCHAT: I can share about that. You know, we have the mosquito that carries the virus in the United States, and we have transmission of other mosquito borne infections in other areas of the southern united states, but we have not seen large outbreaks, and the factors going into that include the dense urban areas in south America or central America where some of the outbreaks have been described. The living conditions where we have most people with access to air-conditioning or screens versus a much more outdoor open air lifestyle, and then that density of population where it makes it easy for mosquitos to hop around between people. The level of mosquitos is more intense in some of the areas where mosquito control is not as strong as it is here, and so we do expect we are at risk for local transmission, and we're not surprised to report that. I do -- I don't want to give misconception here-- we're expecting there to be some local transmission, but based on the experience with the other mosquito borne viruses and those areas in the southern united states, we are not expecting really big difficult to control ones. That said, we're going to jump on this if we find local transmission and work closely with the local authorities to better control the problem. For the average American who is not traveling, this is not something they need to worry about. For people who are pregnant and considering travel to the affected areas, please, take this seriously. It's very important that you understand that we don't know as much as we want to know about this yet, and while we're learning more, it's prudent to consider postponing travel, and if you must travel, talk to your health care provider and protect yourself from mosquito bites. TOM SKINNER: Next question, Kathy. OPERATOR: Liz Szabo from USA today. LIZ SZABO: You mentioned that mosquito control could be difficult in the United States, and I was hoping you could elaborate on that. DR. SCHUCHAT: Yes. You know, we've done well in terms of some of the insect-borne diseases in the U.S., but controlling mosquitos, this type of mosquito is somewhat difficult. The current options have limited efficacy. They include elimination of breeding site, larva treatment, and outdoor spraying to kill adult mosquitos. These are pretty aggressive daytime biters, and so you don't need huge amounts of mosquitos to be able to have a mosquito infect a person, and it's really hard to knock them out totally, so I think our researchers feel that better vector control is a real important area to invest in in terms of research and strategies. You know, there's some innovative approaches looked at-- both different products, different attempts to do better vector mapping and ecological and where to intervene. There’s methods to monitor insecticide resistance and improve methods to minimize development of resistance. We think large scale intervention trials will be needed to understand the effectiveness of different approaches, but, you know, it's easy to say get rid of the mosquitos. It’s harder to do it. LIZ SZABO: Okay. Thanks. What about the prospect that sometimes mentioned about the genetically engineered sterile mosquitos? DR. SCHUCHAT: Yes. The idea of the genetically engineered sterile mosquitos is intriguing. At this point, it's unproven on a large scale, but it's a really exciting idea, and important to understand community acceptance and how to take on the research question in a larger scale. We’re gratified that individuals are looking into these innovative approaches, and we really encourage more of that because I think the mosquitos are probably going to outlive us, and it would be good for us to find better methods. LIZ SZABO: Okay. Thanks. TOM SKINNER: Next question, Kathy? OPERATOR All right. Our next question is from Eben Brown, Fox news. EBEN BROWN: Hi, good morning, and thank you for doing this. These questions, two of them, for either doctor that wishes to answer. First, we talked about mosquito control. Here I’m calling from south Florida. Mosquito control is a political situation meaning that we have -- we have elected officials who deal specifically with mosquito control and boards. What should towns think about doing? Second question, there was an article, I think, within the past week, suggesting that there was a case of sexually transmitted Zika virus between a husband and wife, husband traveled, may have gotten sick, wife who did not travel became sick. It was revealed that they were intimate upon his return. Could you comment on that, please, and is that really something we ought to be worried about, or is it too soon to tell? DR. SCHUCHAT: Thanks for those questions. Let me take them in reverse order. There is one reported case of Zika virus through possible sexual transmission. In another case, Zika virus was found in semen two weeks after a man had Zika virus infection. That gives you the plausibility of spread, but the science is clear to date that Zika virus is primarily transmitted to people through the bite of an infected mosquito. I don't know if an infected mosquito can transmit, but that's really where we put the emphasis right now. In terms of the local mosquito control issues, those are difficult issues. I think that communities need to understand what's known about the benefits and risks and work together with the authorities to understand what's going to be acceptable. I do think that there's a lot of innovation that we're excited about understanding, and we know that the Brazilians are very interested in exploring more effective approaches, but I think in terms of your local Florida situation, you know, the community discussions will be important to continue. EBEN BROWN Great, thank you. TOM SKINNER: Next question. OPERATOR: Question is from Caleb Hellerman, PBS News Hour. CALEB HELLERMAN: Hi, thank you. I’m just following up on a question of how many cases you're expecting to see, and, obviously, after this report, you'll get many more calls. Also, based on the range and the behavior of this mosquito in the Americas, and, of course, headed into warm weather. What do we know about the seasonality of the other related infections and when we might start to see large spikes in cases, and how do you think people should view the numbers that inevitably start to look big? DR. SCHUCHAT: Right. We do expect and believe the virus is widespread in south America in that we will have travelers infected with it coming back and detected, and part of that would be about how many of them present to get tested, and so there is some experience from the chikungunya virus, relatively new virus to the Americas, and it did occur among travelers, and we actually got large numbers of reported travelers, but in terms of local transmission, it was miniscule, you know, a handful of local transmission, whether it's been either virus. So I think we need to be prepared to have numbers of cases among travelers to go up quite a bit, but we don't think it's a concern for the average American. We think that's just going to be a sign of a good surveillance system, but we really think what's important is that pregnant women consider postponing travel to affected areas, and that in the areas where the mosquito can circulate like south Florida, that we have very active surveillance and detect conditions quickly so we can intervene as effectively as possible. So I think that, you know, we have a certain amount of comfort because we have been through the experience, but we also know this is a new virus to us, and we have to keep an open mind. DR. FAUCI: So let me add a brief comment to that because I’ve been asked a lot of questions about this. First of all, we always say as Ann reiterated a few times, and I totally agree, that a lot we don't know so we have to be very careful in making absolute predictions. We still feel based on prior experience that as Ann said, and I agree, it is unlikely we're going to see widespread joint outbreaks and be prepared for that. If that happens, that's not going to be an unexpected phenomena to see a limited cluster, very likely in the southeastern part of the country along the gulf coast and Florida the way we saw it with Dengue. The other thing that's important is that you see in several newspaper articles, they show the map of distribution of the southeastern part of the country and greater distribution of the other mosquito that may or may not be able to first timely transmit that. We don't know yet. Don’t make the assumption, then, that you'll see outbreak this that distribution of mosquitos. That’s just where they are. We are being prepared, and we're not going to be cavalier about it that it is being spread, but that is highly unlikely as we said multiple times. Be prepared for it, but that's not something that we expect to see based on the experience with the other viruses. DR. SCHUCHAT: And I think you also asked about the seasonality and, you know, based on the situation with the viruses in south America, the seasonality can vary by country and year so every year we can see big differences in, you know, how bad a year it is or not, so I think, again, with this being relatively new to the Americas, we'll be very interested in understanding seasonality, and that'll be important information for travelers to learn about, but we don't have that yet for this virus. TOM SKINNER: Next question, Kathy? OPERATOR: Next question comes from Lorna Benson of Minnesota Public Radio. LORNA BENSON: Thank you for taking my call. I’m wondering if there's any risk to the blood supply regarding blood donations, and then, secondly, I wonder if there is a difference in risk depending on -- for pregnant women, depending on what trimester they are in. Thank you. DR. SCHUCHAT: Thank you. The blood supply is of great interest, and I think I want to say that the FDA is looking at the issue of blood supply, donors, and travelers. One thing we know about Zika virus is it's in the bloodstream very briefly. It’s not, as far as we know, there for a long time, so that most people who cleared their bloodstream of the virus by about a week, so we think this is an issue the FDA deliberates about in terms of blood donors. The second question you had was about the trimesters, and, of course, these are questions we are keenly interested in having better answers for. We do believe that the injury of microcephaly begins in the first trimester, but we don't believe we have sufficient knowledge now to know what, if any effects infection in the second and third trimester would have. We know that there are other viruses like rubella that cause birth defects including hearing loss, vision loss, and heart defects, and, you know, even major brain damage. There are different effects at different times during pregnancy, so we really feel for the women pregnant living in the endemic areas and know it's a challenging time for them, and our scientists are working closely with counterparts to understand better. LORNA BENSON: Thank you. TOM SKINNER: Kathy, I know we have possibly a lot of questions and reporters in cue. Go to the next question, go for ten more minutes. Next question, please. OPERATOR: All right. Richard Knox, WBUR Boston. RICHARD KNOX: Thank you. A couple things, one having to do with Puerto Rico, which we know has enormous financial problems right now. I don't know whether that is going to interfere with the ability to have the response of this initially, but I wonder from the CDC, what is happening with regards to Puerto Rico being a challenge and what needs to happen. DR. SCHUCHAT: Thank you so much. You know, one of the CDC installations, our branch is based in Puerto Rico. We have 40 or so staff based there working very closely with the Puerto Rican health authorities and experts, so we are very closely linked in with the Puerto Rican health experts and community, working closely to assure surveillance is ongoing and to get information to the community. There’s the research rein surveillance efforts and building on that is exactly the right thing to do for the community there. They have good surveillance. They have great lab testing and good communication and expertise, and an ability, we hope, to really recognize how widespread it is and what interventions will be most effective, so I think this is a huge priority for us at the CDC and across the government. You know, these are Americans in Puerto Rico, and we're committed to be working closely to protect their health. RICHARD KNOX: Thank you. I just wondered do you have any worry about the ability to mount widespread mosquito abatement possibilities? I have another question, if I may. DR. SCHUCHAT: Yes. As I mentioned before, mosquito control is very difficult, and we are very keen to learn what works in this context to try to identify areas of the major transmission or major breeding grounds are. We know that the mosquito control is just one of the many interventions. We think it's really important for people to protect themselves because we might not be as successful in controlling the mosquito as we'd like. Again, that means long pants, long sleeves, use treated clothing, wearing Deet or similar repellant that's safe in pregnancy, safe for children up over two months of age, and under two months, there are ways to protect them through nets and so forth in terms of their bed and all that. It’s important for us to work closely in Puerto Rico with the community and that the mosquito control, while important, is not the only thing that we have to offer. TOM SKINNER: Next question. OPERATOR: From Dan Childs, ABC News. DAN CHILDS: Thank you very much for taking the question. The first question I had was from the doctor, a short one, do we happen to know the case count in travel associated Zika in each state? You mentioned 11 states, D.C., and then, also, for women who are not pregnant but plan to be down the line, do we know enough yet that the link to microcephaly is only seen in cases when the infection is still active or any association that the associated risk linger longer than the symptoms do? DR. SCHUCHAT: Okay. Thank you. We have not yet released the state by state counts. Think that's one of the things we'll expect to be doing at some regularity, so stay tuned for that, as I mentioned before, we are expecting a lot of travel associated cases, and so the numbers may not be that critical, but we are working with state colleagues to get the information out on a regular basis, but, probably not on a daily basis. Then the other question was about how long the infection might be active in a woman in potentially causing harm to her baby. We believe this is a time limited infection in women and men and children that people have symptoms up to a week, and so we don't think this is one where you have months or years of chronic viral infection that could cause harm to the baby. So we know that four out of five people with the infection we believe have no symptoms, so it's complicated to know, well, when did this start and stop. Our scientists are working closely with counterparts on some investigations to understand this in a more rigorous way. Based on what we know right now, we think it's an active period of infection that may or may not have symptoms, and it's short limited, short time. TOM SKINNER: Kathy, we have about five more minutes, so let's go to the next question, please. OPERATOR: Next question is from John Lauerman of Bloomberg news. JOHN LAUERMAN: Hi. So what is the state of research right now to establish the connection between these birth defects and Zika virus? How is that being pursued? DR. SCHUCHAT: let me give you kind of a general outline. You know, the first thing that's very important is very careful, clinical review of the information on the babies that have been recognized with birth defects. Microcephaly itself has some looseness around what it is and we want to make sure that the infant really has that condition, but there are many other birth defects that can be present in a child, so we think that the pediatricians, genetics, and health experts in Brazil and elsewhere and CDC carefully review the records. There's also plans to specifically be following a cohort of pregnant women to really understand do they get infected or not with the virus and what happens over time during the pregnancy, and then what happens with the babies, and that's the kind of study that's quite intensive, large scale, to detect a rare problem, and we'll, obviously, be a major collaboration, so that work is not yet gun, but discussions are very active about that because I think the field believes that's very important. There's also a collaboration between Brazil and CDC and possibly others around using a case controlled design to compare babies with microcephaly condition and other babies born around the same time in and around the same area to look in more depth at different factors that the mothers were exposed to, and to look at laboratory tests from the mothers and babies, and really get a better idea of what proportion, if any, of these birth defects can be specifically linked with the Zika virus, so I think there's a host of things that are being looked at, but those are a couple of the ones that are high on the list. JOHN LAUERMAN: Thank you. TOM SKINNER: Next question, Kathy? OPERATOR: Next question's from Sandy Lamount of CNN. SANDY LAMOUNT: Thank you very much for taking my question. do you have the exact listing up to date that you're saying are 11 so we can update the map -- TOM SKINNER: Sandy, this is Tom, we hope to be providing that information to you soon when we get things synced up, but we'll provide that hopefully to you soon. Do you have any question? SANDY LAMOUNT: I do. And that had to do with specific areas that were, I think, looked at for historical, looking chikungunya and the United States, what areas of the United States did that include? DR. SCHUCHAT: Yeah. I think those are the southern tips of Florida and Texas and perhaps other similar tips of the south. I’m trying to recall if California’s on the list -- not on that list? Okay. So, you know, there's been a little, and, you know, again, those are very small local transmissions. DR. FAUCI: In the Florida keys and Dade county in 2012, there was a small cluster that was taken care of by vector control, but it was in the Florida keys and in some cases in Dade county. SANDY LAMOUNT Thank you. TOM SKINNER: Kathy, we'll take one last question, please. OPERATOR>> Okay. One moment. We have a question from Nora Kelly, at The Atlantic. NORA KELLY: Thank you for making yourselves available. My question is, it's my understanding that El Nino is expected to bring heavy rain in the south over the next few months, how much a concern is that for mosquitos breeding? DR. SCHUCHAT We, of course, we’re concerned about heavy rains for many reasons in terms of the damage that that can cause. In terms of the risks for this particular virus and spread in those southern tips of Florida and Texas, that is not a major concern. We think the critical issues are to be doing good surveillance and actively recognizing when there's local spread and to follow-up pretty actively of control at that point. We do think the living conditions in general in the united states, the lack of urban density in those areas where the mosquitos circulating and the air-conditions and screens will hopefully keep us in better shape compared with what's beginning on in some of the hot spots in south America or the Caribbean. DR. FAUCI Yeah. Also, an interesting question comes up talking about people who bring up the topic of climate change and very dry or very wet. mosquitos are very interesting species that sometimes changes in climate that you think might propagate them, actually, make it less favorable for the mosquitos, so sometimes climate changes make it either worse in the sense of more mosquitos or even better with fewer mosquito, and it really depends on the relative extend of dryness versus wetness which are all consequences of extremes of climate. TOM SKINNER: All right. Kathy, I believe we're ready to conclude our briefing here. Thanks to the doctors and thank you to everyone for joining us this morning. We’ll continue to share information with you as we have it. A transcript of the telebriefing will be posted to the CDC news room website as soon as possible. We realize some of you were not able to ask your questions, and should you have additional questions, please, call the CDC press office at 404-639-3286 or e-mail CDC to [email protected]. Thank you very much. OPERATOR: Thank you, this completes today's conference. You may disconnect at this time. http://www.cdc.gov/media/releases/2016/t0128-zika-virus-101.html ###
  2. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome190771907799%0.099%KU321639.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds190121901299%0.099%KJ776791.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds185921859297%0.099%KU312312.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177621776296%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds177061770695%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds175981759896%0.098%EU545988.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164691646996%0.096%HQ234499.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1393413934100%0.089%LC002520.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1392313923100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1392313923100%0.089%KF268948.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1391613916100%0.089%KF268950.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1387613876100%0.089%AY632535.2Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds133351333596%0.089%HQ234498.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds133331333396%0.089%KF383115.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds133131331396%0.089%KF383119.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds132881328896%0.089%DQ859059.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds132751327596%0.089%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132681326896%0.089%HQ234501.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds132051320596%0.088%KF383117.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131891318996%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds129991306796%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds129091290993%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108861088693%0.084%KF383120.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds5077507726%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds5052505226%0.099%KU312313.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3452345218%0.099%KU312315.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds2861419791%0.071%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2686268614%0.099%KJ634273.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds174617469%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds174517459%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds174317439%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds173917399%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds173917399%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds173917399%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds173717379%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds159715978%0.099%KJ873160.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds141514157%0.099%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds138213827%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds134613467%0.098%KM851038.1Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds130613069%0.088%AF013415.1Select seq gb|KT200609.1|Zika virus isolate BR/949/15 NS5 gene, partial cds123612366%0.099%KT200609.1
  3. LOCUS KU365780 10662 bp RNA linear VRL 26-JAN-2016 DEFINITION Zika virus strain BeH815744 polyprotein gene, complete cds. ACCESSION KU365780 VERSION KU365780.1 GI:975885971 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus; Spondweni virus group. REFERENCE 1 (bases 1 to 10662) AUTHORS Azevedo,R.S.S., Cruz,A.C.R., Nunes,B.T.D., Quieroz,A.L.N., Oliveira,R.S., Medeiros,D.B.A., Rodrigues,D.S.G., Silva,E.V.P., Pantoja,J.A.S., Massafra,J.M.V., Santos,M., Silva,S.P., Lemos,P.S., Santos,A.C.M., Vasconcelos,H.B., Lima,J.A., Rodrigues,S.G., Tesh,R.B., Nunes,M.R.T. and Vasconcelos,P.F.C. TITLE Genome sequences of four Zika virus isolates from Brazil JOURNAL Unpublished REFERENCE 2 (bases 1 to 10662) AUTHORS Azevedo,R.S.S., Cruz,A.C.R., Nunes,B.T.D., Quieroz,A.L.N., Oliveira,R.S., Medeiros,D.B.A., Rodrigues,D.S.G., Silva,E.V.P., Pantoja,J.A.S., Massafra,J.M.V., Santos,M., Silva,S.P., Lemos,P.S., Santos,A.C.M., Vasconcelos,H.B., Lima,J.A., Rodrigues,S.G., Tesh,R.B., Nunes,M.R.T. and Vasconcelos,P.F.C. TITLE Direct Submission JOURNAL Submitted (30-DEC-2015) Center for Technological Innovation, Evandro Chagas Institute, BR 316, Km 07, s/n, Ananindeua, Para 67030-000, Brazil COMMENT EMAIL: [email protected] ##Assembly-Data-START## Assembly method: Mira 4.0 and Geneious 7.0 Sequencing Technology: Ion and 454 ##Assembly-Data-END##. FEATURES Location/Qualifiers source 1..10662 /organism="Zika virus" /mol_type="genomic RNA" /strain="BeH815744" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="2015" CDS 94..10365 /codon_start=1 /product="polyprotein" /protein_id="AMA12087.1" /db_xref="GI:975885972" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVDLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 gtgaatcaga ctgcgacagt tcgagtttga agcgaaagct agcaacagta tcaacaggtt 61 ttattttgga tttggaaacg agagtttctg gtcatgaaaa acccaaaaaa gaaatccgga 121 ggattccgga ttgtcaatat gctaaaacgc ggagtagccc gtgtgagccc ctttgggggc 181 ttgaagaggc tgccagccgg acttctgctg ggtcatgggc ccatcaggat ggtcttggcg 241 attctagcct ttttgagatt cacggcaatc aagccatcac tgggtctcat caatagatgg 301 ggttcagtgg ggaaaaaaga ggctatggaa ataataaaga agttcaagaa agatctggct 361 gccatgctga gaataatcaa tgctaggaag gagaagaaga gacgaggcgc agatactagt 421 gtcggaattg ttggcctcct gctgaccaca gctatggcag cggaggtcac tagacgtggg 481 agtgcatact atatgtactt ggacagaaac gatgctgggg aggccatatc ttttccaacc 541 acattgggga tgaataagtg ttatatacag atcatggatc ttggacacat gtgtgatgcc 601 accatgagct atgaatgccc tatgctggat gagggggtgg aaccagatga cgtcgattgt 661 tggtgcaaca cgacgtcaac ttgggttgtg tacggaacct gccatcacaa aaaaggtgaa 721 gcacggagat ctagaagagc tgtgacgctc ccctcccatt ccactaggaa gctgcaaacg 781 cggtcgcaaa cctggttgga atcaagagaa tacacaaagc acttgattag agtcgaaaat 841 tggatattta ggaaccctgg cttcgcgtta gcagcagctg ccatcgcttg gcttttggga 901 agctcaacga gccaaaaagt catatacttg gtcatgatac tgctgattgc cccggcatac 961 agcatcaggt gcataggagt cagcaatagg gactttgtgg aaggtatgtc aggtgggacc 1021 tgggttgatg ttgtcttgga acatggaggt tgtgtcaccg taatggcaca ggacaaaccg 1081 actgtcgaca tagagctggt tacaacaaca gtcagcaaca tggcggaggt aagatcctac 1141 tgctatgagg catcaatatc agacatggct tcggacagcc gctgcccaac acaaggtgaa 1201 gcctaccttg acaagcaatc agacactcaa tatgtctgca aaagaacgtt agtggacaga 1261 ggctggggaa atggatgtgg actttttggc aaagggagcc tggtgacatg cgctaagttt 1321 gcatgctcca agaaaatgac cgggaagagc atccagccag agaatctgga gtaccggata 1381 atgctgtcag ttcatggctc ccagcacagt gggatgattg ttaatgacac aggacatgaa 1441 actgatgaga atagagcgaa agttgagata acgcccaatt caccaagagc cgaagccacc 1501 ctggggggtt ttggaagcct aggacttgat tgtgaaccga ggacaggcct tgacttttca 1561 gatttgtatt acttgactat gaataacaag cactggttgg ttcacaagga gtggttccac 1621 gacattccat taccttggca cgctggggca gacaccggaa ctccacactg gaacaacaaa 1681 gaagcactgg tagagttcaa ggacgcacat gccaaaaggc aaactgtcgt ggttctaggg 1741 agtcaagaag gagcagttca cacggccctt gctggagctc tggaggctga gatggatggt 1801 gcaaagggaa ggctgtcctc tggccacttg aaatgtcgcc tgaaaatgga taaacttaga 1861 ttgaagggcg tgtcatactc cttgtgtact gcagcgttca cattcaccaa gatcccggct 1921 gaaacactgc acgggacagt cacagtggag gtacagtacg cagggacaga tggaccttgc 1981 aaggttccag ctcagatggc ggtggacatg caaactctga ccccagttgg gaggttgata 2041 accgctaacc ccgtaatcac tgaaagcact gagaactcta agatgatgct ggaacttgat 2101 ccaccatttg gggactctta cattgtcata ggagtcgggg agaagaagat cacccaccac 2161 tggcacagga gtggcagcac cattggaaaa gcatttgaag ccactgtgag aggtgccaag 2221 agaatggcag tcttgggaga cacagcctgg gactttggat cagttggagg cgctctcaac 2281 tcattgggca agggcatcca tcaaattttt ggagcagctt tcaaatcatt gtttggagga 2341 atgtcctggt tctcacaaat tctcattgga acgttgctga tgtggttggg tctgaacaca 2401 aagaatggat ctatttccct tatgtgcttg gccttagggg gagtgttgat cttcttatcc 2461 acagccgtct ctgctgatgt ggggtgctcg gtggacttct caaagaagga gacgagatgc 2521 ggtacagggg tgttcgtcta taacgacgtt gaagcctgga gggacaggta caagtaccat 2581 cctgactccc cccgtagatt ggcagcagca gtcaagcaag cctgggaaga tggtatctgc 2641 gggatctcct ctgtttcaag aatggaaaac atcatgtgga gatcagtaga aggggagctc 2701 aacgcaatcc tggaagagaa tggagttcaa ctgacggtcg ttgtgggatc tgtaaaaaac 2761 cccatgtgga gaggtccaca gagattgccc gtgcctgtga acgagctgcc ccacggctgg 2821 aaggcttggg ggaaatcgta cttcgtcaga gcagcaaaga caaataacag ctttgtcgtg 2881 gatggtgaca cactgaagga atgcccactc aaacatagag catggaacag ctttcttgtg 2941 gaggatcatg ggttcggggt atttcacact agtgtctggc tcaaggttag agaagattat 3001 tcattagagt gtgatccagc cgttattgga acagctgtta agggaaagga ggctgtacac 3061 agtgatctag gctactggat tgagagtgag aagaatgaca catggaggct gaagagggcc 3121 catctgatcg agatgaaaac atgtgaatgg ccaaagtccc acacattgtg gacagatgga 3181 atagaagaga gtgatctgat catacccaag tctttagctg ggccactcag ccatcacaat 3241 accagagagg gctacaggac ccaaatgaaa gggccatggc acagtgaaga gcttgaaatt 3301 cggtttgagg aatgcccagg cactaaggtc cacgtggagg aaacatgtgg aacaagagga 3361 ccatctctga gatcaaccac tgcaagcgga agggtgatcg aggaatggtg ctgcagggag 3421 tgcacaatgc ccccactgtc gttccgggct aaagatggct gttggtatgg aatggagata 3481 aggcccagga aagaaccaga aagcaactta gtaaggtcaa tggtgactgc aggatcaact 3541 gatcacatgg accacttctc ccttggagtg cttgtgattc tgctcatggt gcaggaaggg 3601 ctgaagaaga gaatgaccac aaagatcatc ataagcacat caatggcagt gctggtagct 3661 atgatcctgg gaggattttc aatgagtgac ctggctaagc ttgcaatttt gatgggtgcc 3721 accttcgcgg aaatgaacac tggaggagat gtagctcatc tggcgctgat agcggcattc 3781 aaagtcagac cagcgttgct ggtatctttc atcttcagag ctaattggac accccgtgaa 3841 agcatgctgc tggccttggc ctcgtgtctt ttgcaaactg cgatctccgc cttggaaggc 3901 gacctgatgg ttctcatcaa tggttttgct ttggcctggt tggcaatacg agcgatggtt 3961 gttccacgca ctgataacat caccttggca atcctggctg ctctgacacc actggcccgg 4021 ggcacactgc ttgtggcgtg gagagcaggc cttgctactt gcggggggtt tatgctcctc 4081 tctctgaagg gaaaaggcag tgtgaagaag aacttaccat ttgtcatggc cctgggacta 4141 accgctgtga ggctggtcga ccccatcaac gtggtgggac tgctgttgct cacaaggagt 4201 gggaagcgga gctggccccc tagcgaagta ctcacagctg ttggcctgat atgcgcattg 4261 gctggagggt tcgccaaggc agatatagag atggctgggc ccatggccgc ggtcggtctg 4321 ctaattgtca gttacgtggt ctcaggaaag agtgtggaca tgtacattga aagagcaggt 4381 gacatcacat gggaaaaaga tgcggaagtc actggaaaca gtccccggct cgatgtggcg 4441 ctagatgaga gtggtgattt ctccctggtg gaggatgacg gtccccccat gagagagatc 4501 atactcaagg tggtcctgat gaccatctgt ggcatgaacc caatagccat accctttgca 4561 gctggagcgt ggtacgtata cgtgaagact ggaaaaagga gtggtgctct atgggatgtg 4621 cctgctccca aggaagtaaa aaagggggag accacagatg gagtgtacag agtaatgact 4681 cgtagactgc taggttcaac acaagttgga gtgggagtta tgcaagaggg ggtctttcac 4741 actatgtggc acgtcacaaa aggatccgcg ctgagaagcg gtgaagggag acttgatcca 4801 tactggggag atgtcaagca ggatctggtg tcatactgtg gtccatggaa gctagatgcc 4861 gcctgggacg ggcacagcga ggtgcagctc ttggccgtgc cccccggaga gagagcgagg 4921 aacatccaga ctctgcccgg aatatttaag acaaaggatg gggacattgg agcggttgcg 4981 ctggattacc cagcaggaac ttcaggatct ccaatcctag acaagtgtgg gagagtgata 5041 ggactttatg gcaatggggt cgtgatcaaa aatgggagtt atgttagtgc catcacccaa 5101 gggaggaggg aggaagagac tcctgttgag tgcttcgagc cttcgatgct gaagaagaag 5161 cagctaactg tcttagactt gcatcctgga gctgggaaaa ccaggagagt tcttcctgaa 5221 atagtccgtg aagccataaa aacaagactc cgcaccgtga tcttagctcc aaccagggtt 5281 gtcgctgctg aaatggagga ggcccttaga gggcttccag tgcgttatat gacaacagca 5341 gtcaatgtca cccactctgg aacagaaatc gtcgacttaa tgtgccatgc caccttcact 5401 tcacgtctac tacagccaat cagagtcccc aactataatc tgtatattat ggatgaggcc 5461 cacttcacag atccctcaag tatagcagca agaggataca tttcaacaag ggttgagatg 5521 ggcgaggcgg ctgccatctt catgaccgcc acgccaccag gaacccgtga cgcatttccg 5581 gactccaact caccaattat ggacaccgaa gtggaagtcc cagagagagc ctggagctca 5641 ggctttgatt gggtgacgga tcattctgga aaaacagttt ggtttgttcc aagcgtgagg 5701 aacggcaatg agatcgcagc ttgtctgaca aaggctggaa aacgggtcat acagctcagc 5761 agaaagactt ttgagacaga gttccagaaa acaaaacatc aagagtggga ctttgtcgtg 5821 acaactgaca tttcagagat gggcgccaac tttaaagctg accgtgtcat agattccagg 5881 agatgcctaa agccggtcat acttgatggc gagagagtca ttctggctgg acccatgcct 5941 gtcacacatg ccagcgctgc ccagaggagg gggcgcatag gcaggaatcc caacaaacct 6001 ggagatgagt atctgtatgg aggtgggtgc gcagagactg acgaagacca tgcacactgg 6061 cttgaagcaa gaatgctcct tgacaatatt tacctccaag atggcctcat agcctcgctc 6121 tatcgacctg aggccgacaa agtagcagcc attgagggag agttcaagct taggacggag 6181 caaaggaaga cctttgtgga actcatgaaa agaggagatc ttcctgtttg gctggcctat 6241 caggttgcat ctgccggaat aacctacaca gatagaagat ggtgctttga tggcacgacc 6301 aacaacacca taatggaaga cagtgtgccg gcagaggtgt ggaccagaca cggagagaaa 6361 agagtgctca aaccgaggtg gatggacgcc agagtttgtt cagatcatgc ggccctgaag 6421 tcattcaagg agtttgccgc tgggaaaaga ggagcggctt ttggagtgat ggaagccctg 6481 ggaacactgc caggacacat gacagagaga ttccaggaag ccattgacaa cctcgctgtg 6541 ctcatgcggg cagagactgg aagcaggcct tacaaagccg cggcggccca attgccggag 6601 accctagaga ccattatgct tttggggttg ctgggaacag tctcgctggg aatcttcttc 6661 gtcttgatga ggaacaaggg catagggaag atgggctttg gaatggtgac tcttggggcc 6721 agcgcatggc tcatgtggct ctcggaaatt gagccagcca gaattgcatg tgtcctcatt 6781 gttgtgtttc tattgctggt ggtgctcata cctgagccag aaaagcaaag atctccccag 6841 gacaaccaaa tggcaatcat catcatggta gcagtaggtc ttctgggctt gattaccgcc 6901 aatgaactcg gatggttgga gagaacaaag agtgacctaa gccatctaat gggaaggaga 6961 gaggaggggg caaccatagg attctcaatg gacattgacc tgcggccagc ctcagcttgg 7021 gccatctatg ctgccttgac aactttcatt accccagccg tccaacatgc agtgaccact 7081 tcatacaaca actactcctt aatggcgatg gccacgcaag ctggagtgtt gtttggtatg 7141 ggcaaaggga tgccattcta cgcatgggac tttggagtcc cgctgctaat gataggttgc 7201 tactcacaat taacacccct gaccctaata gtggccatca ttttgctcgt ggcgcactac 7261 atgtacttga tcccagggct gcaggcagca gctgcgcgtg ctgcccagaa gagaacggca 7321 gctggcatca tgaagaaccc tgttgtggat ggaatagtgg tgactgacat tgacacaatg 7381 acaattgacc cccaagtgga gaaaaagatg ggacaggtgc tactcatagc agtagccgtc 7441 tccagcgcca tactgtcgcg gaccgcctgg gggtgggggg aggctggggc cctgatcaca 7501 gccgcaactt ccactttgtg ggaaggctct ccgaacaagt actggaactc ctctacagcc 7561 acttcactgt gtaacatttt taggggaagt tacttggctg gagcttctct aatctacaca 7621 gtaacaagaa acgctggctt ggtcaagaga cgtgggggtg gaacaggaga gaccctggga 7681 gagaaatgga aggcccgctt gaaccagatg tcggccctgg agttctactc ctacaaaaag 7741 tcaggcatca ccgaggtgtg cagagaagag gcccgccgcg ccctcaagga cggtgtggca 7801 acgggaggcc atgctgtgtc ccgaggaagt gcaaagctga gatggttggt ggagcgggga 7861 tacctgcagc cctatggaaa ggtcattgat cttggatgtg gcagaggggg ctggagttac 7921 tacgccgcca ccatccgcaa agttcaagaa gtgaaaggat acacaaaagg aggccctggt 7981 catgaagaac ccgtgttggt gcaaagctat gggtggaaca tagtccgtct taagagtggg 8041 gtggacgtct ttcatatggc ggctgagccg tgtgacacgt tgctgtgtga cataggtgag 8101 tcatcatcta gtcctgaagt ggaagaagca cggacgctca gagtcctctc catggtgggg 8161 gattggcttg aaaaaagacc aggagccttt tgtataaagg tgttgtgccc atacaccagc 8221 actatgatgg aaaccctgga gcgactgcag cgtaggtatg ggggaggact ggtcagagtg 8281 ccactctccc gcaactctac acatgagatg tattgggtct ctggagcgaa aagcaacacc 8341 ataaaaagtg tgtccaccac gagccagctc ctcttggggc gcatggacgg gcctaggagg 8401 ccagtgaaat atgaggagga tgtggatctc ggctctggca cgcgggctgt ggtaagctgc 8461 gctgaagctc ccaacatgaa gatcattggt aaccgcattg aaaggatccg cagtgagcac 8521 gcggaaacgt ggttctttga cgagaaccac ccatatagga catgggctta ccatggaagc 8581 tatgaggccc ccacacaagg gtcagcgtcc tctctaataa acggggttgt caggctcctg 8641 tcaaaaccct gggatgtggt gactggagtc acaggaatag ccatgaccga caccacaccg 8701 tatggtcagc aaagagtttt caaggaaaaa gtggacacta gggtgccaga cccccaagaa 8761 ggcactcgtc aggttatgag catggtctct tcctggttgt ggaaagagct aggcaaacac 8821 aaacggccac gagtctgtac caaagaagag ttcatcaaca aggttcgtag caatgcagca 8881 ttaggggcaa tatttgaaga ggaaaaagag tggaagactg cagtggaagc tgtgaacgat 8941 ccaaggttct gggctctagt ggataaggaa agagagcacc acctgagagg agagtgccag 9001 agttgtgtgt acaacatgat gggaaaaaga gaaaagaaac aaggggaatt tggaaaggcc 9061 aagggcagcc gcgccatctg gtatatgtgg ctaggggcta gatttctaga gttcgaagcc 9121 cttggattct tgaacgagga tcactggatg gggagagaga actcaggagg tggtgttgaa 9181 gggctgggat tacaaagact cggatatgtc ctagaagaga tgagtcgtat accaggagga 9241 aggatgtatg cagatgacac tgctggctgg gacacccgca tcagcaggtt tgatctggag 9301 aatgaagctc taatcaccaa ccaaatggaa aaagggcaca gggccttggc attggccata 9361 atcaagtaca cataccaaaa caaagtggta aaggtcctta gaccagctga aaaagggaaa 9421 acagttatgg acattatttc gagacaagac caaaggggga gcggacaagt tgtcacttac 9481 gctcttaaca catttaccaa cctagtggtg caactcattc ggaatatgga ggctgaggaa 9541 gttctagaga tgcaagactt gtggctgctg cggaggtcag agaaagtgac caactggttg 9601 cagagcaacg gatgggatag gctcaaacga atggcagtca gtggagatga ttgcgttgtg 9661 aagccaattg atgataggtt tgcacatgcc ctcaggttct tgaatgatat gggaaaagtt 9721 aggaaggaca cacaagagtg gaaaccctca actggatggg acaactggga agaagttccg 9781 ttttgctccc accacttcaa caagctccat ctcaaggacg ggaggtccat tgtggttccc 9841 tgccgccacc aagatgaact gattggccgg gcccgcgtct ctccaggggc gggatggagc 9901 atccgggaga ctgcttgcct agcaaaatca tatgcgcaaa tgtggcagct cctttatttc 9961 cacagaaggg acctccgact gatggccaat gccatttgtt catctgtgcc agttgactgg 10021 gttccaactg ggagaactac ctggtcaatc catggaaagg gagaatggat gaccactgaa 10081 gacatgcttg tggtgtggaa cagagtgtgg attgaggaga acgaccacat ggaagacaag 10141 accccagtta cgaaatggac agacattccc tatttgggaa aaagggaaga cttgtggtgt 10201 ggatctctca tagggcacag accgcgcacc acctgggctg agaacattaa aaacacagtc 10261 aacatggtgc gcaggatcat aggtgatgaa gaaaagtaca tggactacct atccacccaa 10321 gttcgctact tgggtgaaga agggtctaca cctggagtgc tgtaagcacc aatcttaatg 10381 ttgtcaggcc tgctagtcag ccacagcttg gggaaagctg tgcagcctgt gaccccccag 10441 gagaagctgg gaaaccaagc ctatagtcag gccgagaacg ccatggcacg gaagaagcca 10501 tgctgcctgt gagcccctca gaggacactg agtcaaaaaa ccccacgcgc ttggaggcgc 10561 aggatgggaa aagaaggtgg cgaccttccc cacccttcaa tctggggcct gaactggaga 10621 tcagctgtgg atctccagaa gagggactag tggttagagg ag
  4. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome190861908699%0.099%KU321639.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds190211902199%0.099%KJ776791.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds186011860197%0.099%KU312312.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177661776696%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds177211772195%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds176121761296%0.098%EU545988.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164691646996%0.096%HQ234499.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1393413934100%0.089%LC002520.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1392813928100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1391913919100%0.089%KF268948.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1391213912100%0.089%KF268950.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1387613876100%0.089%AY632535.2Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds133391333996%0.089%HQ234498.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds133331333396%0.089%KF383115.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds133171331796%0.089%KF383119.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds132881328896%0.089%DQ859059.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds132751327596%0.089%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132591325996%0.089%HQ234501.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds132091320996%0.088%KF383117.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131891318996%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds130031307196%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds129181291893%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108951089593%0.084%KF383120.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds5081508126%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds5056505626%0.099%KU312313.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3452345218%0.099%KU312315.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds2856419791%0.071%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2686268614%0.099%KJ634273.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds174617469%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds174517459%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds174317439%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds173917399%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds173917399%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds173917399%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds173717379%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds159715978%0.099%KJ873160.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds141514157%0.099%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds138213827%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds134613467%0.098%KM851038.1
  5. LOCUS KU365779 10662 bp RNA linear VRL 26-JAN-2016 DEFINITION Zika virus strain BeH819966 polyprotein gene, complete cds. ACCESSION KU365779 VERSION KU365779.1 GI:975885969 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus; Spondweni virus group. REFERENCE 1 (bases 1 to 10662) AUTHORS Azevedo,R.S.S., Cruz,A.C.R., Nunes,B.T.D., Quieroz,A.L.N., Oliveira,R.S., Medeiros,D.B.A., Rodrigues,D.S.G., Silva,E.V.P., Pantoja,J.A.S., Massafra,J.M.V., Santos,M., Silva,S.P., Lemos,P.S., Santos,A.C.M., Vasconcelos,H.B., Lima,J.A., Rodrigues,S.G., Tesh,R.B., Nunes,M.R.T. and Vasconcelos,P.F.C. TITLE Genome sequences of four Zika virus isolates from Brazil JOURNAL Unpublished REFERENCE 2 (bases 1 to 10662) AUTHORS Azevedo,R.S.S., Cruz,A.C.R., Nunes,B.T.D., Quieroz,A.L.N., Oliveira,R.S., Medeiros,D.B.A., Rodrigues,D.S.G., Silva,E.V.P., Pantoja,J.A.S., Massafra,J.M.V., Santos,M., Silva,S.P., Lemos,P.S., Santos,A.C.M., Vasconcelos,H.B., Lima,J.A., Rodrigues,S.G., Tesh,R.B., Nunes,M.R.T. and Vasconcelos,P.F.C. TITLE Direct Submission JOURNAL Submitted (30-DEC-2015) Center for Technological Innovation, Evandro Chagas Institute, BR 316, Km 07, s/n, Ananindeua, Para 67030-000, Brazil COMMENT EMAIL: [email protected] ##Assembly-Data-START## Assembly method: Mira 4.0 and Geneious 7.0 Sequencing Technology: Ion and 454 ##Assembly-Data-END##. FEATURES Location/Qualifiers source 1..10662 /organism="Zika virus" /mol_type="genomic RNA" /strain="BeH819966" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="2015" CDS 94..10365 /codon_start=1 /product="polyprotein" /protein_id="AMA12086.1" /db_xref="GI:975885970" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 gtgaatcaga ctgcgacagt tcgagtttga agcgaaagct agcaacagta tcaacaggtt 61 ttattttgga tttggaaacg agagtttctg gtcatgaaaa acccaaaaaa gaaatccgga 121 ggattccgga ttgtcaatat gctaaaacgc ggagtagccc gtgtgagccc ctttgggggc 181 ttgaagaggc tgccagccgg acttctgctg ggtcatgggc ccatcaggat ggtcttggcg 241 attctagcct ttttgagatt cacggcaatc aagccatcac tgggtctcat caatagatgg 301 ggttcagtgg ggaaaaaaga ggctatggaa ataataaaga agttcaagaa agatctggct 361 gccatgctga gaataatcaa tgctaggaag gagaagaaga gacgaggcgc agatactagt 421 gtcggaattg ttggcctcct gctgaccaca gctatggcag cggaggtcac tagacgtggg 481 agtgcatact atatgtactt ggacagaaac gatgctgggg aggccatatc ttttccaacc 541 acattgggga tgaataagtg ttatatacag atcatggatc ttggacacat gtgtgatgcc 601 accatgagct atgaatgccc tatgctggat gagggggtgg aaccagatga cgtcgattgt 661 tggtgcaaca cgacgtcaac ttgggttgtg tacggaacct gccatcacaa aaaaggtgaa 721 gcacggagat ctagaagagc tgtgacgctc ccctcccatt ccactaggaa gctgcaaacg 781 cggtcgcaaa cctggttgga atcaagagaa tacacaaagc acttgattag agtcgaaaat 841 tggatattca ggaaccctgg cttcgcgtta gcagcagctg ccatcgcttg gcttttggga 901 agctcaacga gccaaaaagt catatacttg gtcatgatac tgctgattgc cccggcatac 961 agcatcaggt gcataggagt cagcaatagg gactttgtgg aaggtatgtc aggtgggacc 1021 tgggttgatg ttgtcttgga acatggaggt tgtgtcaccg taatggcaca ggacaaaccg 1081 actgtcgaca tagagctggt tacaacaaca gtcagcaaca tggcggaggt aagatcctac 1141 tgctatgagg catcaatatc agacatggct tcggacagcc gctgcccaac acaaggtgaa 1201 gcctaccttg acaagcaatc agacactcaa tatgtctgca aaagaacgtt agtggacaga 1261 ggctggggaa atggatgtgg actttttggc aaagggagcc tggtgacatg cgctaagttt 1321 gcatgctcca agaaaatgac cgggaagagc atccagccag agaatctgga gtaccggata 1381 atgctgtcag ttcatggctc ccagcacagt gggatgattg ttaatgacac aggacatgaa 1441 actgatgaga atagagcgaa agttgagata acgcccaatt caccaagagc cgaagccacc 1501 ctggggggtt ttggaagcct aggacttgat tgtgaaccga ggacaggcct tgacttttca 1561 gatttgtatt acttgactat gaataacaag cactggttgg ttcacaagga gtggttccac 1621 gacattccat taccttggca cgctggggca gacaccggaa ctccacactg gaacaacaaa 1681 gaagcactgg tagagttcaa ggacgcacat gccaaaaggc aaactgtcgt ggttctaggg 1741 agtcaagaag gagcagttca cacggccctt gctggagctc tggaggctga gatggatggt 1801 gcaaagggaa ggctgtcctc tggccacttg aaatgtcgcc tgaaaatgga taaacttaga 1861 ttgaagggcg tgtcatactc cttgtgtact gcagcgttca cattcaccaa gatcccggct 1921 gaaacactgc acgggacagt cacagtggag gtacagtacg cagggacaga tggaccttgc 1981 aaggttccag ctcagatggc ggtggacatg caaactctga ccccagttgg gaggttgata 2041 accgctaacc ccgtaatcac tgaaagcact gagaactcta agatgatgct ggaacttgat 2101 ccaccatttg gggactctta cattgtcata ggagtcgggg agaagaagat cacccaccac 2161 tggcacagga gtggcagcac cattggaaaa gcatttgaag ccactgtgag aggtgccaag 2221 agaatggcag tcttgggaga cacagcctgg gactttggat cagttggagg cgctctcaac 2281 tcattgggca agggcatcca tcaaattttt ggagcagctt tcaaatcatt gtttggagga 2341 atgtcctggt tctcacaaat tctcattgga acgttgctga tgtggttggg tctgaacaca 2401 aagaatggat ctatttccct tatgtgcttg gccttagggg gagtgttgat cttcttatcc 2461 acagccgtct ctgctgatgt ggggtgctcg gtggacttct caaagaagga gacgagatgc 2521 ggtacagggg tgttcgtcta taacgacgtt gaagcctgga gggacaggta caagtaccat 2581 cctgactccc cccgtagatt ggcagcagca gtcaagcaag cctgggaaga tggtatctgc 2641 gggatctcct ctgtttcaag aatggaaaac atcatgtgga gatcagtaga aggggagctc 2701 aacgcaatcc tggaagagaa tggagttcaa ctgacggtcg ttgtgggatc tgtaaaaaac 2761 cccatgtgga gaggtccaca gagattgccc gtgcctgtga acgagctgcc ccacggctgg 2821 aaggcttggg ggaaatcgta cttcgtcaga gcagcaaaga caaataacag ctttgtcgtg 2881 gatggtgaca cactgaagga atgcccactc aaacatagag catggaacag ctttcttgtg 2941 gaggatcatg ggttcggggt atttcacact agtgtctggc tcaaggttag agaagattat 3001 tcattagagt gtgatccagc cgttattgga acagctgtta agggaaagga ggctgtacac 3061 agtgatctag gctactggat tgagagtgag aagaatgaca catggaggct gaagagggcc 3121 catctgatcg agatgaaaac atgtgaatgg ccaaagtccc acacattgtg gacagatgga 3181 atagaagaga gtgatctgat catacccaag tctttagctg ggccactcag ccatcacaat 3241 accagagagg gctacaggac ccaaatgaaa gggccatggc acagtgaaga gcttgaaatt 3301 cggtttgagg aatgcccagg cactaaggtc cacgtggagg aaacatgtgg aacaagagga 3361 ccatctctga gatcaaccac tgcaagcgga agggtgatcg aggaatggtg ctgcagggag 3421 tgcacaatgc ccccactgtc gttccgggct aaagatggct gttggtatgg aatggagata 3481 aggcccagga aagaaccaga aagcaactta gtaaggtcaa tggtgactgc aggatcaact 3541 gatcacatgg accacttctc ccttggagtg cttgtgattc tgctcatggt gcaggaaggg 3601 ctgaagaaga gaatgaccac aaagatcatc ataagcacat caatggcagt gctggtagct 3661 atgatcctgg gaggattttc aatgagtgac ctggctaagc ttgcaatttt gatgggtgcc 3721 accttcgcgg aaatgaacac tggaggagat gtagctcatc tggcgctgat agcggcattc 3781 aaagtcagac cagcgttgct ggtatctttc atcttcagag ctaattggac accccgtgaa 3841 agcatgctgc tggccttggc ctcgtgtctt ttgcaaactg cgatctccgc cttggaaggc 3901 gacctgatgg ttctcatcaa tggttttgct ttggcctggt tggcaatacg agcgatggtt 3961 gttccacgca ctgataacat caccttggca atcctggctg ctctgacacc actggcccgg 4021 ggcacactgc ttgtggcgtg gagagcaggc cttgctactt gcggggggtt tatgctcctc 4081 tctctgaagg gaaaaggcag tgtgaagaag aacttaccat ttgtcatggc cctgggacta 4141 accgctgtga ggctggtcga ccccatcaac gtggtgggac tgctgttgct cacaaggagt 4201 gggaagcgga gctggccccc tagcgaagta ctcacagctg ttggcctgat atgcgcattg 4261 gctggagggt tcgccaaggc agatatagag atggctgggc ccatggccgc ggtcggtctg 4321 ctaattgtca gttacgtggt ctcaggaaag agtgtggaca tgtacattga aagagcaggt 4381 gacatcacat gggaaaaaga tgcggaagtc actggaaaca gtccccggct cgatgtggcg 4441 ctagatgaga gtggtgattt ctccctggtg gaggatgacg gtccccccat gagagagatc 4501 atactcaagg tggtcctgat gaccatctgt ggcatgaacc caatagccat accctttgca 4561 gctggagcgt ggtacgtata cgtgaagact ggaaaaagga gtggtgctct atgggatgtg 4621 cctgctccca aggaagtaaa aaagggggag accacagatg gagtgtacag agtaatgact 4681 cgtagactgc taggttcaac acaagttgga gtgggagtta tgcaagaggg ggtctttcac 4741 actatgtggc acgtcacaaa aggatccgcg ctgagaagcg gtgaagggag acttgatcca 4801 tactggggag atgtcaagca ggatctggtg tcatactgtg gtccatggaa gctagatgcc 4861 gcctgggacg ggcacagcga ggtgcagctc ttggccgtgc cccccggaga gagagcgagg 4921 aacatccaga ctctgcccgg aatatttaag acaaaggatg gggacattgg agcggttgcg 4981 ctggattacc cagcaggaac ttcaggatct ccaatcctag acaagtgtgg gagagtgata 5041 ggactttatg gcaatggggt cgtgatcaaa aatgggagtt atgttagtgc catcacccaa 5101 gggaggaggg aggaagagac tcctgttgag tgcttcgagc cttcgatgct gaagaagaag 5161 cagctaactg tcttagactt gcatcctgga gctgggaaaa ccaggagagt tcttcctgaa 5221 atagtccgtg aagccataaa aacaagactc cgtactgtga tcttagctcc aaccagggtt 5281 gtcgctgctg aaatggagga ggcccttaga gggcttccag tgcgttatat gacaacagca 5341 gtcaatgtca cccactctgg aacagaaatc gtcgacttaa tgtgccatgc caccttcact 5401 tcacgtctac tacagccaat cagagtcccc aactataatc tgtatattat ggatgaggcc 5461 cacttcacag atccctcaag tatagcagca agaggataca tttcaacaag ggttgagatg 5521 ggcgaggcgg ctgccatctt catgaccgcc acgccaccag gaacccgtga cgcatttccg 5581 gactccaact caccaattat ggacaccgaa gtggaagtcc cagagagagc ctggagctca 5641 ggctttgatt gggtgacgga tcattctgga aaaacagttt ggtttgttcc aagcgtgagg 5701 aacggcaatg agatcgcagc ttgtctgaca aaggctggaa aacgggtcat acagctcagc 5761 agaaagactt ttgagacaga gttccagaaa acaaaacatc aagagtggga ctttgtcgtg 5821 acaactgaca tttcagagat gggcgccaac tttaaagctg accgtgtcat agattccagg 5881 agatgcctaa agccggtcat acttgatggc gagagagtca ttctggctgg acccatgcct 5941 gtcacacatg ccagcgctgc ccagaggagg gggcgcatag gcaggaatcc caacaaacct 6001 ggagatgagt atctgtatgg aggtgggtgc gcagagactg acgaagacca tgcacactgg 6061 cttgaagcaa gaatgctcct tgacaatatt tacctccaag atggcctcat agcctcgctc 6121 tatcgacctg aggccgacaa agtagcagcc attgagggag agttcaagct taggacggag 6181 caaaggaaga cctttgtgga actcatgaaa agaggagatc ttcctgtttg gctggcctat 6241 caggttgcat ctgccggaat aacctacaca gatagaagat ggtgctttga tggcacgacc 6301 aacaacacca taatggaaga cagtgtgccg gcagaggtgt ggaccagaca cggagagaaa 6361 agagtgctca aaccgaggtg gatggacgcc agagtttgtt cagatcatgc ggccctgaag 6421 tcattcaagg agtttgccgc tgggaaaaga ggagcggctt ttggagtgat ggaagccctg 6481 ggaacactgc caggacacat gacagagaga ttccaggaag ccattgacaa cctcgctgtg 6541 ctcatgcggg cagagactgg aagcaggcct tacaaagccg cggcggccca attgccggag 6601 accctagaga ccattatgct tttggggttg ctgggaacag tctcgctggg aatcttcttc 6661 gtcttgatga ggaacaaggg catagggaag atgggctttg gaatggtgac tcttggggcc 6721 agcgcatggc tcatgtggct ctcggaaatt gagccagcca gaattgcatg tgtcctcatt 6781 gttgtgtttc tattgctggt ggtgctcata cctgagccag aaaagcaaag atctccccag 6841 gacaaccaaa tggcaatcat catcatggta gcagtaggtc ttctgggctt gattaccgcc 6901 aatgaactcg gatggttgga gagaacaaag agtgacctaa gccatctaat gggaaggaga 6961 gaggaggggg caaccatagg attctcaatg gacattgacc tgcggccagc ctcagcttgg 7021 gccatctatg ctgccttgac aactttcatt accccagccg tccaacatgc agtgaccact 7081 tcatacaaca actactcctt aatggcgatg gccacgcaag ctggagtgtt gtttggtatg 7141 ggcaaaggga tgccattcta cgcatgggac tttggagtcc cgctgctaat gataggttgc 7201 tactcacaat taacacccct gaccctaata gtggccatca ttttgctcgt ggcgcactac 7261 atgtacttga tcccagggct gcaggcagca gctgcgcgtg ctgcccagaa gagaacggca 7321 gctggcatca tgaagaaccc tgttgtggat ggaatagtgg tgactgacat tgacacaatg 7381 acaattgacc cccaagtgga gaaaaagatg ggacaggtgc tactcatagc agtagccgtc 7441 tccagcgcca tactgtcgcg gaccgcctgg gggtgggggg aggctggggc cctgatcaca 7501 gccgcaactt ccactttgtg ggaaggctct ccgaacaagt actggaactc ctctacagcc 7561 acttcactgt gtaacatttt taggggaagt tacttggctg gagcttctct aatctacaca 7621 gtaacaagaa acgctggctt ggtcaagaga cgtgggggtg gaacaggaga gaccctggga 7681 gagaaatgga aggcccgctt gaaccagatg tcggccctgg agttctactc ctacaaaaag 7741 tcaggcatca ccgaggtgtg cagagaagag gcccgccgcg ccctcaagga cggtgtggca 7801 acgggaggcc atgctgtgtc ccgaggaagt gcaaagctga gatggttggt ggagcgggga 7861 tacctgcagc cctatggaaa ggtcattgat cttggatgtg gcagaggggg ctggagttac 7921 tacgccgcca ccatccgcaa agttcaagaa gtgaaaggat acacaaaagg aggccctggt 7981 catgaagaac ccgtgttggt gcaaagctat gggtggaaca tagtccgtct taagagtggg 8041 gtggacgtct ttcatatggc ggctgagccg tgtgacacgt tgctgtgtga cataggtgag 8101 tcatcatcta gtcctgaagt ggaagaagca cggacgctca gagtcctctc catggtgggg 8161 gattggcttg aaaaaagacc aggagccttt tgtataaagg tgttgtgccc atacaccagc 8221 actatgatgg aaaccctgga gcgactgcag cgtaggtatg ggggaggact ggtcagagtg 8281 ccactctccc gcaactctac acatgagatg tattgggtct ctggagcgaa aagcaacacc 8341 ataaaaagtg tgtccaccac gagccagctc ctcttggggc gcatggacgg gcctaggagg 8401 ccagtgaaat atgaggagga tgtgaatctc ggctctggca cgcgggctgt ggtaagctgc 8461 gctgaagctc ccaacatgaa gatcattggt aaccgcattg aaaggatccg cagtgagcac 8521 gcggaaacgt ggttctttga cgagaaccac ccatatagga catgggctta ccatggaagc 8581 tatgaggccc ccacacaagg gtcagcgtcc tctctaataa acggggttgt caggctcctg 8641 tcaaaaccct gggatgtggt gactggagtc acaggaatag ccatgaccga caccacaccg 8701 tatggtcagc aaagagtttt caaggaaaaa gtggacacta gggtgccaga cccccaagaa 8761 ggcactcgtc aggttatgag catggtctct tcctggttgt ggaaagagct aggcaaacac 8821 aaacggccac gagtctgtac caaagaagag ttcatcaaca aggttcgtag caatgcagca 8881 ttaggggcaa tatttgaaga ggaaaaagag tggaagactg cagtggaagc tgtgaacgat 8941 ccaaggttct gggctctagt ggataaggaa agagagcacc acctgagagg agagtgccag 9001 agttgtgtgt acaacatgat gggaaaaaga gaaaagaaac aaggggaatt tggaaaggcc 9061 aagggcagcc gcgccatctg gtatatgtgg ctaggggcta gatttctaga gttcgaagcc 9121 cttggattct tgaacgagga tcactggatg gggagagaga actcaggagg tggtgttgaa 9181 gggctgggat tacaaagact cggatatgtc ctagaagaga tgagtcgtat accaggagga 9241 aggatgtatg cagatgacac tgctggctgg gacacccgca tcagcaggtt tgatctggag 9301 aatgaagctc taatcaccaa ccaaatggaa aaagggcaca gggccttggc attggccata 9361 atcaagtaca cataccaaaa caaagtggta aaggtcctta gaccagctga aaaagggaaa 9421 acagttatgg acattatttc gagacaagac caaaggggga gcggacaagt tgtcacttac 9481 gctcttaaca catttaccaa cctagtggtg caactcattc ggaatatgga ggctgaggaa 9541 gttctagaga tgcaagactt gtggctgctg cggaggtcag agaaagtgac caactggttg 9601 cagagcaacg gatgggatag gctcaaacga atggcagtca gtggagatga ttgcgttgtg 9661 aagccaattg atgataggtt tgcacatgcc ctcaggttct tgaatgatat gggaaaagtt 9721 aggaaggaca cacaagagtg gaaaccctca actggatggg acaactggga agaagttccg 9781 ttttgctccc accacttcaa caagctccat ctcaaggacg ggaggtccat tgtggttccc 9841 tgccgccacc aagatgaact gattggccgg gcccgcgtct ctccaggggc gggatggagc 9901 atccgggaga ctgcttgcct agcaaaatca tatgcgcaaa tgtggcagct cctttatttc 9961 cacagaaggg acctccgact gatggccaat gccatttgtt catctgtgcc agttgactgg 10021 gttccaactg ggagaactac ctggtcaatc catggaaagg gagaatggat gaccactgaa 10081 gacatgcttg tggtgtggaa cagagtgtgg attgaggaga acgaccacat ggaagacaag 10141 accccagtta cgaaatggac agacatcccc tatttgggaa aaagggaaga cttgtggtgt 10201 ggatctctca tagggcacag accgcgcacc acctgggctg agaacattaa aaacacagtc 10261 aacatggtgc gcaggatcat aggtgatgaa gaaaagtaca tggactacct atccacccaa 10321 gttcgctact tgggtgaaga agggtctaca cctggagtgc tgtaagcacc agtcttaatg 10381 ttgtcaggcc tgctagtcag ccacagcttg gggaaagctg tgcagcctgt gaccccccag 10441 gagaagctgg gaaaccaagc ctatagtcag gccgagaacg ccatggcacg gaagaagcca 10501 tgctgcctgt gagcccctca gaggacactg agtcaaaaaa ccccacgcgc ttggaggcgc 10561 aggatgggaa aagaaggtgg cgaccttccc cacccttcaa tctggggcct gaactggaga 10621 tcagctgtgg atctccagaa gagggactag tggttagagg ag
  6. Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome190521905299%0.099%KU321639.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds189851898598%0.099%KJ776791.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds185921859296%0.099%KU312312.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177391773995%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds176881768894%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds175851758595%0.098%EU545988.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164061640695%0.095%HQ234499.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1401514015100%0.089%LC002520.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1401314013100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1400414004100%0.089%KF268948.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1399713997100%0.089%KF268950.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1394813948100%0.089%AY632535.2Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds133081330895%0.089%HQ234498.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds132971329795%0.089%KF383115.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds132861328695%0.089%KF383119.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds132481324895%0.089%KF383116.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds132481324895%0.089%DQ859059.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132231322395%0.089%HQ234501.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds131871318795%0.088%KF383117.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131471314795%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds129721303795%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128821288293%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108861088693%0.084%KF383120.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds5081508126%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds5056505626%0.099%KU312313.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3458345817%0.099%KU312315.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds2861419391%0.071%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2691269114%0.099%KJ634273.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds173717379%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds173617369%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds173417349%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds173017309%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds173017309%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds173017309%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds172817289%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds158815888%0.099%KJ873160.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds140614067%0.099%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds137313737%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds133713377%0.098%KM851038.1
  7. LOCUS KU365778 10727 bp RNA linear VRL 26-JAN-2016 DEFINITION Zika virus strain BeH819015 polyprotein gene, complete cds. ACCESSION KU365778 VERSION KU365778.1 GI:975885966 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus; Spondweni virus group. REFERENCE 1 (bases 1 to 10727) AUTHORS Azevedo,R.S.S., Cruz,A.C.R., Nunes,B.T.D., Quieroz,A.L.N., Oliveira,R.S., Medeiros,D.B.A., Rodrigues,D.S.G., Silva,E.V.P., Pantoja,J.A.S., Massafra,J.M.V., Santos,M., Silva,S.P., Lemos,P.S., Santos,A.C.M., Vasconcelos,H.B., Lima,J.A., Rodrigues,S.G., Tesh,R.B., Nunes,M.R.T. and Vasconcelos,P.F.C. TITLE Genome sequences of four Zika virus isolates from Brazil JOURNAL Unpublished REFERENCE 2 (bases 1 to 10727) AUTHORS Azevedo,R.S.S., Cruz,A.C.R., Nunes,B.T.D., Quieroz,A.L.N., Oliveira,R.S., Medeiros,D.B.A., Rodrigues,D.S.G., Silva,E.V.P., Pantoja,J.A.S., Massafra,J.M.V., Santos,M., Silva,S.P., Lemos,P.S., Santos,A.C.M., Vasconcelos,H.B., Lima,J.A., Rodrigues,S.G., Tesh,R.B., Nunes,M.R.T. and Vasconcelos,P.F.C. TITLE Direct Submission JOURNAL Submitted (30-DEC-2015) Center for Technological Innovation, Evandro Chagas Institute, BR 316, Km 07, s/n, Ananindeua, Para 67030-000, Brazil COMMENT EMAIL: [email protected] ##Assembly-Data-START## Assembly method: Mira 4.0 and Geneious 7.0 Sequencing Technology: Ion and 454 ##Assembly-Data-END##. FEATURES Location/Qualifiers source 1..10727 /organism="Zika virus" /mol_type="genomic RNA" /strain="BeH819015" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="2015" CDS 95..10366 /codon_start=1 /product="polyprotein" /protein_id="AMA12085.1" /db_xref="GI:975885967" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 tgtgaatcag actgcgacag ttcgagtttg aagcgaaagc tagcaacagt atcaacaggt 61 tttattttgg atttggaaac gagagtttct ggtcatgaaa aacccaaaaa agaaatccgg 121 aggattccgg attgtcaata tgctaaaacg cggagtagcc cgtgtgagcc cctttggggg 181 cttgaagagg ctgccagccg gacttctgct gggtcatggg cccatcagga tggtcttggc 241 gattctagcc tttttgagat tcacggcaat caagccatca ctgggtctca tcaatagatg 301 gggttcagtt gggaaaaaag aggctatgga aataataaag aagttcaaga aagatctggc 361 tgccatgctg agaataatca atgctaggaa ggagaagaag agacgaggcg cagatactag 421 tgtcggaatt gttggcctcc tgctgaccac agctatggca gcggaggtca ctagacgtgg 481 gagtgcatac tatatgtact tggacagaaa cgatgctggg gaggccatat cttttccaac 541 cacattgggg atgaataagt gttatataca gatcatggat cttggacaca tgtgtgatgc 601 caccatgagc tatgaatgcc ctatgctgga tgagggggtg gaaccagatg acgtcgattg 661 ttggtgcaac acgacgtcaa cttgggttgt gtacggaacc tgccatcaca aaaaaggtga 721 agcacggaga tctagaagag ctgtgacgct cccctcccat tccactagga agctgcaaac 781 gcggtcgcaa acctggttgg aatcaagaga atacacaaag cacttgatta gagtcgaaaa 841 ttggatattc aggaaccctg gcttcgcgtt agcagcagct gccatcgctt ggcttttggg 901 aagctcaacg agccaaaaag tcatatactt ggtcatgata ctgctgattg ccccggcata 961 cagcatcagg tgcataggag tcagcaatag ggactttgtg gaaggtatgt caggtgggac 1021 ttgggttgat gttgtcttgg aacatggagg ttgtgtcacc gtaatggcac aggacaaacc 1081 gactgtcgac atagagctgg ttacaacaac agtcagcaac atggcggagg taagatccta 1141 ctgctatgag gcatcaatat cagacatggc ttcggacagc cgctgcccaa cacaaggtga 1201 agcctacctt gacaagcaat cagacactca atatgtctgc aaaagaacgt tagtggacag 1261 aggctgggga aatggatgtg gactttttgg caaagggagc ctggtgacat gcgctaagtt 1321 tgcatgctcc aagaaaatga ccgggaagag catccagcca gagaatctgg agtaccggat 1381 aatgctgtca gttcatggct cccagcacag tgggatgatc gttaatgaca caggacatga 1441 aactgatgag aatagagcga aagttgagat aacgcccaat tcaccaagag ccgaagccac 1501 cctggggggt tttggaagcc taggacttga ttgtgaaccg aggacaggcc ttgacttttc 1561 agatttgtat tacttgacta tgaataacaa gcactggttg gttcacaagg agtggttcca 1621 cgacattcca ttaccttggc acgctggggc agacaccgga actccacact ggaacaacaa 1681 agaagcactg gtagagttca aggacgcaca tgccaaaagg caaactgtcg tggttctagg 1741 gagtcaagaa ggagcagttc acacggccct tgctggagct ctggaggctg agatggatgg 1801 tgcaaaggga aggctgtcct ctggccactt gaaatgtcgc ctgaaaatgg ataaacttag 1861 attgaagggc gtgtcatact ccttgtgtac tgcagcgttc acattcacca agatcccggc 1921 tgaaacactg cacgggacag tcacagtgga ggtacagtac gcagggacag atggaccttg 1981 caaggttcca gctcagatgg cggtggacat gcaaactctg accccagttg ggaggttgat 2041 aaccgctaac cccgtaatca ctgaaagcac tgagaactct aagatgatgc tggaacttga 2101 tccaccattt ggggactctt acattgtcat aggagtcggg gagaagaaga tcacccacca 2161 ctggcacagg agtggcagca ccattggaaa agcatttgaa gccactgtga gaggtgccaa 2221 gagaatggca gtcttgggag acacagcctg ggactttgga tcagttggag gcgctctcaa 2281 ctcattgggc aagggcatcc atcaaatttt tggagcagct ttcaaatcat tgtttggagg 2341 aatgtcctgg ttctcacaaa ttctcattgg aacgttgctg atgtggttgg gtctgaacac 2401 aaagaatgga tctatttccc ttatgtgctt ggccttaggg ggggtgttga tcttcttatc 2461 cacagccgtc tctgctgatg tggggtgctc ggtggacttc tcaaagaagg agacgagatg 2521 cggtacaggg gtgttcgtct ataacgacgt tgaagcctgg agggacaggt acaagtacca 2581 tcctgactcc ccccgtagat tggcagcagc agtcaagcaa gcctgggaag atggtatctg 2641 cgggatctcc tctgtttcaa gaatggaaaa catcatgtgg agatcagtag aaggggagct 2701 caacgcaatc ctggaagaga atggagttca actgacggtc gttgtgggat ctgtaaaaaa 2761 ccccatgtgg agaggtccac agagattgcc cgtgcctgtg aacgagctgc cccacggctg 2821 gaaggcttgg gggaaatcgt acttcgtcag agcagcaaag acaaataaca gctttgtcgt 2881 ggatggtgac acactgaagg aatgcccact caaacataga gcatggaaca gctttcttgt 2941 ggaggatcat gggttcgggg tatttcacac tagtgtctgg ctcaaggtta gagaagatta 3001 ttcattagag tgtgatccag ccgttattgg aacagctgtt aagggaaagg aggctgtaca 3061 cagtgatcta ggctactgga ttgagagtga gaagaatgac acatggaggc tgaagagggc 3121 ccatctgatc gagatgaaaa catgtgaatg gccaaagtcc cacacattgt ggacagatgg 3181 aatagaagag agtgatctga tcatacccaa gtctttagct gggccactca gccatcacaa 3241 taccagagag ggctacagga cccaaatgaa agggccatgg cacagtgaag agcttgaaat 3301 tcggtttgag gaatgcccag gcactaaggt ccacgtggag gaaacatgtg gaacaagagg 3361 accatctctg agatcaacca ctgcaagcgg aagggtgatc gaggaatggt gctgcaggga 3421 gtgcacaatg cccccactgt cgttccgggc taaagatggc tgttggtatg gaatggagat 3481 aaggcccagg aaagaaccag aaagcaactt agtaaggtca atggtgactg caggatcaac 3541 tgatcacatg gaccacttct cccttggagt gcttgtgatc ctgctcatgg tgcaggaagg 3601 gctgaagaag agaatgacca caaagatcat cataagcaca tcaatggcag tgctggtagc 3661 tatgatcctg ggaggatttt caatgagtga cctggctaag cttgcaattt tgatgggtgc 3721 caccttcgcg gaaatgaaca ctggaggaga tgtagctcat ctggcgctga tagcggcatt 3781 caaagtcaga ccagcgttgc tggtatcttt catcttcaga gctaattgga caccccgtga 3841 aagcatgctg ctggccttgg cctcgtgtct tttgcaaact gcgatctccg ccttggaagg 3901 cgacctgatg gttctcatca atggttttgc tttggcctgg ttggcaatac gagcgatggt 3961 tgttccacgc actgataaca tcaccttggc aatcctggct gctctgacac cactggcccg 4021 gggcacactg cttgtggcgt ggagagcagg ccttgctact tgcggggggt ttatgctcct 4081 ctctctgaag ggaaaaggca gtgtgaagaa gaacttacca tttgtcatgg ccctgggact 4141 aaccgctgtg aggctggtcg accccatcaa cgtggtggga ctgctgttac tcacaaggag 4201 tgggaagcgg agctggcccc ctagcgaagt actcacagct gttggcctga tatgcgcatt 4261 ggctggaggg ttcgccaagg cagatataga gatggctggg cccatggccg cggtcggtct 4321 gctaattgtc agttacgtgg tctcaggaaa gagtgtggac atgtacattg aaagagcagg 4381 tgacatcaca tgggaaaaag atgcggaagt cactggaaac agtccccggc tcgatgtggc 4441 gctagatgag agtggtgatt tctccctggt ggaggatgac ggtcccccca tgagagagat 4501 catactcaag gtggtcctga tgaccatctg tggcatgaat ccaatagcca taccctttgc 4561 agctggagcg tggtacgtat acgtgaagac tggaaaaagg agtggtgctc tatgggatgt 4621 gcctgctccc aaggaagtaa aaaaggggga gaccacagat ggagtgtaca gagtaatgac 4681 tcgtagactg ctaggttcaa cacaagttgg agtgggagtt atgcaagagg gggtctttca 4741 cactatgtgg cacgtcacaa aaggatccgc gctgagaagc ggtgaaggga gacttgatcc 4801 atactgggga gatgtcaagc aggatctggt gtcatactgt ggtccatgga agctagatgc 4861 cgcctgggac gggcacagcg aggtgcagct cttggccgtg ccccccggag agagagcgag 4921 gaacatccag actctgcccg gaatatttaa gacaaaggat ggggacattg gagcggttgc 4981 gctggattac ccagcaggaa cttcaggatc tccaatccta gacaagtgtg ggagagtgat 5041 aggactttat ggcaatgggg tcgtgatcaa aaatgggagt tatgttagtg ccatcaccca 5101 agggaggagg gaagaagaga ctcctgttga gtgcttcgag ccctcgatgc tgaagaagaa 5161 gcagctaact gtcttagact tgcatcctgg agctgggaaa accaggagag ttcttcctga 5221 aatagtccgt gaagccataa aaacaagact ccgtactgtg atcttagctc caaccagggt 5281 tgtcgctgct gaaatggagg aggcccttag agggcttcca gtgcgttata tgacaacagc 5341 agtcaatgtc acccactctg gaacagaaat cgtcgactta atgtgccatg ccaccttcac 5401 ttcacgtcta ctacagccaa tcagagtccc caactataat ctgtatatta tggatgaggc 5461 ccacttcaca gatccctcaa gtatagcagc aagaggatac atttcaacaa gggttgagat 5521 gggcgaggcg gctgccatct tcatgaccgc cacgccacca ggaacccgtg acgcatttcc 5581 ggactccaac tcaccaatta tggacaccga agtggaagtc ccagagagag cctggagctc 5641 aggctttgat tgggtgacgg atcattctgg aaaaacagtt tggtttgttc caagcgtgag 5701 gaacggcaat gagatcgcag cttgtctgac aaaggctgga aaacgggtca tacagctcag 5761 cagaaagact tttgagacag agttccagaa aacaaaacat caagagtggg actttgtcgt 5821 gacaactgac atttcagaga tgggcgccaa ctttaaagct gaccgtgtca tagattccag 5881 gagatgccta aagccggtca tacttgatgg cgagagagtc attctggctg gacccatgcc 5941 tgtcacacat gccagcgctg cccagaggag ggggcgcata ggcaggaatc ccaacaaacc 6001 tggagatgag tatctgtatg gaggtgggtg cgcagagact gacgaagacc atgcacactg 6061 gcttgaagca agaatgctcc ttgacaatat ttacctccaa gatggcctca tagcctcgct 6121 ctatcgacct gaggccgaca aagtagcagc cattgaggga gagttcaagc ttaggacgga 6181 gcaaaggaag acctttgtgg aactcatgaa aagaggagat cttcctgttt ggctggccta 6241 tcaggttgca tctgccggaa taacctacac agatagaaga tggtgctttg atggcacgac 6301 caacaacacc ataatggaag atagtgtgcc ggcagaggtg tggaccagac acggagagaa 6361 aagagtgctc aaaccgaggt ggatggacgc cagagtttgt tcagatcatg cggccctgaa 6421 gtcattcaag gagtttgccg ctgggaaaag aggagcggct tttggagtga tggaagccct 6481 gggaacactg ccaggacaca tgacagagag attccaggaa gccattgaca acctcgctgt 6541 gctcatgcgg gcagagactg gaagcaggcc ttacaaagcc gcggcggccc aattgccgga 6601 gaccctagag accataatgc ttttggggtt gctgggaaca gtctcgctgg gaatcttctt 6661 cgtcttgatg aggaacaagg gcatagggaa gatgggcttt ggaatggtga ctcttggggc 6721 cagcgcatgg ctcatgtggc tctcggaaat tgagccagcc agaattgcat gtgtcctcat 6781 tgttgtgttc ctattgctgg tggtgctcat acctgagcca gaaaagcaaa gatctcccca 6841 ggacaaccaa atggcaatca tcatcatggt agcagtaggt cttctgggct tgattaccgc 6901 caatgaactc ggatggttgg agagaacaaa gagtgaccta agccatctaa tgggaaggag 6961 agaggagggg gcaaccatag gattctcaat ggacattgac ctgcggccag cctcagcttg 7021 ggccatctat gctgccttga caactttcat taccccagcc gtccaacatg cagtgaccac 7081 ctcatacaac aactactcct taatggcgat ggccacgcaa gctggagtgt tgtttggtat 7141 gggcaaaggg atgccattct acgcatggga ctttggagtc ccgctgctaa tgataggttg 7201 ctactcacaa ttaacacccc tgaccctaat agtggccatc attttgctcg tggcgcacta 7261 catgtacttg atcccagggc tgcaggcagc agctgcgcgt gctgcccaga agagaacggc 7321 agctggcatc atgaagaacc ctgttgtgga tggaatagtg gtgactgaca ttgacacaat 7381 gacaattgac ccccaagtgg agaaaaagat gggacaggtg ctactcatag cagtagccgt 7441 ctccagcgcc atactgtcgc ggaccgcctg ggggtggggg gaggctgggg ccctgatcac 7501 agccgcaact tccactttgt gggaaggctc tccgaacaag tactggaact cctctacagc 7561 cacttcactg tgtaacattt ttaggggaag ttacttggct ggagcttctc taatctacac 7621 agtaacaaga aacgctggct tggtcaagag acgtgggggt ggaacaggag agaccctggg 7681 agagaaatgg aaggcccgct tgaaccagat gtcggccctg gagttctact cctacaaaaa 7741 gtcaggcatc accgaggtgt gcagagaaga ggcccgccgc gccctcaagg acggtgtggc 7801 aacgggaggc catgctgtgt cccgaggaag tgcaaagctg agatggttgg tggagcgggg 7861 atacctgcag ccctatggaa aggtcattga tcttggatgt ggcagagggg gctggagtta 7921 ctacgccgcc accatccgca aagttcaaga agtgaaagga tacacaaaag gaggccctgg 7981 tcatgaagaa cccgtgttgg tgcaaagcta tgggtggaac atagtccgtc ttaagagtgg 8041 ggtggacgtc tttcatatgg cggctgagcc gtgtgacacg ctgctgtgtg acataggtga 8101 gtcatcatct agtcctgaag tggaagaagc acggacgctc agagtcctct ccatggtggg 8161 ggattggctt gaaaaaagac caggagcctt ttgtataaaa gtgttgtgcc catacaccag 8221 cactatgatg gaaaccctgg agcgactgca gcgtaggtat gggggaggac tggtcagagt 8281 gccactctcc cgcaactcta cacatgagat gtactgggtc tctggagcga aaagcaacac 8341 cataaaaagt gtgtccacca cgagccagct cctcttgggg cgcatggacg ggcctaggag 8401 gccagtgaaa tatgaggagg atgtgaatct cggctctggc acgcgggctg tggtaagctg 8461 cgctgaagct cccaacatga agatcattgg taaccgcatt gaaaggatcc gcagtgagca 8521 cgcggaaacg tggttctttg acgagaacca cccatatagg acatgggctt accatggaag 8581 ctatgaggcc cccacacaag ggtcagcgtc ctctctaata aacggggttg tcaggctcct 8641 gtcaaaaccc tgggatgtgg tgactggagt cacaggaata gccatgaccg acaccacacc 8701 gtatggtcag caaagagttt tcaaggaaaa agtggacact agggtgccag acccccaaga 8761 aggcactcgt caggttatga gcatggtctc ttcctggttg tggaaagagc taggcaaaca 8821 caaacggcca cgagtctgta ccaaagaaga gttcatcaac aaggttcgta gcaatgcagc 8881 attaggggca atatttgaag aggaaaaaga gtggaagact gcagtggaag ctgtgaacga 8941 tccaaggttc tgggctctag tggacaagga aagagagcac cacctgagag gagagtgcca 9001 gagttgtgtg tataacatga tgggaaaaag agaaaagaaa caaggggaat ttggaaaggc 9061 caagggcagc cgcgccatct ggtatatgtg gctaggggct agatttctag agttcgaagc 9121 ccttggattc ttgaacgagg atcactggat ggggagagag aactcaggag gtggtgttga 9181 agggctggga ttacaaagac tcggatatgt cctagaagag atgagtcgta taccaggagg 9241 aaggatgtat gcagatgaca ctgctggctg ggacacccgc attagcaggt ttgatctgga 9301 gaatgaagct ctaatcacca accaaatgga gaaagggcac agggccttgg cattggccat 9361 aatcaagtac acataccaaa acaaagtggt aaaggtcctt agaccagctg aaaaagggaa 9421 aacagttatg gacattattt cgagacaaga ccaaaggggg agcggacaag ttgtcactta 9481 cgctcttaac acatttacca acctagtggt gcaactcatt cggaatatgg aggctgagga 9541 agttctagag atgcaagact tgtggctgct gcggaggtca gagaaagtga ccaactggtt 9601 gcagagcaac ggatgggata ggctcaaacg aatggcagtc agtggagatg attgcgttgt 9661 gaagccaatt gatgataggt ttgcacatgc cctcaggttc ttgaatgata tgggaaaagt 9721 tagaaaggac acacaagagt ggaaaccctc aactggatgg gacaactggg aagaagttcc 9781 gttttgctcc caccacttca acaagctcca tctcaaggac gggaggtcca ttgtggttcc 9841 ctgccgccac caagatgaac tgattggccg ggcccgcgtc tctccagggg cgggatggag 9901 catccgggag actgcttgcc tagcaaaatc atatgcgcag atgtggcagc tcctttattt 9961 ccacagaagg gacctccgac tgatggccaa tgccatttgt tcatctgtgc cagttgactg 10021 ggttccaact gggagaacta cctggtcaat ccatggaaag ggagaatgga tgaccactga 10081 agacatgctt gtggtgtgga acagagtgtg gattgaggag aacgaccaca tggaagacaa 10141 gaccccagtt acgaaatgga cagacattcc ctatttggga aaaagggaag acttgtggtg 10201 tggatctctc atagggcaca gaccgcgcac cacctgggct gagaacatta aaaacacagt 10261 caacatggtg cgcaggatca taggtgatga agaaaagtac atggactacc tatccaccca 10321 agttcgctac ttgggtgaag aagggtctac acctggagtg ctgtaagcac caatcttaat 10381 gttgtcaggc ctgctagtca gccacagctt ggggaaagct gtgcagcctg tgacccccca 10441 ggagaagctg ggaaaccaag cctatagtca ggccgagaac gccatggcac ggaagaagcc 10501 atgctgcctg tgagcccctc agaggatact gagtcaaaaa accccacgcg cttggaggcg 10561 caggatggga aaagaaggtg gcgaccttcc ccacccttca atctggggcc tgaactggag 10621 atcagctgtg gatccccaga agagggacta gtggttagag gagacccccc ggaaaacgca 10681 aaacagcata ttgacgctgg gaaagaccag agactccatg agtttcc
  8. Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome190681906899%0.099%KU321639.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds190031900399%0.099%KJ776791.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds185831858397%0.099%KU312312.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177571775796%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds177031770395%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds175941759496%0.098%EU545988.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164661646696%0.096%HQ234499.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1392513925100%0.089%LC002520.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1392313923100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1392313923100%0.089%KF268948.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1391613916100%0.089%KF268950.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1386713867100%0.089%AY632535.2Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds133291332996%0.089%KF383115.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds133291332996%0.089%HQ234498.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds133081330896%0.089%KF383119.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds132841328496%0.089%DQ859059.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds132701327096%0.089%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132631326396%0.089%HQ234501.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds132001320096%0.088%KF383117.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131831318396%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds129941306296%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds129091290993%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108861088693%0.084%KF383120.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds5077507726%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds5052505226%0.099%KU312313.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3452345218%0.099%KU312315.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds2856419191%0.071%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2686268614%0.099%KJ634273.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds174617469%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds174517459%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds174317439%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds173917399%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds173917399%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds173917399%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds173717379%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds159715978%0.099%KJ873160.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds141514157%0.099%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds138213827%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds134613467%0.098%KM851038.1
  9. LOCUS KU365777 10662 bp RNA linear VRL 26-JAN-2016 DEFINITION Zika virus strain BeH818995 polyprotein gene, complete cds. ACCESSION KU365777 VERSION KU365777.1 GI:975885964 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus; Spondweni virus group. REFERENCE 1 (bases 1 to 10662) AUTHORS Azevedo,R.S.S., Cruz,A.C.R., Nunes,B.T.D., Quieroz,A.L.N., Oliveira,R.S., Medeiros,D.B.A., Rodrigues,D.S.G., Silva,E.V.P., Pantoja,J.A.S., Massafra,J.M.V., Santos,M., Silva,S.P., Lemos,P.S., Santos,A.C.M., Vasconcelos,H.B., Lima,J.A., Rodrigues,S.G., Tesh,R.B., Nunes,M.R.T. and Vasconcelos,P.F.C. TITLE Genome sequences of four Zika virus isolates from Brazil JOURNAL Unpublished REFERENCE 2 (bases 1 to 10662) AUTHORS Azevedo,R.S.S., Cruz,A.C.R., Nunes,B.T.D., Quieroz,A.L.N., Oliveira,R.S., Medeiros,D.B.A., Rodrigues,D.S.G., Silva,E.V.P., Pantoja,J.A.S., Massafra,J.M.V., Santos,M., Silva,S.P., Lemos,P.S., Santos,A.C.M., Vasconcelos,H.B., Lima,J.A., Rodrigues,S.G., Tesh,R.B., Nunes,M.R.T. and Vasconcelos,P.F.C. TITLE Direct Submission JOURNAL Submitted (30-DEC-2015) Center for Technological Innovation, Evandro Chagas Institute, BR 316, Km 07, s/n, Ananindeua, Para 67030-000, Brazil COMMENT EMAIL: [email protected] ##Assembly-Data-START## Assembly method: Mira 4.0 and Geneious 7.0 Sequencing Technology: Ion and 454 ##Assembly-Data-END##. FEATURES Location/Qualifiers source 1..10662 /organism="Zika virus" /mol_type="genomic RNA" /strain="BeH818995" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="2015" CDS 94..10365 /codon_start=1 /product="polyprotein" /protein_id="AMA12084.1" /db_xref="GI:975885965" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVDLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 gtgaatcaga ctgcgacagt tcgagtttga agcgaaagct agcaacagta tcaacaggtt 61 ttattttgga tttggaaacg agagtttctg gtcatgaaaa acccaaaaaa gaaatccgga 121 ggattccgga ttgtcaatat gctaaaacgc ggagtagccc gtgtgagccc ctttgggggc 181 ttgaagaggc tgccagccgg acttctgctg ggtcatgggc ccatcaggat ggtcttggcg 241 attctagcct ttttgagatt cacggcaatc aagccatcac tgggtctcat caatagatgg 301 ggttcagtgg ggaaaaaaga ggctatggaa ataataaaga agttcaagaa agatctggct 361 gccatgctga gaataatcaa tgctaggaag gagaagaaga gacgaggcgc agatactagt 421 gtcggaattg ttggcctcct gctgaccaca gctatggcag cggaggtcac tagacgtggg 481 agtgcatact atatgtactt ggacagaaac gatgctgggg aggccatatc ttttccaacc 541 acattgggga tgaataagtg ttatatacag atcatggatc ttggacacat gtgtgatgcc 601 accatgagct atgaatgccc tatgctggat gagggggtgg aaccagatga cgtcgattgt 661 tggtgcaaca cgacgtcaac ttgggttgtg tacggaacct gccatcacaa aaaaggtgaa 721 gcacggagat ctagaagagc tgtgacgctc ccctcccatt ccactaggaa gctgcaaacg 781 cggtcgcaaa cctggttgga atcaagagaa tacacaaagc acttgattag agtcgaaaat 841 tggatattta ggaaccctgg cttcgcgtta gcagcagctg ccatcgcttg gcttttggga 901 agctcaacga gccaaaaagt catatacttg gtcatgatac tgctgattgc cccggcatac 961 agcatcaggt gcataggagt cagcaatagg gactttgtgg aaggtatgtc aggtgggacc 1021 tgggttgatg ttgtcttgga acatggaggt tgtgtcaccg taatggcaca ggacaaaccg 1081 actgtcgaca tagagctggt tacaacaaca gtcagcaaca tggcggaggt aagatcctac 1141 tgctatgagg catcaatatc agacatggct tcggacagcc gctgcccaac acaaggtgaa 1201 gcctaccttg acaagcaatc agacactcaa tatgtctgca aaagaacgtt agtggacaga 1261 ggctggggaa atggatgtgg actttttggc aaagggagcc tggtgacatg cgctaagttt 1321 gcatgctcca agaaaatgac cgggaagagc atccagccag agaatctgga gtaccggata 1381 atgctgtcag ttcatggctc ccagcacagt gggatgattg ttaatgacac aggacatgaa 1441 actgatgaga atagagcgaa agttgagata acgcccaatt caccaagagc cgaagccacc 1501 ctggggggtt ttggaagcct aggacttgat tgtgaaccga ggacaggcct tgacttttca 1561 gatttgtatt acttgactat gaataacaag cactggttgg ttcacaagga gtggttccac 1621 gacattccat taccttggca cgctggggca gacaccggaa ctccacactg gaacaacaaa 1681 gaagcactgg tagagttcaa ggacgcacat gccaaaaggc aaactgtcgt ggttctaggg 1741 agtcaagaag gagcagttca cacggccctt gctggagctc tggaggctga gatggatggt 1801 gcaaagggaa ggctgtcctc tggccacttg aaatgtcgcc tgaaaatgga taaacttaga 1861 ttgaagggcg tgtcatactc cttgtgtact gcagcgttca cattcaccaa gatcccggct 1921 gaaacactgc acgggacagt cacagtggag gtacagtacg cagggacaga tggaccttgc 1981 aaggttccag ctcagatggc ggtggacatg caaactctga ccccagttgg gaggttgata 2041 accgctaacc ccgtaatcac tgaaagcact gagaactcta agatgatgct ggaacttgat 2101 ccaccatttg gggactctta cattgtcata ggagtcgggg agaagaagat cacccaccac 2161 tggcacagga gtggcagcac cattggaaaa gcatttgaag ccactgtgag aggtgccaag 2221 agaatggcag tcttgggaga cacagcctgg gactttggat cagttggagg cgctctcaac 2281 tcattgggca agggcatcca tcaaattttt ggagcagctt tcaaatcatt gtttggagga 2341 atgtcctggt tctcacaaat tctcattgga acgttgctga tgtggttggg tctgaacaca 2401 aagaatggat ctatttccct tatgtgcttg gccttagggg gagtgttgat cttcttatcc 2461 acagccgtct ctgctgatgt ggggtgctcg gtggacttct caaagaagga gacgagatgc 2521 ggtacagggg tgttcgtcta taacgacgtt gaagcctgga gggacaggta caagtaccat 2581 cctgactccc cccgtagatt ggcagcagca gtcaagcaag cctgggaaga tggtatctgc 2641 gggatctcct ctgtttcaag aatggaaaac atcatgtgga gatcagtaga aggggagctc 2701 aacgcaatcc tggaagagaa tggagttcaa ctgacggtcg ttgtgggatc tgtaaaaaac 2761 cccatgtgga gaggtccaca gagattgccc gtgcctgtga acgagctgcc ccacggctgg 2821 aaggcttggg ggaaatcgta cttcgtcaga gcagcaaaga caaataacag ctttgtcgtg 2881 gatggtgaca cactgaagga atgcccactc aaacatagag catggaacag ctttcttgtg 2941 gaggatcatg ggttcggggt atttcacact agtgtctggc tcaaggttag agaagattat 3001 tcattagagt gtgatccagc cgttattgga acagctgtta agggaaagga ggctgtacac 3061 agtgatctag gctactggat tgagagtgag aagaatgaca catggaggct gaagagggcc 3121 catctgatcg agatgaaaac atgtgaatgg ccaaagtccc acacattgtg gacagatgga 3181 atagaagaga gtgatctgat catacccaag tctttagctg ggccactcag ccatcacaat 3241 accagagagg gctacaggac ccaaatgaaa gggccatggc acagtgaaga gcttgaaatt 3301 cggtttgagg aatgcccagg cactaaggtc cacgtggagg aaacatgtgg aacaagagga 3361 ccatctctga gatcaaccac tgcaagcgga agggtgatcg aggaatggtg ctgcagggag 3421 tgcacaatgc ccccactgtc gttccgggct aaagatggct gttggtatgg aatggagata 3481 aggcccagga aagaaccaga aagcaactta gtaaggtcaa tggtgactgc aggatcaact 3541 gatcacatgg accacttctc ccttggagtg cttgtgattc tgctcatggt gcaggaaggg 3601 ctgaagaaga gaatgaccac aaagatcatc ataagcacat caatggcagt gctggtagct 3661 atgatcctgg gaggattttc aatgagtgac ctggctaagc ttgcaatttt gatgggtgcc 3721 accttcgcgg aaatgaacac tggaggagat gtagctcatc tggcgctgat agcggcattc 3781 aaagtcagac cagcgttgct ggtatctttc atcttcagag ctaattggac accccgtgaa 3841 agcatgctgc tggccttggc ctcgtgtctt ttgcaaactg cgatctccgc cttggaaggc 3901 gacctgatgg ttctcatcaa tggttttgct ttggcctggt tggcaatacg agcgatggtt 3961 gttccacgca ctgataacat caccttggca atcctggctg ctctgacacc actggcccgg 4021 ggcacactgc ttgtggcgtg gagagcaggc cttgctactt gcggggggtt tatgctcctc 4081 tctctgaagg gaaaaggcag tgtgaagaag aacttaccat ttgtcatggc cctgggacta 4141 accgctgtga ggctggtcga ccccatcaac gtggtgggac tgctgttgct cacaaggagt 4201 gggaagcgga gctggccccc tagcgaagta ctcacagctg ttggcctgat atgcgcattg 4261 gctggagggt tcgccaaggc agatatagag atggctgggc ccatggccgc ggtcggtctg 4321 ctaattgtca gttacgtggt ctcaggaaag agtgtggaca tgtacattga aagagcaggt 4381 gacatcacat gggaaaaaga tgcggaagtc actggaaaca gtccccggct cgatgtggcg 4441 ctagatgaga gtggtgattt ctccctggtg gaggatgacg gtccccccat gagagagatc 4501 atactcaagg tggtcctgat gaccatctgt ggcatgaacc caatagccat accctttgca 4561 gctggagcgt ggtacgtata cgtgaagact ggaaaaagga gtggtgctct atgggatgtg 4621 cctgctccca aggaagtaaa aaagggggag accacagatg gagtgtacag agtaatgact 4681 cgtagactgc taggttcaac acaagttgga gtgggagtta tgcaagaggg ggtctttcac 4741 actatgtggc acgtcacaaa aggatccgcg ctgagaagcg gtgaagggag acttgatcca 4801 tactggggag atgtcaagca ggatctggtg tcatactgtg gtccatggaa gctagatgcc 4861 gcctgggacg ggcacagcga ggtgcagctc ttggccgtgc cccccggaga gagagcgagg 4921 aacatccaga ctctgcccgg aatatttaag acaaaggatg gggacattgg agcggttgcg 4981 ctggattacc cagcaggaac ttcaggatct ccaatcctag acaagtgtgg gagagtgata 5041 ggactttatg gcaatggggt cgtgatcaaa aatgggagtt atgttagtgc catcacccaa 5101 gggaggaggg aggaagagac tcctgttgag tgcttcgagc cttcgatgct gaagaagaag 5161 cagctaactg tcttagactt gcatcctgga gctgggaaaa ccaggagagt tcttcctgaa 5221 atagtccgtg aagccataaa aacaagactc cgcaccgtga tcttagctcc aaccagggtt 5281 gtcgctgctg aaatggagga ggcccttaga gggcttccag tgcgttatat gacaacagca 5341 gtcaatgtca cccactctgg aacagaaatc gtcgacttaa tgtgccatgc caccttcact 5401 tcacgtctac tacagccaat cagagtcccc aactataatc tgtatattat ggatgaggcc 5461 cacttcacag atccctcaag tatagcagca agaggataca tttcaacaag ggttgagatg 5521 ggcgaggcgg ctgccatctt catgaccgcc acgccaccag gaacccgtga cgcatttccg 5581 gactccaact caccaattat ggacaccgaa gtggaagtcc cagagagagc ctggagctca 5641 ggctttgatt gggtgacgga tcattctgga aaaacagttt ggtttgttcc aagcgtgagg 5701 aacggcaatg agatcgcagc ttgtctgaca aaggctggaa aacgggtcat acagctcagc 5761 agaaagactt ttgagacaga gttccagaaa acaaaacatc aagagtggga ctttgtcgtg 5821 acaactgaca tttcagagat gggcgccaac tttaaagctg accgtgtcat agattccagg 5881 agatgcctaa agccggtcat acttgatggc gagagagtca ttctggctgg acccatgcct 5941 gtcacacatg ccagcgctgc ccagaggagg gggcgcatag gcaggaatcc caacaaacct 6001 ggagatgagt atctgtatgg aggtgggtgc gcagagactg acgaagacca tgcacactgg 6061 cttgaagcaa gaatgctcct tgacaatatt tacctccaag atggcctcat agcctcgctc 6121 tatcgacctg aggccgacaa agtagcagcc attgagggag agttcaagct taggacggag 6181 caaaggaaga cctttgtgga actcatgaaa agaggagatc ttcctgtttg gctggcctat 6241 caggttgcat ctgccggaat aacctacaca gatagaagat ggtgctttga tggcacgacc 6301 aacaacacca taatggaaga cagtgtgccg gcagaggtgt ggaccagaca cggagagaaa 6361 agagtgctca aaccgaggtg gatggacgcc agagtttgtt cagatcatgc ggccctgaag 6421 tcattcaagg agtttgccgc tgggaaaaga ggagcggctt ttggagtgat ggaagccctg 6481 ggaacactgc caggacacat gacagagaga ttccaggaag ccattgacaa cctcgctgtg 6541 ctcatgcggg cagagactgg aagcaggcct tacaaagccg cggcggccca attgccggag 6601 accctagaga ccattatgct tttggggttg ctgggaacag tctcgctggg aatcttcttc 6661 gtcttgatga ggaacaaggg catagggaag atgggctttg gaatggtgac tcttggggcc 6721 agcgcatggc tcatgtggct ctcggaaatt gagccagcca gaattgcatg tgtcctcatt 6781 gttgtgtttc tattgctggt ggtgctcata cctgagccag aaaagcaaag atctccccag 6841 gacaaccaaa tggcaatcat catcatggta gcagtaggtc ttctgggctt gattaccgcc 6901 aatgaactcg gatggttgga gagaacaaag agtgacctaa gccatctaat gggaaggaga 6961 gaggaggggg caaccatagg attctcaatg gacattgacc tgcggccagc ctcagcttgg 7021 gccatctatg ctgccttgac aactttcatt accccagccg tccaacatgc agtgaccact 7081 tcatacaaca actactcctt aatggcgatg gccacgcaag ctggagtgtt gtttggtatg 7141 ggcaaaggga tgccattcta cgcatgggac tttggagtcc cgctgctaat gataggttgc 7201 tactcacaat taacacccct gaccctaata gtggccatca ttttgctcgt ggcgcactac 7261 atgtacttga tcccagggct gcaggcagca gctgcgcgtg ctgcccagaa gagaacggca 7321 gctggcatca tgaagaaccc tgttgtggat ggaatagtgg tgactgacat tgacacaatg 7381 acaattgacc cccaagtgga gaaaaagatg ggacaggtgc tactcatagc agtagccgtc 7441 tccagcgcca tactgtcgcg gaccgcctgg gggtgggggg aggctggggc cctgatcaca 7501 gccgcaactt ccactttgtg ggaaggctct ccgaacaagt actggaactc ctctacagcc 7561 acttcactgt gtaacatttt taggggaagt tacttggctg gagcttctct aatctacaca 7621 gtaacaagaa acgctggctt ggtcaagaga cgtgggggtg gaacaggaga gaccctggga 7681 gagaaatgga aggcccgctt gaaccagatg tcggccctgg agttctactc ctacaaaaag 7741 tcaggcatca ccgaggtgtg cagagaagag gcccgccgcg ccctcaagga cggtgtggca 7801 acgggaggcc atgctgtgtc ccgaggaagt gcaaagctga gatggttggt ggagcgggga 7861 tacctgcagc cctatggaaa ggtcattgat cttggatgtg gcagaggggg ctggagttac 7921 tacgccgcca ccatccgcaa agttcaagaa gtgaaaggat acacaaaagg aggccctggt 7981 catgaagaac ccgtgttggt gcaaagctat gggtggaaca tagtccgtct taagagtggg 8041 gtggacgtct ttcatatggc ggctgagccg tgtgacacgt tgctgtgtga cataggtgag 8101 tcatcatcta gtcctgaagt ggaagaagca cggacgctca gagtcctctc catggtgggg 8161 gattggcttg aaaaaagacc aggagccttt tgtataaagg tgttgtgccc atacaccagc 8221 actatgatgg aaaccctgga gcgactgcag cgtaggtatg ggggaggact ggtcagagtg 8281 ccactctccc gcaactctac acatgagatg tattgggtct ctggagcgaa aagcaacacc 8341 ataaaaagtg tgtccaccac gagccagctc ctcttggggc gcatggacgg gcctaggagg 8401 ccagtgaaat atgaggagga tgtggatctc ggctctggca cgcgggctgt ggtaagctgc 8461 gctgaagctc ccaacatgaa gatcattggt aaccgcattg aaaggatccg cagtgagcac 8521 gcggaaacgt ggttctttga cgagaaccac ccatatagga catgggctta ccatggaagc 8581 tatgaggccc ccacacaagg gtcagcgtcc tctctaataa acggggttgt caggctcctg 8641 tcaaaaccct gggatgtggt gactggagtc acaggaatag ccatgaccga caccacaccg 8701 tatggtcagc aaagagtttt caaggaaaaa gtggacacta gggtgccaga cccccaagaa 8761 ggcactcgtc aggttatgag catggtctct tcctggttgt ggaaagagct aggcaaacac 8821 aaacggccac gagtctgtac caaagaagag ttcatcaaca aggttcgtag caatgcagca 8881 ttaggggcaa tatttgaaga ggaaaaagag tggaagactg cagtggaagc tgtgaacgat 8941 ccaaggttct gggctctagt ggataaggaa agagagcacc acctgagagg agagtgccag 9001 agttgtgtgt acaacatgat gggaaaaaga gaaaagaaac aaggggaatt tggaaaggcc 9061 aagggcagcc gcgccatctg gtatatgtgg ctaggggcta gatttctaga gttcgaagcc 9121 cttggattct tgaacgagga tcactggatg gggagagaga actcaggagg tggtgttgaa 9181 gggctgggat tacaaagact cggatatgtc ctagaagaga tgagtcgtat accaggagga 9241 aggatgtatg cagatgacac tgctggctgg gacacccgca tcagcaggtt tgatctggag 9301 aatgaagctc taatcaccaa ccaaatggaa aaagggcaca gggccttggc attggccata 9361 atcaagtaca cataccaaaa caaagtggta aaggtcctta gaccagctga aaaagggaaa 9421 acagttatgg acattatttc gagacaagac caaaggggga gcggacaagt tgtcacttac 9481 gctcttaaca catttaccaa cctagtggtg caactcattc ggaatatgga ggctgaggaa 9541 gttctagaga tgcaagactt gtggctgctg cggaggtcag agaaagtgac caactggttg 9601 cagagcaacg gatgggatag gctcaaacga atggcagtca gtggagatga ttgcgttgtg 9661 aagccaattg atgataggtt tgcacatgcc ctcaggttct tgaatgatat gggaaaagtt 9721 aggaaggaca cacaagagtg gaaaccctca actggatggg acaactggga agaagttccg 9781 ttttgctccc accacttcaa caagctccat ctcaaggacg ggaggtccat tgtggttccc 9841 tgccgccacc aagatgaact gattggccgg gcccgcgtct ctccaggggc gggatggagc 9901 atccgggaga ctgcttgcct agcaaaatca tatgcgcaaa tgtggcagct cctttatttc 9961 cacagaaggg acctccgact gatggccaat gccatttgtt catctgtgcc agttgactgg 10021 gttccaactg ggagaactac ctggtcaatc catggaaagg gagaatggat gaccactgaa 10081 gacatgcttg tggtgtggaa cagagtgtgg attgaggaga acgaccacat ggaagacaag 10141 accccagtta cgaaatggac agacatcccc tatttgggaa aaagggaaga cttgtggtgt 10201 ggatctctca tagggcacag accgcgcacc acctgggctg agaacattaa aaacacagtc 10261 aacatggtgc gcaggatcat aggtgatgaa gaaaagtaca tggactacct atccacccaa 10321 gttcgctact tgggtgaaga agggtctaca cctggagtgc tgtaagcacc agtcttaatg 10381 ttgtcaggcc tgctagtcag ccacagcttg gggaaagctg tgcagcctgt gaccccccag 10441 gagaagctgg gaaaccaagc ctatagtcag gccgagaacg ccatggcacg gaagaagcca 10501 tgctgcctgt gagcccctca gaggacactg agtcaaaaaa ccccacgcgc ttggaggcgc 10561 aggatgggaa aagaaggtgg cgaccttccc cacccttcaa tctggggcct gaactggaga 10621 tcagctgtgg atctccagaa gagggactag tggttagagg ag
  10. Evandro Chagas Institute has released four full Zika sequences from Brazil.
  11. Zika 101January 28, 2016By: Dr. Anne Schuchat, Principal Deputy Director, CDCSummary: The Zika virus is spread to people through the bite of infected mosquitos. About 1 in 5 people who get infected with Zika virus will show symptoms.In the past several weeks, increased cases of Zika virus disease (Zika) have been reported in South and Central America, and to a limited degree in the Commonwealth of Puerto Rico, a US territory, and the US Virgin Islands. Zika is a little known illness spread by a certain type of mosquito. Although most people who may be exposed to Zika virus will have only mild or no symptoms, there has been evidence linking Zika virus to negative effects on pregnancies in some cases, which has received widespread public attention. We understand that this news is concerning, especially to pregnant women and their families who may travel to or live in affected areas. Here are some answers to common questions about Zika. What is Zika? The Zika virus is spread to people through the bite of infected mosquitos. About 1 in 5 people who get infected with Zika virus will show symptoms. Most of those who get sick experience only mild symptoms that last about a week. The most common symptoms are fever, rash, joint pain, and red eyes (conjunctivitis). It’s rare for someone infected with Zika to become seriously sick or die. Zika is not spread through routine direct person-to-person contact. Zika and Pregnancy While anyone can be infected with Zika, what makes it stand out from other mosquito-borne illnesses, is the effect it appears to have on pregnancy. We know that Zika can spread from a pregnant mother to her baby, and that infection during pregnancy may be linked to birth defects, such as a condition called microcephaly (when a baby’s head is smaller than expected when compared with babies of the same sex and age). Our understanding of the link between Zika and pregnancy is evolving. Because of the possible risk to unborn babies, CDC recommends that women who are pregnant or trying to become pregnant consider postponing travel to areas with local Zika transmission. If you are pregnant and must travel to one of these areas, talk to your healthcare provider first and strictly follow steps to prevent mosquito bites. As we learn more about this disease, our guidance may change based on new information important for the public to know. How to Protect Yourself from Zika Because there are currently no vaccines or treatment for Zika, the best way to protect yourself is toprevent mosquito bites. You can do this by wearing long-sleeved shirts and long pants and treating your clothing and other items with permethrin. Use an Environmental Protection Agency (EPA)-registered insect repellant as directed. You shouldn’t use insect repellant on babies younger than 2 months of age; instead, dress your baby in clothing that covers arms and legs and cover the crib, stroller, or baby carrier with mosquito netting. If you’ve recently traveled to an area with Zika and develop a rash, joint pain, or red eyes, tell your doctor that you traveled to a country with Zika virus. Because the symptoms of Zika are similar to dengue and chikungunya, special blood tests may be needed. If you get sick with Zika, make sure to get plenty of rest and fluids, and take medicines like acetaminophen or paracetamol to reduce fever and pain. Don’t take aspirin or other non-steroidal anti-inflammatory drugs like ibuprofen. You can also prevent others from getting sick by avoiding mosquito bites during the first week of illness following the same steps outlined above, because Zika virus can stay in the blood during the first week of infection. Zika in the Continental US? Although Zika has been in the news recently, outbreaks of Zika have previously been reported in tropical Africa, Southeast Asia, and the Pacific Islands. In May 2015, the Pan American Health Organization issued an alert for the first confirmed infection in Brazil. Since then, local transmission of Zika virus has been reported in more than 20 other countries and territories in Latin America and the Caribbean. Because the mosquitoes that spread Zika are found throughout the tropics, outbreaks of the disease will likely continue. Zika is currently not found in the continental United States, but cases of Zika have been reported in returning travelers. Because of the recent outbreaks in the Americas, we expect to see more cases of Zika in travelers visiting or returning to the United States. Many areas in the continental U.S., primarily in the Southeast and Gulf Coast regions, have mosquitoes that can become infected with and spread Zika virus, so it is possible that these imported cases could result in local spread of the virus in some areas of the United States. Limited local transmission may occur in the mainland United States, but we believe it is unlikely that we will see widespread transmission of Zika in the mainland United States. Recent outbreaks in the United States of chikungunya and dengue were quite small compared with outbreaks in South America. What HHS is Doing In response to recent outbreaks of Zika, CDC issued travel notices for people traveling to areas where Zika virus transmission is ongoing. Specific areas where Zika virus transmission is ongoing are often difficult to determine and are likely to keep changing over time. It’s important to keep up to date on CDC’s travel notices for recommendations on what to do if you travel to an area with Zika. CDC has also provided guidance, in consultation with major medical societies, to the health care community. We are working with countries with widespread transmission of Zika to learn as much about the virus as we can, as quickly as we can. Our goal is to prevent Zika infection, especially among women who are pregnant or thinking about getting pregnant, and to help those who have traveled to areas with widespread transmission learn as quickly as possible if they have been infected. We are preparing for additional potential Zika cases in the United States by working with state and local health departments and educating doctors and other healthcare providers on how to test and care for patients. We are working with government scientists, outside experts, and the private sector to speed the development of tests, treatments and vaccines and improved mosquito-control methods. CDC and the National Institutes of Health are also increasing their support for scientific research to learn more about this disease so that advice can be updated and new safeguards and medical responses can be developed. NIH is also supporting research to develop rapid diagnostics, treatments, and vaccine candidates. http://www.hhs.gov/blog/2016/01/28/zika-101.html
  12. niman replied to niman's topic in WHO News
    A new mosquito-borne threat to pregnant women in BrazilMarcia TriunfolPublished Online: 23 December 2015DOI: http://dx.doi.org/10.1016/S1473-3099(15)00548-4 Article Info SummaryFull Text An apparent connection between the emergence of Zika virus and an unusual rise in microcephaly has alarmed Brazilian authorities. Marcia Triunfol reports. In April, 2015, a few cases of Zika virus infection were reported in Bahia, a state to the northeast of Brazil. Patients developed a rash, conjunctivitis, arthralgia, and mild fever. Initially, it seemed that the newcomer would be just one more virus causing a dengue-like illness in a population that has been struggling against dengue for too long. However, in October that year, doctors and health authorities in Brazil noticed an increasing number of newborn babies with microcephaly in Pernambuco, another state in the northeast region, while new cases of microcephaly continued to appear in other states. On Dec 15, the Ministry of Health confirmed 134 cases of microcephaly believed to be associated with Zika virus infection—a further 2165 cases in 549 counties in 20 states are under investigation. All confirmed cases are limited to four states in the northeast region of Brazil. Rio Grande do Norte, the state with the highest incidence of congenital microcephaly, jumped from one case in 2014 to 35 cases in 2015. From 2010 to the beginning of 2015, the incidence of microcephaly in the country had been around 180 cases per year. Interestingly, Bahia, which was one of the first states where Zika virus was isolated, does not have any confirmed cases of microcephaly yet reported. Amilcar Tanuri, a virologist at the Federal University of Rio de Janeiro, is yet to be convinced about the direct association between Zika and congenital microcephaly. “The contrasting outcome of Zika infection in mothers and their babies is intriguing”, he says. Although the mother develops an almost imperceptible rash and mild cold-like symptoms, the baby can develop microcephaly and even die, yet Tanuri feels other elements, and possibly other viruses, are contributing to the high incidence of microcephaly. Ana Bispo, a virologist and head of the Flavivirus Laboratory at Instituto Oswaldo Cruz in Rio de Janeiro and the first researcher to partly sequence the virus from the amniotic fluid of two mothers whose babies were affected by microcephaly, believes that the finding is a “strong indication of the correlation between Zika virus and the increasing number of microcephaly cases observed in Brazil”. Zika is an arbovirus mainly transmitted by the Aedes aegypti mosquito. The virus is closely related to other flaviviruses, including dengue and chikungunya. Two types of Zika virus, the African and the Asian, have been identified. Phylogenetic analysis has showed that the virus circulating in Brazil is of the Asian type, and is similar to the one associated with an outbreak in French Polynesia in 2013. Although there are no reports in the scientific literature of an association between Zika virus and congenital microcephaly, a Rapid Risk Assessment alert from the European Centre for Disease Prevention and Control states that health authorities in French Polynesia have recently reported increasing numbers of cases of CNS malformations and polymalformative syndrome during 2014–15. Didier Musso, director of the Emerging Infectious Diseases Unit at Institut Louis Malardé in Papeete, French Polynesia, feels it is possible that co-circulation of Zika virus and other viruses are involved. This possibility could explain not only the potential association between Zika and microcephaly but also the high incidence first noted in French Polynesia and now in Brazil of Guillain–Barré syndrome—an autoimmune disorder that is also being associated with Zika infection. According to a recent study uploaded to bioRxiv, a biological research preprint server, researchers at the University of São Paulo and Institut Pasteur de Dakar suggest that the Zika virus has gone through important changes that might aid its recent urban expansion. According to Caio Cesar de Melo Freire, “the virus has adapted to use the same cellular machinery used by its host, increasing its replication and titers. For instance, it uses the same codons used by the host's housekeeping genes”. Zika outbreaks are also being reported in other countries in South and Central America. According to WHO and the Pan American Health Organization, autochthonous cases of Zika have been detected in Colombia, El Salvador, Guatemala, Mexico, Paraguay, Suriname, and Venezuela. Yet, among all countries where Zika has been detected, Brazil is currently the only one where the outbreak seems to be strongly associated with a very high incidence of microcephaly. However, the high incidence of microcephaly is not the only peculiarity associated with Zika virus in Brazil. An initial study done in the state of Bahia shows that most individuals (six of seven) infected at the beginning of the outbreak were women aged around 30 years. Later, data analysis of 40 women presented by Alexander Vargas, at the Ministry of Health, showed that all mothers whose newborn babies had microcephaly, between August and October, 2015, in Pernambuco, belong to low-income families. More data is needed to establish if Zika has any preference for particular hosts. For now, the Ministry of Health has recommended that pregnant women use repellents at all times. Cláudio Maierovitch, the director of the communicable disease surveillance department at the Ministry of Health has stated that now is not a good time to get pregnant in high-risk areas in Brazil. It is not clear how exactly the virus arrived in Brazil. Although some suspect that the Football World Cup in 2014 might have brought to Brazil an even greater disgrace than the 7-1 loss against Germany, researchers in French Polynesia highlight that none of the Pacific countries with circulating Zika participated in the games and suggest that the Va'a World Sprint Championship canoe race is a more likely factor. The canoe race took place in Rio de Janeiro in August, 2014, and athletes from French Polynesia, New Caledonia, the Cook Islands, and Easter Island—all countries with high incidence of Zika at the time—participated in the event. More recently, cases of chikungunya infection, which is also transmitted by A aegypti, are increasing in the country. The strategy adopted by health authorities to combat all three viruses at once, is to educate the population on how to tackle mosquito proliferation. On the scientific front, studies are underway on the dissemination of mosquitoes infected with wolbachia, a bacterium that infects arthropod species including A aegypti. Pedro Lagerblad de Oliveira of the Molecular Entomology Unit of the National Institute of Science and Technology says studies have shown that virus infection and transmission to human beings is impaired in mosquitoes infected with wolbachi because the bacterium does not coexist with other pathogens. Also, the offspring of an infected female mosquito, of either sex, carry the wolbachi infection, and the offspring of a non-infected female with an infected male are sterile. In time, wolbachia-infected mosquitoes are expected to become predominant. The strategy seems effective against dengue, chikungunya, and malaria; whether it will also work against Zika virus remains to be seen. http://www.thelancet.com/journals/laninf/article/PIIS1473-3099(15)00548-4/fulltext
  13. niman replied to niman's topic in WHO News
    Editorial Meet dengue's cousin, ZikaErin Archer Kelser, Show more doi:10.1016/j.micinf.2015.12.003Get rights and content It's too early to know how alarmed we should be about the spread of Zika virus (ZIKV). The good news is that ZIKV currently presents as a relatively mild and self-limiting illness, with low hospitalization rates [1], [2], [3], [4], [5], [6] and [7]. The bad news is that ZIKV is spreading rapidly worldwide [1], [4], [8] and [9], is challenging to diagnose [1], [2], [3], [4],[5], [6], [7], [9] and [10], and may have effects following the illness including autoimmune diseases like Guillain-Barré syndrome (GBS) [2], [4], [5] and [11], other neurological disorders [2] and [4] and birth defects [12]. The World Health Organization (WHO) has warned its Member States that ZIKV has the potential to place an additional burden on local health systems and recommends development of ZIKV testing capabilities and public education campaigns for prevention of ZIKV [1], [8] and [13]. 1. About ZIKVZIKV is a mosquito-borne ssRNA flavivirus of the Flaviviridae family that includes dengue virus (DENV), West Nile Virus (WNV), Japanese encephalitis and Yellow Fever. ZIKV's closest relative is Spondweni virus [1], [3] and [6]. Comprehensive genetic comparison has revealed subclades reflecting 2 lineages, one African and one Asian [4]. ZIKV is suspected of having widespread occurrence in Africa and Southeast Asia [5]. Humans and non-human primates are the only known reservoir [3] and [9] but one study did find antibody in rodents [3]. ZIKV has the ability to infect multiple species of the Aedes genus of mosquito [1], [5], [6],[9], [11] and [15], the same genus that spreads DENV [3], [6], [7] and [8] and Chikungunya (CHIK) [7]. Perinatal and transfusion transmission of ZIKV are theoretically possible [1], [2] and [7], and sexual transmission has also been reported [1], [4],[7] and [15]. 2. History and outbreaksFirst identified in a rhesus monkey in the Zika forest of Uganda in 1947, the first human cases were identified in Nigeria in 1954. Although a small cluster of 7 cases was reported in Java, Indonesia, in 1977 [5] and [14], no significant human outbreaks had been documented before an outbreak on Yap Island in the Federated States of Micronesia in 2007 [1], [2], [3], [5], [6], [9] and [14]. Duffy et al. estimate that approximately 900 people were affected, three-fourths of Yap's population at the time [9]. 2013–2014 had an outbreak in French Polynesia and New Caledonia [2], [3], [4], [10] and [11]. In French Polynesia, there were over 8750 suspected cases and 383 cases confirmed [4], an estimated 11% of the population [1]. In February 2014, autochthonous transmission was reported on Easter Island, marking ZIKV's arrival in the Americas. By May 2015, WHO warned of ZIKA in Brazil [4], and October 2015 brought WHO warnings of ZIKA transmission in Colombia [8]. On November 11, 2015, WHO warned of another country in South America with local ZIKV transmission, Suriname [13]. In 2015, outbreaks in Vanautu, the Solomon Islands and New Caledonia have also been reported [4]. 3. Diagnostic challengesZIKV is difficult to diagnose because it shares vectors, geographic distribution and symptoms with DENV [1], [2], [5] and [6] and CHIK [5] and [6], making diagnosis by clinical signs and epidemiology unreliable [5] and [6]. DENV, ZIKV and CHIK all present clinically with fever, maculopapular rash, conjunctivitis and arthralgia, and are sometimes co-circulating in the same areas [5] and [6] or co-infecting patients [10]. Given the potential severity of illness from dengue virus (DENV), it is particularly important to distinguish between the two (see Table 1). Table 1.Comparison of the symptoms, morbidity and mortality, clinical management, sequelae and vectors for dengue virus (DENV) versus Zika virus (ZIKV), 2015. (Table by Erin Archer Kelser). Dengue virus (DENV)Zika virus (ZIKV)Signs and symptoms-Maculopapular rash, myalgias and arthralgias, conjunctivitis -Temp >40 °C, plus 2 of the following: severe headache, retro-orbital pain, myalgias and arthralgias, nausea, vomiting [21] -Can have 3 phases: 1)the acute febrile phase, 2) on day 3–7, a critical (plasma leak) phase that often presents with defervescence and capillary permeability, an increase in hematocrit and drop in platelets, bleeding, shock, organ failure and respiratory distress, congestive heart failure, 3) a recovery (reabsorbtion) phase [20] and [21] -Symptoms usually 2–7 days [21] -Maculopapular rash, myalgias and arthralgias, conjunctivitis -Temp <38.5 [1] --joint swelling (especially hands and feet), headache, retro-orbital pain [1],[2], [3], [4] and [14] -Self-limiting, with symptoms 2–7 days[1], [2], [4] and [14] Morbidity and mortality-Suspected 390 million infected/year -Approx 1/4 infected symptomatic -Approx 500,000 hospitalizations/year where 2.5% die (approx 12,500 deaths/year) [22] -# cases not yet known -Approx 1/4 of infections believed to be symptomatic[1], [7] and [11] -Hospitalization is rare [1], [2], [3], [4],[5], [6] and [7] Clinical management-No NSAIDS because of risk of bleeding -Close assessment of hydration, bleeding status and signs of organ failure or respiratory distress -If severe/hemhorragic disease, see detailed WHO guidelines [20] and [21] -Symptom management with analgesics and anti-pyretics [7], [8], [9],[10], [11], [12],[13] and [14]NSAIDs acceptable if dengue ruled out[14] Long-term effects and sequelae-Long-term effects documented up to 2 years after illness [17] -Link to Guillan-Barre, encephalitis and other neuro syndromes, autoimmune disease [17] and [18] -No long-term effects known. -Possible link to Guillain-Barre, encephalitis, other neuro syndromes, autoimmune diseases, especially if previously infected with DENV [2],[4] and [11] Primary vectorsAedes aegypti, Ae. Albopictus [21] and [22]Multiple Aedes spp [1],[5], [6], [9] and [11].Table options Lab confirmation is recommended for ZIKV diagnosis, but lab confirmation presents its own set of challenges. Although it is unlikely that IgM results will cross-react with an alphavirus like CHIK [9], cross-reactivity of ZIKV IgM with other flaviruses (especially DENV) has been widely reported [1], [2], [3], [5], [7], [9], [10], [14] and [16]. Current testing recommendations are to obtain RT-PCR by urine or saliva within the first 5 or 6 days of illness [1], [4], [5], [14] and [16], with highest concentrations found in saliva early in the disease course, but possibly remaining detectable for longer in the urine[4] and [5]. In the French Polynesia outbreak, some cases had positive ZIKV RT-PCR urine results more than 10 days after symptom onset [4]. If serology is performed, an acute phase should be drawn from day 6 onward with a convalescent serum drawn 2–3 weeks later [3] and [16]. Lanciotti notes that false positives for ZIKV seem more likely if ZIKV is not the first flavivirus that the patient has encountered [5], but cross-reactivity has also been reported in primary infected patients[1]. If cross-reactivity is suspected, plaque reduction neutralization testing (PRNT) can help to discriminate between cross-reacting antibodies [5], [6], [7], [9], [11] and [16]. If an isolated DENV positive titer presents with other negative results, diagnostic suspicion should be raised for other flaviviruses [1] and [2]. Pan-flavivirus assays with subsequent sequencing analysis can also be performed [4]. 4. Possible sequelaeThere have been reports of an increase in Guillain-Barré syndrome (GBS) syndrome (GBS) [2], [4] and [5] and other autoimmune [4] and neurological syndromes [2] in the context of ZIKV outbreaks, but it is not known how many of these patients may have been co-infected or previously infected with DENV, which may increase the risk [2], [11],[17] and [18]. In the French Polynesia outbreak, 74 patients presented with neurological or autoimmune illness who had symptoms consistent with ZIKV in the previous days; 42 of these patients were diagnosed with GBS [4]. This was a 20-fold increase over baseline[5]. Oeler et al. speculate that this increase in GBS cases in the presence of ZIKV may reveal the genetic evolution of the virus to a more pathogenic genotype, a particular susceptibility in the Polynesian population, or that previous DENV illness may predispose patients to GBS via sequential arboviral immune stimulation [11]. Most recently, Brazil has declared a state of emergency because of an alarming increase this year of microcephaly in Pernambuco. The baseline rate for this area of microcephaly is 10 cases per year [19]. As of November 9, 141 cases of microcephaly have been reported in Pernambuco. Although the cause is undetermined at this time, ZIKV was isolated from the amniotic fluid of two of the mothers. On November 24, 2015, health officials in French Polynesia also reported an increase of congenital central nervous system malformations, coinciding with their own outbreak from 2013 to 2014 [12]. 5. Vectors and vector controlPrevention of ZIKV is directed at minimizing breeding sites and contact with Aedesmosquitoes Fig. 1. Aedes often live around buildings and in urban areas. They are active during daylight hours, especially near dawn and dusk, and they have a variety of artificial and natural breeding sites. People in endemic areas are encouraged to use insect repellent, wear light-colored long sleeves and pants and inhabit buildings that utilize air conditioning or window and door screens [1], [8] and [4]. Bed nets are recommended for residents and travelers who sleep during the day [1] and infants under 3 months old, upon whom insect repellent should not be used [6]. Fig. 1. Aedes aegypti mosquito. (Photo by James Gathany, Centers for Disease Control and Prevention. 2006). Figure options Concerns exist that other Aedes spp. will become competent vectors for ZIKV [1], [3],[4] and [5]. Outbreaks in Yap and other regions have shown that even physically isolated communities can experience rapid ZIKV spread via travel and commerce [3], [5] and [9]. The Asian lineage particularly seems to have high epidemic potential [4]. Until recently, it may have been easy to write off ZIKV as a mild illness, part of the differential diagnosis for mild rash illness, but ZIKV is showing itself to be more than that. It has become a confounding variable in the fight against DENV, a marker of rapid arboviral disease spread in the age of jet travel and commerce, and ZIKV continues to present us with mysteries—Does ZIKV cause GBS or other autoimmune syndromes, and is it more likely when combined with DENV or other flaviruses? Can ZIKV cause congenital microcephaly or other birth defects? On November 29, 2015, the Brazilian health ministry reported the first three suspected deaths to be caused by ZIKV. Until we test and observe more cases of ZIKV, morbidity and mortality from ZIKV will remain unclear. Conflict of interestNo conflicts to declare. References[1]World Health OrganizationWestern Pacific region (WPRO) Zika virus (2015) http://www.wpro.who.int/mediacentre/factsheets/fs_05182015_zika/en/ [2]European Centre for Disease Prevention and ControlRapid risk assessment: zika virus infection outbreak, French Polynesia (14 February 2014) http://docs.google.com/viewer?url=http://ecdc.europa.eu/en/publications/Publications/Zika-virus-French-Polynesia-rapid-risk-assessment.pdf?time=0 [3]E.B. HayesZika virus outside Africa Emerg Infect Dis, 15 (2009), pp. 1347–1350 View Record in Scopus | Full Text via CrossRef | Citing articles (48)[4]European Centre for Disease Prevention and ControlRapid risk assessment: zika virus infection outbreak, Brazil and the Pacific region (25 May 2015) http://ecdc.europa.eu/en/publications/Publications/rapid-risk-assessment-Zika%20virus-south-america-Brazil-2015.pdf [5]R.S. Lanciotti, O.L. Kosoy, J.J. Laven, J.O. Velez, A.J. Lambert, A.J. Johnson, et al.Genetic and serologic properties of Zika virus associated with an epidemic, Yap State, Micronesia, 2007 Emerg Infect Dis, 14 (2008), pp. 1232–1239 View Record in Scopus | Full Text via CrossRef | Citing articles (47)[6]G.S. Campos, A.C. Bandeira, S.I. SardiZika virus outbreak, Bahia, Brazil Emerg Infect Dis, 21 (2015), pp. 1885–1886 View Record in Scopus | Full Text via CrossRef | Citing articles (4)[7]Centers for Disease Control and PreventionZika virus (2015) http://www.cdc.gov/zika/index.html [8]World Health OrganizationZika virus infection – Brazil and Colombia (21 Oct 2015) http://www.who.int/csr/don/21-october-2015-zika/en/ [9]M.R. Duffy, T.H. Chen, W.T. Hancock, A.M. Powers, J.L. Kool, R.S. Lanciotti, et al.Zika virus outbreak on Yap island, Federated States of Micronesia N Engl J Med, 360 (2009), pp. 2536–2543 View Record in Scopus | Full Text via CrossRef | Citing articles (79)[10]M. Dupont-Rouzeyrol, O. O'Connor, E. Calvez, M. Daures, M. John, J.P. Grangeon, et al.Co-infection with Zika and dengue viruses in 2 patients, New Caledonia, 2014 Emerg Infect Dis, 21 (2015), pp. 381–382 View Record in Scopus | Full Text via CrossRef | Citing articles (6)[11]E. Oehler, L. Watrin, P. Larre, I. Leparc-Goffart, S. Lastere, F. Valour, et al.Zika virus infection complicated by Guillain-Barré syndrome – case report, French Polynesia, December 2013 Euro Surveill, 19 (2014) pii 20720 [12]European Centre for Disease Prevention and ControlRapid risk assessment: microcephaly in brazil potentially linked to the Zika virus epidemic (24 Nov 2015) http://ecdc.europa.eu/en/publications/Publications/zika-microcephaly-Brazil-rapid-risk-assessment-Nov-2015.pdf [13]World Health OrganizationZika virus infection – suriname (13 Nov 2015) http://www.who.int/csr/don/13-november-2015-zika/en/ [14]European Centre for Disease Prevention and ControlZika virus infection: factsheet for health professionals (2015) http://ecdc.europa.eu/en/healthtopics/zika_virus_infection/factsheet-health-professionals/Pages/factsheet_health_professionals.aspx [15]B.D. Foy, K.C. Kobylinski, J.L. Chilson Foy, B.J. Blitvich, A. Travassos da Rosa, A.D. Haddow, et al.Probable non–vector-borne transmission of Zika virus, Colorado, USA Emerg Infect Dis, 17 (2011), pp. 880–882 View Record in Scopus | Full Text via CrossRef | Citing articles (35)[16]World Health Organization and Pan American Health OrganizationZika Virus (ZIKV) surveillance in the Americas: interim guidance for laboratory detection and diagnosis (2015) Available at: http://www.paho.org/hq/index.php?option=com_topics&view=article&id=427&Itemid=41484&lang=en [17]G. Garcia, N. Gonzalez, A.B. Perez, B. Sierra, E. Aguirre, D. Rizo, et al.Long-term persistence of clinical symptoms in dengue-infected persons and its association with immunological disorders Int J Infect Dis, 15 (2011), pp. e38–e43 Article | PDF (189 K) | View Record in Scopus | Citing articles (28)[18]O. SimonAcute polyradiculoneuropathy and dengue fever infection Presentation at Journée Scientifique de l'IPNC (21 November 2013) Available at: http://www.institutpasteur.nc/wp-content/uploads/2013/11/S2-03-O-Simon.pdf [19]World Health Organization and Pan American Health OrganizationEpidemiological Alert: Increase of Microcephaly in the Northeast of Brazil (17 November 2015) http://www.paho.org/hq/index.php?option=com_docman&task=doc_view&Itemid=270&gid=32285=en [20]Centers for Disease Control and Prevention. Clinical guidance: dengue virus. http://www.cdc.gov/dengue/clinicalLab/clinical.html. [21]World Health Organization and Special Programme for Research and Training in Tropical DiseasesDengue guidelines for diagnosis, treatment, prevention and control (2009) http://www.who.int/tdr/publications/documents/dengue-diagnosis.pdf [22]World Health OrganizationDengue and severe dengue Factsheet, 117 (2015) http://www.who.int/mediacentre/factsheets/fs117/en/ Tel.: +1 415 609 3608.Copyright © 2015 Institut Pasteur. Published by Elsevier Masson SAS All rights reserved. Note to users: Corrected proofs are Articles in Press that contain the authors' corrections. Final citation details, e.g., volume and/or issue number, publication year and page numbers, still need to be added and the text might change before final publication. Although corrected proofs do not have all bibliographic details available yet, they can already be cited using the year of online publication and the DOI , as follows: author(s), article title, Publication (year), DOI. Please consult the journal's reference style for the exact appearance of these elements, abbreviation of journal names and use of punctuation. When the final article is assigned to volumes/issues of the Publication, the Article in Press version will be removed and the final version will appear in the associated published volumes/issues of the Publication. The date the article was first made available online will be carried over. http://www.sciencedirect.com/science/article/pii/S1286457915002592
  14. niman replied to niman's topic in WHO News
    The Opinion Pages | EDITORIALZika Virus Requires an Urgent ResponseBy THE EDITORIAL BOARDJAN. 28, 2016 Photo Workers in Recife, Brazil, sprayed insecticide to combat mosquitoes that transmit the Zika virus.CreditFelipe Dana/Associated PressAdvertisement Continue reading the main storyContinue reading the main storyShare This PageEmailShareTweetSaveMoreContinue reading the main storyNo sooner was the Ebola virus subdued in Africa than another virus, Zika, began sweeping through South and Central America. It has been linked toserious birth defects and is threatening to invade the United States. It is imperative that the World Health Organization not repeat its sluggish response to the Ebola crisis and act urgently this time to mobilize international action. Until it reached the Western Hemisphere, the Zika virus — related to dengue, yellow fever and West Nile virus and named after the Ugandan forest where it was first identified almost 70 years ago — had caused little more than relatively mild, flulike infections. But in the nine months since it came to the Americas, it has moved swiftly through Brazil and two dozen other countries and territories, spread by mosquitoes of the Aedes species, which can breed in the tiniest pools of water and usually bite during the day, making them especially hard to control. Continue reading the main storyRELATED COVERAGE Reports of Zika-Linked Birth Defect Rise in Brazil JAN. 27, 2016 Brazil Will Deploy Troops to Spread Awareness of Zika VirusJAN. 26, 2016Though not particularly dangerous to the person infected, the spread of Zika has been accompanied by a huge spike in microcephaly, a congenital and irreversible deformation of the skull in newborn babies. The number of reported cases in Brazil jumped from 147 in 2014 to nearly 4,000 in 2015, leaving health officials with little doubt — although no firm scientific proof — that Zika was responsible. Scientists have also identified a possible link between the virus and the neurological disorder known as the Guillain-Barré syndrome. At present there is no vaccine, no cure and no widely available test for Zika infection. In their absence, the obvious course is to avoid mosquito bites by wearing clothes that cover arms and legs, and using air-conditioning and screens and insect repellents containing DEET. Brazil, which is hosting the Olympic Games this summer, has begun an extensive campaign to eradicate mosquitoes, including the deployment of 220,000 soldiers to search for breeding sites, and has urged women to avoid getting pregnant until the outbreak is brought under control. El Salvador has advised women to delay pregnancy until 2018. In the United States, the Centers for Disease Control and Prevention has issued a list of countries pregnant women would be wise to avoid and has urged pregnant women who have traveled to affected areas to see a doctor and determine whether a test is required. None of that is likely to quickly end the scourge, and no country can do that on its own. On the contrary, the virus could migrate to southern areas of the United States when winter ends. Regrettably, despite these actions, the World Health Organization seems, once again, to be dozing and has yet to generate a broad and coordinated international response. By coincidence, the W.H.O. executive board is currently meeting in Geneva, so this is the perfect time for the agency to show leadership by convening an emergency committee of experts to take stock of the Zika pandemic and advise the W.H.O. director general, Dr. Margaret Chan, on how best to combat it. Follow The New York Times Opinion section on Facebook and Twitter, and sign up for theOpinion Today newsletter. A version of this editorial appears in print on January 28, 2016, on page A28 of the New York edition with the headline: Another Virus Requiring an Urgent Response. Today's Paper|Subscribe http://www.nytimes.com/2016/01/28/opinion/zika-virus-requires-an-urgent-response.html?_r=0
  15. niman replied to niman's topic in WHO News
    Live stream http://live.reuters.com/Event/Reuters_Live_Video
  16. niman replied to niman's topic in WHO News
    Zika virus: Up to four million Zika cases predictedBy James GallagherHealth editor, BBC News website4 minutes ago From the sectionHealthJump media playerMedia player help Out of media player. Press enter to return or tab to continue.Media captionWHO director general Dr Margaret Chan: "The level of concern is high as is the level of uncertainty"The World Health Organization has set up a Zika "emergency team" after the "explosive" spread of the virus. It expects three to four million cases of Zika virus disease in the Americas. WHO director general Dr Margaret Chan said Zika had gone "from a mild threat to one of alarming proportions" and was having a "heart-breaking" impact. The team will meet on Monday to decide whether Zika should be treated as a global emergency. The last time an international emergency was declared was for the Ebola outbreak in West Africa which has killed more than 11,000 people. Zika: What you need to know Zika was first detected in Uganda in 1947, but has never caused an outbreak on this scale. Brazil reported the first cases of Zika in South America in May 2015. Most cases result in no symptoms and it is hard to test for, but WHO officials said an estimated 1.5 million people had been infected in the country. The virus, which is spread by mosquitoes, has since spread to more than 20 countries in the region. At the same time there has been a steep rise in levels of microcephaly - babies born with abnormally small heads - and the rare nervous system disorder Guillain-Barre syndrome. The link between the virus and these disorders has not been confirmed, but Dr Chan said it was "strongly suspected" and "deeply alarming". And she warned the situation could yet deteriorate as "this year's El Nino weather patterns are expected to increase mosquito populations greatly in many areas". The BBC's David Shukman, reporting from Recife in north-east Brazil, said doctors were "overwhelmed" by cases of microcephaly. Image copyrightMario TamaImage captionOne hospital in the city of Recife has seen a sharp rise in cases of microcephaly in the past six monthsOne hospital in the city had gone from dealing with an average of five cases a year to 300 in the past six months. Emergency teamEarlier, doctors writing in the Journal of the American Medical Association said Zika had "explosive pandemic potential" and said the WHO's failure to act swiftly on Ebola probably cost thousands of lives. In a statement to the executive board meeting of the WHO, Dr Chan said: "The level of concern is high, as is the level of uncertainty. "Questions abound - we need to get some answers quickly. "For all these reasons, I have decided to convene an Emergency Committee. "I am asking the Committee for advice on the appropriate level of international concern and for recommended measures that should be undertaken in affected countries and elsewhere." Dr Carissa Etienne, the regional-director for the WHO Pan American Health Organization, said the link between the abnormalities and Zika had not been confirmed. But she added: "We cannot tolerate the prospect of more babies being born with neurological and other malformations and more people facing the threat of paralysis." Follow James on Twitter. Image copyrightUS CDCImage captionAedes aegyptiWhat is the Zika virus:Spread by the Aedes aegyptimosquito, which also carries dengue fever and yellow feverFirst discovered in Africa in the 1940s but is now spreading in Latin AmericaScientists say there is growing evidence of a link to microcephaly, that leads to babies being born with small headsCan lead to fever and a rash but most people show no symptoms, and there is no known cureOnly way to fight Zika is to clear stagnant water where mosquitoes breed, and protect against mosquito bitesZika: What you need to know http://www.bbc.com/news/health-35427493
  17. niman replied to niman's topic in WHO News
    NEWS JAN 28 2016, 8:11 AM ETZika Virus Outbreak: WHO Chief Convenes Emergency Committee Meetingby ALEXANDER SMITH SHARE The World Health Organization said Thursday it will convene an emergency committee on the Zika virus, which is "spreading explosively" and suspectedof causing birth defects. The meeting scheduled for Monday will examine whether the Zika outbreak should be classified as an international health emergency, WHO said in a statement. WHO's Director General Dr. Margaret Chan said the virus is "spreading explosively" in the Americas. "The level of alarm is extremely high," she said. FacebookTwitterGoogle PlusEmbed CDC to Doctors: Monitor Women Returning From Zika Virus Hot Zones 1:59Experts strongly suspect that Zika is causing a severe birth defect called microcephaly, in which babies' brains are underdeveloped. It's not certain yet, but evidence is building. 'The possible links, only recently suspected, have rapidly changed the risk profile of Zika, from a mild threat to one of alarming proportions," Chan said in remarks to WHO's executive board. "The increased incidence of microcephaly is particularly alarming, as it places a heart-breaking burden on families and communities." On Wednesday, two experts on international health matters accused Chan and WHO of acting far too slowly in raising the alarm about Zika. Twenty-four countries have reported cases of the virus and the WHO has predicted it will eventually end up in virtually every Western Hemisphere country. Until last year, the virus had not been a major concern for health officials, causing mostly mild symptoms in around 20 percent of those infected. http://www.nbcnews.com/news/world/zika-virus-outbreak-who-chief-convenes-emergency-committee-meeting-n505706 Dr. Vanessa Van Der Linden, the neuro-pediatrician who first recognized and alerted authorities over the microcephaly crisis in Brazil, measures the head of a 2-month-old baby with microcephaly on Wednesday in Recife, Brazil. The baby's mother was diagnosed with having the Zika virus during her pregnancy. Mario Tama / Getty Images
  18. niman replied to niman's topic in WHO News
    Live stream http://www.who.int/mediacentre/events/2016/webstreaming/eb138/en/
  19. niman replied to niman's topic in WHO News
    WHO Director-General briefs Executive Board on Zika situationBriefing to the Executive Board on the Zika situation Geneva, Switzerland 28 January 2016 Distinguished members of the Board, representatives of Member States, ladies and gentlemen, Welcome to this briefing on the Zika situation. I will give you a brief history of this disease and explain why WHO is so deeply concerned. The Zika virus was first isolated in 1947 from a monkey in the Zika forest of Uganda. Its historical home has been in a narrow equatorial belt stretching across Africa and into equatorial Asia. For decades, the disease, transmitted by the Aedes genus of mosquito, slumbered, affecting mainly monkeys. In humans, Zika occasionally caused a mild disease of low concern. In 2007, Zika expanded its geographical range to cause the first documented outbreak in the Pacific islands, in the Federated States of Micronesia. From 2013-2014, 4 additional Pacific island nations documented large Zika outbreaks. In French Polynesia, the Zika outbreak was associated with neurological complications at a time when the virus was co-circulating with dengue. That was a unique feature, but difficult to interpret. The situation today is dramatically different. Last year, the virus was detected in the Americas, where it is now spreading explosively. As of today, cases have been reported in 23 countries and territories in the region. The level of alarm is extremely high. Arrival of the virus in some places has been associated with a steep increase in the birth of babies with abnormally small heads and in cases of Guillain-Barre syndrome. A causal relationship between Zika virus infection and birth malformations and neurological syndromes has not yet been established, but is strongly suspected. The possible links, only recently suspected, have rapidly changed the risk profile of Zika, from a mild threat to one of alarming proportions. The increased incidence of microcephaly is particularly alarming, as it places a heart-breaking burden on families and communities. WHO is deeply concerned about this rapidly evolving situation for 4 main reasons: the possible association of infection with birth malformations and neurological syndromesthe potential for further international spread given the wide geographical distribution of the mosquito vectorthe lack of population immunity in newly affected areasand the absence of vaccines, specific treatments, and rapid diagnostic tests.Moreover, conditions associated with this year’s El Nino weather pattern are expected to increase mosquito populations greatly in many areas. The level of concern is high, as is the level of uncertainty. Questions abound. We need to get some answers quickly. For all these reasons, I have decided to convene an Emergency Committee under the International Health Regulations. The Committee will meet in Geneva on Monday, 1 February. I am asking the Committee for advice on the appropriate level of international concern and for recommended measures that should be undertaken in affected countries and elsewhere. I will also ask the Committee to prioritize areas where research is most urgently needed. Decisions concerning the Committee’s advice to me will be made public on our web site. Thank you.
  20. niman posted a topic in WHO News
    WHO director General issues update on Zika. http://who.int/dg/speeches/2016/zika-situation/en/
  21. CDC is holding a Zika 101 presser at 11 AM EST today.
  22. References1Campos GS, Bandeira AC, Sardi SI. Zika Virus Outbreak, Bahia, Brazil. Emerg Infect Dis 2015; 21: 1885–1886.CrossRef,PubMed,Web of Science® Times Cited: 22Ioos S, Mallet HP, Leparc Goffart I, Gauthier V, Cardoso T, Herida M. Current Zika virus epidemiology and recent epidemics.Medecine et maladies infectieuses 2014; 44: 302–307.CrossRef,PubMed,Web of Science® Times Cited: 43Besnard M, Lastere S, Teissier A, Cao-Lormeau V, Musso D. Evidence of perinatal transmission of Zika virus, French Polynesia, December 2013 and February 2014. Euro Surveill 2014; 19.CrossRef,PubMed,Web of Science® Times Cited: 54Lanciotti RS, Kosoy OL, Laven JJ, Velez JO, Lambert AJ, Johnson AJ, Stanfield SM, Duffy MR. Genetic and serologic properties of Zika virus associated with an epidemic, Yap State, Micronesia, 2007. Emerg Infect Dis 2008; 8: 1232–1239.CrossRef,CAS,Web of Science® Times Cited: 405Centers for Disease Control and Prevention (CDC). Intrauterine West Nile virus infection--New York, 2002. MMWR Morb Mortal Wkly Rep 2002; 51: 1135–1136.PubMed6Faye O, Freire CC, Iamarino A, Faye O, de Oliveira JV, Diallo M, Zanotto PM, Sall AA. Molecular evolution of Zika virus during its emergence in the 20(th) century. PLoS Negl Trop Dis 2014; 8: e2636.CrossRef,PubMed,Web of Science® Times Cited: 87Goenaga S, Kenney JL, Duggal NK, Delorey M, Ebel GD, Zhang B, Levis SC, Enria DA, Brault AC. Potential for Co-Infection of a Mosquito-Specific Flavivirus, Nhumirim Virus, to Block West Nile Virus Transmission in Mosquitoes. Viruses 2015; 7: 5801–5812.CrossRef,PubMed,Web of Science®

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.