Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. DescriptionsAlignSegment-IDNameScoreE-ValueIdentityEPI588956A/goose/Taiwan/a015/2015 (A/H5N8) segment 8 (NS)1548.60.000000e+00838/838 (100%)EPI573642A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 8 (NS)1548.60.000000e+00838/838 (100%)EPI588972A/chicken/Taiwan/a174/2015 (A/H5N3) segment 8 (NS)1543.10.000000e+00837/838 (99%)EPI586554A/chicken/BC/FAV24/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI586538A/chicken/BC/FAV22/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI586522A/chicken/BC/FAV20/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI586514A/poultry/BC/FAV19/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI585671A/baikal teal/Korea/2417/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI585670A/baikal teal/Korea/2416/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI585669A/baikal teal/Korea/2414/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI585667A/baikal teal/Korea/2403/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI585666A/baikal teal/Korea/2402/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI585664A/baikal teal/Korea/1458/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI585663A/baikal teal/Korea/1457/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI585660A/baikal teal/Korea/1452/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI585657A/baikal teal/Korea/1447/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI585656A/baikal teal/Korea/1446/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI585655A/baikal teal/Korea/1445/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI585653A/baikal teal/Korea/1437/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI585096A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI576474A/chicken/BC/FAV8/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI569394A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI569387A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI568703A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI568700A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561713A/broiler duck/Korea/H31/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561701A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561694A/common teal/Korea/H455-30/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561685A/tundra swan/Korea/H411/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561678A/bean goose/Korea/H328/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561671A/mallard/Korea/H297/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561664A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561657A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561630A/mallard/Korea/H207/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561623A/breeder duck/Korea/H200/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561574A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561560A/Coot/Korea/H81/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561553A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561533A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561519A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561345A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI561200A/broiler duck/Korea/H29/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI542634A/mallard/Korea/W452/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI509757A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI509712A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 8 (NS)1537.50.000000e+00836/838 (99%)EPI662685A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI590737A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI590723A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI590716A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI587525A/American wigeon/BC/050-31/2015 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI586562A/chicken/BC/FAV25/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI586546A/chicken/BC/FAV23/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI586530A/chicken/BC/FAV21/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI586505A/poultry/BC/FAV17/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI585668A/baikal teal/Korea/2406/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI585665A/baikal teal/Korea/2399/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI585661A/baikal teal/Korea/1454/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI585659A/baikal teal/Korea/1449/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI585658A/baikal teal/Korea/1448/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI585654A/baikal teal/Korea/1441/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI584083A/turkey/BC/FAV14/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI573175A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI573166A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI569366A/turkey/Washington/61-22/2014 (A/H5N2) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI561650A/breeder duck/Korea/H249/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI561609A/broiler duck/Korea/H145/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI561602A/broiler duck/Korea/H133/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI561595A/breeder duck/Korea/H128/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI561581A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI561546A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI561364A/bean goose/Korea/H40/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI561357A/broiler duck/Korea/H48/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI561352A/broiler duck/Korea/H47/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI561191A/waterfowl/Korea/S005/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI554604A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI553471A/wigeon/Sakha/1/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI552750A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI548628A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI548428A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 8 (NS)1532.00.000000e+00835/838 (99%)EPI662741A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI662720A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI662713A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI662706A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI662692A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI620461A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI620447A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI620440A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI620433A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI620426A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI620419A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI620412A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI590696A/chicken/Washington/3490-18/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI590689A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI587637A/chicken/Iowa/04-20/2015 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI586497A/poultry/BC/FAV15/2014 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI585662A/baikal teal/Korea/1456/2014 (A/H5N8) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI576481A/chicken/BC/FAV9/2014 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI573302A/turkey/BC/FAV10/2014 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI573183A/duck/Netherlands/14015898/2014 (A/H5N8) segment 8 (NS)1526.50.000000e+00834/838 (99%)EPI569363A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 8 (NS)1526.50.000000e+00834/838 (99%)
  2. DescriptionsAlignSegment-IDNameScoreE-ValueIdentityEPI573639A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 5 (NP)2745.20.000000e+001492/1495 (99%)EPI553209A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 5 (NP)2737.90.000000e+001492/1497 (99%)EPI585085A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 5 (NP)2732.30.000000e+001491/1497 (99%)EPI569391A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 5 (NP)2732.30.000000e+001491/1497 (99%)EPI569377A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 5 (NP)2732.30.000000e+001491/1497 (99%)EPI569373A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 5 (NP)2732.30.000000e+001491/1497 (99%)EPI587522A/American wigeon/BC/050-31/2015 (A/H5N8) segment 5 (NP)2721.20.000000e+001489/1497 (99%)EPI585605A/baikal teal/Korea/1456/2014 (A/H5N8) segment 5 (NP)2721.20.000000e+001489/1497 (99%)EPI573287A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 5 (NP)2721.20.000000e+001489/1497 (99%)EPI585614A/baikal teal/Korea/2417/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI585613A/baikal teal/Korea/2416/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI585612A/baikal teal/Korea/2414/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI585611A/baikal teal/Korea/2406/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI585609A/baikal teal/Korea/2402/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI585608A/baikal teal/Korea/2399/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI585606A/baikal teal/Korea/1457/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI585601A/baikal teal/Korea/1448/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI585596A/baikal teal/Korea/1437/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI561706A/bean goose/Korea/H40/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI561675A/bean goose/Korea/H328/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI561654A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI561647A/breeder duck/Korea/H249/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI561606A/broiler duck/Korea/H145/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI561578A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI561571A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI561564A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI561543A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI561530A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI561523A/broiler duck/Korea/H65/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI561509A/bean goose/Korea/H53/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI561361A/broiler duck/Korea/H49/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI561354A/broiler duck/Korea/H48/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI561342A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 5 (NP)2715.70.000000e+001488/1497 (99%)EPI585610A/baikal teal/Korea/2403/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)EPI585600A/baikal teal/Korea/1447/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)EPI585598A/baikal teal/Korea/1445/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)EPI561668A/mallard/Korea/H297/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)EPI561634A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)EPI561613A/breeder duck/Korea/H158/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)EPI561592A/breeder duck/Korea/H128/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)EPI542629A/mallard/Korea/W452/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)EPI517162A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 5 (NP)2710.20.000000e+001487/1497 (99%)EPI585607A/baikal teal/Korea/1458/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)EPI585604A/baikal teal/Korea/1454/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)EPI585603A/baikal teal/Korea/1452/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)EPI585599A/baikal teal/Korea/1446/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)EPI585597A/baikal teal/Korea/1441/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)EPI561691A/common teal/Korea/H455-30/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)EPI561682A/tundra swan/Korea/H411/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)EPI561661A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)EPI561627A/mallard/Korea/H207/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)EPI561620A/breeder duck/Korea/H200/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)EPI561557A/Coot/Korea/H81/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)EPI561550A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)EPI561349A/broiler duck/Korea/H47/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)EPI561206A/broiler duck/Korea/H31/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)EPI561197A/broiler duck/Korea/H29/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)EPI509713A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 5 (NP)2704.60.000000e+001486/1497 (99%)EPI585602A/baikal teal/Korea/1449/2014 (A/H5N8) segment 5 (NP)2699.10.000000e+001485/1497 (99%)EPI561698A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 5 (NP)2699.10.000000e+001485/1497 (99%)EPI561599A/broiler duck/Korea/H133/2014 (A/H5N8) segment 5 (NP)2699.10.000000e+001485/1497 (99%)EPI561516A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 5 (NP)2699.10.000000e+001485/1497 (99%)EPI561188A/waterfowl/Korea/S005/2014 (A/H5N8) segment 5 (NP)2699.10.000000e+001485/1497 (99%)EPI542625A/duck/Beijing/FS01/2013 (A/H5N8) segment 5 (NP)2699.10.000000e+001485/1497 (99%)EPI509705A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 5 (NP)2699.10.000000e+001485/1497 (99%)EPI573681A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 5 (NP)2693.50.000000e+001484/1497 (99%)EPI573673A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 5 (NP)2693.50.000000e+001484/1497 (99%)EPI573656A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 5 (NP)2693.50.000000e+001484/1497 (99%)EPI573665A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 5 (NP)2688.00.000000e+001483/1497 (99%)EPI573647A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 5 (NP)2688.00.000000e+001483/1497 (99%)EPI573188A/chicken/Netherlands/14016437/2014 (A/H5N8) segment 5 (NP)2688.00.000000e+001483/1497 (99%)EPI548494A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 5 (NP)2688.00.000000e+001483/1497 (99%)EPI595142A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)EPI595134A/greater white-fronted goose/Korea/K14-372-2/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)EPI595129A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)EPI595120A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)EPI595112A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)EPI595103A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)EPI595095A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)EPI595083A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)EPI595075A/mallard/Korea/N15-99/2015 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)EPI595067A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)EPI573180A/duck/Netherlands/14015898/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)EPI573165A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)EPI553182A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)EPI552747A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)EPI548486A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)EPI548427A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 5 (NP)2682.50.000000e+001482/1497 (98%)EPI553363A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 5 (NP)2676.90.000000e+001481/1497 (98%)EPI553344A/chicken/Miyazaki/7/2014 (A/H5N8) segment 5 (NP)2676.90.000000e+001481/1497 (98%)EPI595059A/common teal/Korea/KU-12/2015 (A/H5N8) segment 5 (NP)2671.40.000000e+001481/1498 (98%)EPI573172A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 5 (NP)2671.40.000000e+001480/1497 (98%)EPI558011A/duck/England/36038/14 (A/H5N8) segment 5 (NP)2671.40.000000e+001480/1497 (98%)EPI558004A/duck/England/36226/14 (A/H5N8) segment 5 (NP)2671.40.000000e+001480/1497 (98%)EPI554602A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 5 (NP)2671.40.000000e+001480/1497 (98%)EPI548624A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 5 (NP)2671.40.000000e+001480/1497 (98%)EPI547674A/duck/England/36254/14 (A/H5N8) segment 5 (NP)2671.40.000000e+001480/1497 (98%)EPI576392A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 5 (NP)2665.80.000000e+001479/1497 (98%)EPI547682A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 5 (NP)2665.80.000000e+001479/1497 (98%)EPI576383A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 5 (NP)2660.30.000000e+001478/1497 (98%)
  3. DescriptionsAlignSegment-IDNameScoreE-ValueIdentityEPI588975A/duck/Taiwan/a068/2015 (A/H5N8) segment 3 (PA)3956.60.000000e+002146/2148 (99%)EPI588967A/chicken/Taiwan/a174/2015 (A/H5N3) segment 3 (PA)3956.60.000000e+002146/2148 (99%)EPI588951A/goose/Taiwan/a015/2015 (A/H5N8) segment 3 (PA)3951.10.000000e+002145/2148 (99%)EPI573637A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 3 (PA)3940.00.000000e+002145/2151 (99%)EPI553207A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 3 (PA)3940.00.000000e+002145/2151 (99%)EPI587520A/American wigeon/BC/050-31/2015 (A/H5N8) segment 3 (PA)3906.80.000000e+002139/2151 (99%)EPI586557A/chicken/BC/FAV25/2014 (A/H5N2) segment 3 (PA)3906.80.000000e+002139/2151 (99%)EPI586541A/chicken/BC/FAV23/2014 (A/H5N2) segment 3 (PA)3906.80.000000e+002139/2151 (99%)EPI586525A/chicken/BC/FAV21/2014 (A/H5N2) segment 3 (PA)3906.80.000000e+002139/2151 (99%)EPI586508A/poultry/BC/FAV19/2014 (A/H5N2) segment 3 (PA)3906.80.000000e+002139/2151 (99%)EPI569382A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 3 (PA)3906.80.000000e+002139/2151 (99%)EPI586533A/chicken/BC/FAV22/2014 (A/H5N2) segment 3 (PA)3901.20.000000e+002138/2151 (99%)EPI586517A/chicken/BC/FAV20/2014 (A/H5N2) segment 3 (PA)3901.20.000000e+002138/2151 (99%)EPI586500A/poultry/BC/FAV17/2014 (A/H5N2) segment 3 (PA)3901.20.000000e+002138/2151 (99%)EPI585103A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 3 (PA)3901.20.000000e+002138/2151 (99%)EPI584078A/turkey/BC/FAV14/2014 (A/H5N2) segment 3 (PA)3901.20.000000e+002138/2151 (99%)EPI576173A/chicken/BC/FAV8/2014 (A/H5N2) segment 3 (PA)3901.20.000000e+002138/2151 (99%)EPI590470A/chicken/Washington/3490-18/2015 (A/H5N2) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI586549A/chicken/BC/FAV24/2014 (A/H5N2) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI586492A/poultry/BC/FAV15/2014 (A/H5N2) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI585536A/baikal teal/Korea/2414/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI585535A/baikal teal/Korea/2406/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI585531A/baikal teal/Korea/1458/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI585530A/baikal teal/Korea/1457/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI585528A/baikal teal/Korea/1454/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI585525A/baikal teal/Korea/1448/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI585524A/baikal teal/Korea/1447/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI585523A/baikal teal/Korea/1446/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI573292A/turkey/BC/FAV10/2014 (A/H5N2) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI569389A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI569370A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI569368A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI569362A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 3 (PA)3895.70.000000e+002138/2152 (99%)EPI569360A/chicken/Washington/61-9/2014 (A/H5N2) segment 3 (PA)3895.70.000000e+002138/2152 (99%)EPI561712A/bean goose/Korea/H40/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI561643A/tundra swan/Korea/H411/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI561583A/broiler duck/Korea/H133/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI561537A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI561534A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI561502A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI561500A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI561338A/broiler duck/Korea/H49/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI561334A/broiler duck/Korea/H47/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI509694A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 3 (PA)3895.70.000000e+002137/2151 (99%)EPI590471A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 3 (PA)3890.20.000000e+002137/2152 (99%)EPI585538A/baikal teal/Korea/2417/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI585537A/baikal teal/Korea/2416/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI585533A/baikal teal/Korea/2402/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI585532A/baikal teal/Korea/2399/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI585529A/baikal teal/Korea/1456/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI576174A/chicken/BC/FAV9/2014 (A/H5N2) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI573280A/turkey/Washington/61-22/2014 (A/H5N2) segment 3 (PA)3890.20.000000e+002137/2152 (99%)EPI561687A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI561686A/common teal/Korea/H455-30/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI561642A/bean goose/Korea/H328/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI561640A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI561588A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI561587A/mallard/Korea/H207/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI561586A/breeder duck/Korea/H200/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI561584A/broiler duck/Korea/H145/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI561582A/breeder duck/Korea/H128/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI561501A/broiler duck/Korea/H65/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI561335A/broiler duck/Korea/H48/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI561333A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI561193A/broiler duck/Korea/H31/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI561192A/broiler duck/Korea/H29/2014 (A/H5N8) segment 3 (PA)3890.20.000000e+002136/2151 (99%)EPI662660A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 3 (PA)3884.60.000000e+002136/2152 (99%)EPI590475A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 3 (PA)3884.60.000000e+002136/2152 (99%)EPI590472A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 3 (PA)3884.60.000000e+002136/2152 (99%)EPI590469A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 3 (PA)3884.60.000000e+002136/2152 (99%)EPI585534A/baikal teal/Korea/2403/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)EPI585527A/baikal teal/Korea/1452/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)EPI585526A/baikal teal/Korea/1449/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)EPI585522A/baikal teal/Korea/1445/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)EPI585521A/baikal teal/Korea/1441/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)EPI585520A/baikal teal/Korea/1437/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)EPI585107A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 3 (PA)3884.60.000000e+002136/2152 (99%)EPI561641A/mallard/Korea/H297/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)EPI561639A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)EPI561585A/breeder duck/Korea/H158/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)EPI561539A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)EPI561538A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)EPI561536A/Coot/Korea/H81/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)EPI561535A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)EPI561499A/bean goose/Korea/H53/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)EPI561184A/waterfowl/Korea/S005/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)EPI509693A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 3 (PA)3884.60.000000e+002135/2151 (99%)EPI662675A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 3 (PA)3879.10.000000e+002135/2152 (99%)EPI662674A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 3 (PA)3879.10.000000e+002135/2152 (99%)EPI590473A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 3 (PA)3879.10.000000e+002135/2152 (99%)EPI573645A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 3 (PA)3879.10.000000e+002134/2151 (99%)EPI561638A/breeder duck/Korea/H249/2014 (A/H5N8) segment 3 (PA)3879.10.000000e+002134/2151 (99%)EPI542618A/mallard/Korea/W452/2014 (A/H5N8) segment 3 (PA)3879.10.000000e+002134/2151 (99%)EPI595141A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 3 (PA)3875.40.000000e+002133/2151 (99%)EPI662673A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 3 (PA)3873.50.000000e+002134/2152 (99%)EPI620404A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 3 (PA)3873.50.000000e+002134/2152 (99%)EPI620403A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 3 (PA)3873.50.000000e+002134/2152 (99%)EPI620402A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 3 (PA)3873.50.000000e+002134/2152 (99%)EPI620401A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 3 (PA)3873.50.000000e+002134/2152 (99%)EPI620400A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 3 (PA)3873.50.000000e+002134/2152 (99%)
  4. DescriptionsAlignSegment-IDNameScoreE-ValueIdentityEPI573636A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 2 (PB1)4185.60.000000e+002272/2275 (99%)EPI553206A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 2 (PB1)4163.50.000000e+002268/2275 (99%)EPI587526A/American wigeon/BC/050-31/2015 (A/H5N8) segment 2 (PB1)4146.80.000000e+002265/2275 (99%)EPI569388A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 2 (PB1)4146.80.000000e+002265/2275 (99%)EPI585569A/baikal teal/Korea/1458/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI585565A/baikal teal/Korea/1452/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI585564A/baikal teal/Korea/1449/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI585561A/baikal teal/Korea/1446/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI585559A/baikal teal/Korea/1441/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI561666A/mallard/Korea/H297/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI561659A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI561645A/breeder duck/Korea/H249/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI561611A/breeder duck/Korea/H158/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI561604A/broiler duck/Korea/H145/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI561597A/broiler duck/Korea/H133/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI561590A/breeder duck/Korea/H128/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI561562A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI561528A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI561347A/broiler duck/Korea/H47/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI561340A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI561202A/broiler duck/Korea/H31/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI561195A/broiler duck/Korea/H29/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI542631A/mallard/Korea/W452/2014 (A/H5N8) segment 2 (PB1)4141.30.000000e+002264/2275 (99%)EPI585576A/baikal teal/Korea/2417/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI585575A/baikal teal/Korea/2416/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI585573A/baikal teal/Korea/2406/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI585572A/baikal teal/Korea/2403/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI585568A/baikal teal/Korea/1457/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI585566A/baikal teal/Korea/1454/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI585563A/baikal teal/Korea/1448/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI585562A/baikal teal/Korea/1447/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI585560A/baikal teal/Korea/1445/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI569375A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI569371A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI561703A/bean goose/Korea/H40/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI561689A/common teal/Korea/H455-30/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI561625A/mallard/Korea/H207/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI561618A/breeder duck/Korea/H200/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI561569A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI561555A/Coot/Korea/H81/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI561541A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI561514A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI509708A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 2 (PB1)4135.80.000000e+002263/2275 (99%)EPI561186A/waterfowl/Korea/S005/2014 (A/H5N8) segment 2 (PB1)4133.90.000000e+002262/2275 (99%)EPI585570A/baikal teal/Korea/2399/2014 (A/H5N8) segment 2 (PB1)4130.20.000000e+002262/2275 (99%)EPI585567A/baikal teal/Korea/1456/2014 (A/H5N8) segment 2 (PB1)4130.20.000000e+002262/2275 (99%)EPI561696A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 2 (PB1)4130.20.000000e+002262/2275 (99%)EPI561680A/tundra swan/Korea/H411/2014 (A/H5N8) segment 2 (PB1)4130.20.000000e+002262/2275 (99%)EPI561548A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 2 (PB1)4130.20.000000e+002262/2275 (99%)EPI561521A/broiler duck/Korea/H65/2014 (A/H5N8) segment 2 (PB1)4130.20.000000e+002262/2275 (99%)EPI561359A/broiler duck/Korea/H49/2014 (A/H5N8) segment 2 (PB1)4130.20.000000e+002262/2275 (99%)EPI585574A/baikal teal/Korea/2414/2014 (A/H5N8) segment 2 (PB1)4124.70.000000e+002261/2275 (99%)EPI585571A/baikal teal/Korea/2402/2014 (A/H5N8) segment 2 (PB1)4124.70.000000e+002261/2275 (99%)EPI585558A/baikal teal/Korea/1437/2014 (A/H5N8) segment 2 (PB1)4124.70.000000e+002261/2275 (99%)EPI561652A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 2 (PB1)4124.70.000000e+002261/2275 (99%)EPI561632A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 2 (PB1)4124.70.000000e+002261/2275 (99%)EPI561576A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 2 (PB1)4124.70.000000e+002261/2275 (99%)EPI561337A/broiler duck/Korea/H48/2014 (A/H5N8) segment 2 (PB1)4124.70.000000e+002261/2275 (99%)EPI509703A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 2 (PB1)4124.70.000000e+002261/2275 (99%)EPI585082A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 2 (PB1)4119.10.000000e+002260/2275 (99%)EPI561673A/bean goose/Korea/H328/2014 (A/H5N8) segment 2 (PB1)4119.10.000000e+002260/2275 (99%)EPI561507A/bean goose/Korea/H53/2014 (A/H5N8) segment 2 (PB1)4119.10.000000e+002260/2275 (99%)EPI517159A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 2 (PB1)4119.10.000000e+002260/2275 (99%)EPI552744A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 2 (PB1)4113.60.000000e+002259/2275 (99%)EPI548430A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 2 (PB1)4113.60.000000e+002259/2275 (99%)EPI543000A/duck/Beijing/FS01/2014 (A/H5N8) segment 2 (PB1)4113.60.000000e+002259/2275 (99%)EPI595073A/mallard/Korea/N15-99/2015 (A/H5N8) segment 2 (PB1)4108.10.000000e+002259/2276 (99%)EPI573177A/duck/Netherlands/14015898/2014 (A/H5N8) segment 2 (PB1)4108.10.000000e+002258/2275 (99%)EPI558009A/duck/England/36038/14 (A/H5N8) segment 2 (PB1)4108.10.000000e+002258/2275 (99%)EPI558002A/duck/England/36226/14 (A/H5N8) segment 2 (PB1)4108.10.000000e+002258/2275 (99%)EPI547671A/duck/England/36254/14 (A/H5N8) segment 2 (PB1)4108.10.000000e+002258/2275 (99%)EPI580263A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 2 (PB1)4102.50.000000e+002257/2275 (99%)EPI576389A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 2 (PB1)4102.50.000000e+002257/2275 (99%)EPI576386A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 2 (PB1)4102.50.000000e+002257/2275 (99%)EPI548621A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 2 (PB1)4102.50.000000e+002257/2275 (99%)EPI547680A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 2 (PB1)4102.50.000000e+002257/2275 (99%)EPI595126A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 2 (PB1)4097.00.000000e+002256/2275 (99%)EPI595118A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 2 (PB1)4097.00.000000e+002256/2275 (99%)EPI595110A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 2 (PB1)4097.00.000000e+002256/2275 (99%)EPI595101A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 2 (PB1)4097.00.000000e+002256/2275 (99%)EPI579005A/chicken/Netherlands/14016437/2014 (A/H5N8) segment 2 (PB1)4097.00.000000e+002256/2275 (99%)EPI554600A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 2 (PB1)4097.00.000000e+002256/2275 (99%)EPI553360A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 2 (PB1)4097.00.000000e+002256/2275 (99%)EPI595140A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 2 (PB1)4093.30.000000e+002255/2275 (99%)EPI595092A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 2 (PB1)4091.40.000000e+002255/2275 (99%)EPI573670A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 2 (PB1)4091.40.000000e+002255/2275 (99%)EPI573644A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 2 (PB1)4091.40.000000e+002255/2275 (99%)EPI573161A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 2 (PB1)4091.40.000000e+002255/2275 (99%)EPI548491A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 2 (PB1)4091.40.000000e+002255/2275 (99%)EPI548483A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 2 (PB1)4091.40.000000e+002255/2275 (99%)EPI553185A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 2 (PB1)4089.60.000000e+002253/2275 (99%)EPI595057A/common teal/Korea/KU-12/2015 (A/H5N8) segment 2 (PB1)4085.90.000000e+002255/2276 (99%)EPI573652A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 2 (PB1)4085.90.000000e+002254/2275 (99%)EPI553341A/chicken/Miyazaki/7/2014 (A/H5N8) segment 2 (PB1)4085.90.000000e+002254/2275 (99%)EPI543008A/duck/Beijing/CT01/2014 (A/H5N8) segment 2 (PB1)4082.20.000000e+002252/2274 (99%)EPI595064A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 2 (PB1)4080.40.000000e+002253/2275 (99%)EPI573678A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 2 (PB1)4080.40.000000e+002253/2275 (99%)EPI573662A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 2 (PB1)4080.40.000000e+002253/2275 (99%)EPI542598A/duck/Beijing/FS01/2013 (A/H5N8) segment 2 (PB1)4054.50.000000e+002226/2241 (99%)EPI590678A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 2 (PB1)4045.30.000000e+002224/2241 (99%)
  5. DescriptionsAlignSegment-IDNameScoreE-ValueIdentityEPI588949A/goose/Taiwan/a015/2015 (A/H5N8) segment 1 (PB2)4189.30.000000e+002276/2280 (99%)EPI573635A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 1 (PB2)4172.70.000000e+002273/2280 (99%)EPI553205A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 1 (PB2)4167.20.000000e+002272/2280 (99%)EPI569380A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 1 (PB2)4156.10.000000e+002270/2280 (99%)EPI662721A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)EPI662699A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)EPI590738A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)EPI586531A/chicken/BC/FAV22/2014 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)EPI586498A/poultry/BC/FAV17/2014 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)EPI586490A/poultry/BC/FAV15/2014 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)EPI585081A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)EPI573296A/turkey/BC/FAV10/2014 (A/H5N2) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)EPI569369A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)EPI569367A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 1 (PB2)4150.50.000000e+002269/2280 (99%)EPI662704A/chicken/Nebraska/15-017897-1/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)EPI662686A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)EPI620455A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)EPI620427A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)EPI620420A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)EPI620413A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)EPI587630A/chicken/Iowa/04-20/2015 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)EPI587519A/American wigeon/BC/050-31/2015 (A/H5N8) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)EPI586555A/chicken/BC/FAV25/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)EPI586547A/chicken/BC/FAV24/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)EPI586539A/chicken/BC/FAV23/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)EPI586523A/chicken/BC/FAV21/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)EPI584076A/turkey/BC/FAV14/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)EPI576475A/chicken/BC/FAV9/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)EPI576468A/chicken/BC/FAV8/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)EPI569379A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 1 (PB2)4145.00.000000e+002268/2280 (99%)EPI662742A/chicken/Wisconsin/15-012160-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)EPI662735A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)EPI662728A/chicken/Nebraska/15-017990-5/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)EPI662707A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)EPI662679A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)EPI620448A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)EPI620441A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)EPI620434A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)EPI620406A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)EPI590724A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)EPI590683A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)EPI586515A/chicken/BC/FAV20/2014 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)EPI573283A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)EPI573279A/turkey/Washington/61-22/2014 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)EPI573274A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 1 (PB2)4139.50.000000e+002267/2280 (99%)EPI586506A/poultry/BC/FAV19/2014 (A/H5N2) segment 1 (PB2)4135.80.000000e+002266/2280 (99%)EPI662714A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)EPI590731A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)EPI590717A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)EPI590690A/chicken/Washington/3490-18/2015 (A/H5N2) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)EPI585089A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)EPI573269A/chicken/Washington/61-9/2014 (A/H5N2) segment 1 (PB2)4133.90.000000e+002266/2280 (99%)EPI590710A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 1 (PB2)4128.40.000000e+002266/2281 (99%)EPI590697A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)EPI585557A/baikal teal/Korea/2417/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)EPI585556A/baikal teal/Korea/2416/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)EPI585553A/baikal teal/Korea/2403/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)EPI585543A/baikal teal/Korea/1447/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)EPI585541A/baikal teal/Korea/1445/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)EPI561702A/bean goose/Korea/H40/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)EPI561672A/bean goose/Korea/H328/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)EPI561631A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)EPI561624A/mallard/Korea/H207/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)EPI561568A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)EPI561540A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)EPI561527A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)EPI561506A/bean goose/Korea/H53/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)EPI561358A/broiler duck/Korea/H49/2014 (A/H5N8) segment 1 (PB2)4128.40.000000e+002265/2280 (99%)EPI585554A/baikal teal/Korea/2406/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)EPI585551A/baikal teal/Korea/2399/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)EPI585550A/baikal teal/Korea/1458/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)EPI585548A/baikal teal/Korea/1456/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)EPI585546A/baikal teal/Korea/1452/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)EPI585545A/baikal teal/Korea/1449/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)EPI585544A/baikal teal/Korea/1448/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)EPI585539A/baikal teal/Korea/1437/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)EPI561610A/breeder duck/Korea/H158/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)EPI561603A/broiler duck/Korea/H145/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)EPI561575A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)EPI561561A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)EPI561513A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)EPI561353A/broiler duck/Korea/H48/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)EPI561339A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 1 (PB2)4122.80.000000e+002264/2280 (99%)EPI585555A/baikal teal/Korea/2414/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)EPI585549A/baikal teal/Korea/1457/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)EPI585542A/baikal teal/Korea/1446/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)EPI585540A/baikal teal/Korea/1441/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)EPI561679A/tundra swan/Korea/H411/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)EPI561665A/mallard/Korea/H297/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)EPI561651A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)EPI561644A/breeder duck/Korea/H249/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)EPI561596A/broiler duck/Korea/H133/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)EPI561589A/breeder duck/Korea/H128/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)EPI561554A/Coot/Korea/H81/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)EPI561547A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)EPI561520A/broiler duck/Korea/H65/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)EPI561346A/broiler duck/Korea/H47/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)EPI561201A/broiler duck/Korea/H31/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)EPI561194A/broiler duck/Korea/H29/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)EPI561185A/waterfowl/Korea/S005/2014 (A/H5N8) segment 1 (PB2)4117.30.000000e+002263/2280 (99%)
  6. DescriptionsAlignSegment-IDNameScoreE-ValueIdentityEPI588979A/duck/Taiwan/a068/2015 (A/H5N8) segment 7 (MP)1801.60.000000e+00979/981 (99%)EPI588955A/goose/Taiwan/a015/2015 (A/H5N8) segment 7 (MP)1801.60.000000e+00979/981 (99%)EPI586561A/chicken/BC/FAV25/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI586553A/chicken/BC/FAV24/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI586521A/chicken/BC/FAV20/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI586504A/poultry/BC/FAV17/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI585651A/baikal teal/Korea/2416/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI585650A/baikal teal/Korea/2414/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI585649A/baikal teal/Korea/2406/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI585647A/baikal teal/Korea/2402/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI585646A/baikal teal/Korea/2399/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI585645A/baikal teal/Korea/1458/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI585644A/baikal teal/Korea/1457/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI585643A/baikal teal/Korea/1456/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI585642A/baikal teal/Korea/1454/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI585641A/baikal teal/Korea/1452/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI585639A/baikal teal/Korea/1448/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI585638A/baikal teal/Korea/1447/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI585637A/baikal teal/Korea/1446/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI585635A/baikal teal/Korea/1441/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI585634A/baikal teal/Korea/1437/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI585087A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI584082A/turkey/BC/FAV14/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI576480A/chicken/BC/FAV9/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI576473A/chicken/BC/FAV8/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI573301A/turkey/BC/FAV10/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI569386A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561700A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561693A/common teal/Korea/H455-30/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561684A/tundra swan/Korea/H411/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561677A/bean goose/Korea/H328/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561670A/mallard/Korea/H297/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561656A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561649A/breeder duck/Korea/H249/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561636A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561629A/mallard/Korea/H207/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561622A/breeder duck/Korea/H200/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561601A/broiler duck/Korea/H133/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561594A/breeder duck/Korea/H128/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561580A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561573A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561566A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561559A/Coot/Korea/H81/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561552A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561532A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561525A/broiler duck/Korea/H65/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561511A/bean goose/Korea/H53/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561351A/broiler duck/Korea/H47/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561344A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561211A/broiler duck/Korea/H31/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561199A/broiler duck/Korea/H29/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI561190A/waterfowl/Korea/S005/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI553211A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI542633A/mallard/Korea/W452/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI517164A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI509756A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI509711A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI588971A/chicken/Taiwan/a174/2015 (A/H5N3) segment 7 (MP)1796.10.000000e+00978/981 (99%)EPI588963A/duck/Taiwan/a043/2015 (A/H5N2) segment 7 (MP)1796.10.000000e+00978/981 (99%)EPI662740A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI662726A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI662719A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI662712A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI662705A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI662691A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI620411A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI590743A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI590736A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI590729A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI590722A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI590708A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI590695A/chicken/Washington/3490-18/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI590688A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI587524A/American wigeon/BC/050-31/2015 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI586545A/chicken/BC/FAV23/2014 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI586537A/chicken/BC/FAV22/2014 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI586529A/chicken/BC/FAV21/2014 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI586513A/poultry/BC/FAV19/2014 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI586496A/poultry/BC/FAV15/2014 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI585652A/baikal teal/Korea/2417/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI585648A/baikal teal/Korea/2403/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI585640A/baikal teal/Korea/1449/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI585636A/baikal teal/Korea/1445/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI585095A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI573289A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI573164A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI569393A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI568702A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI568701A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI568699A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI568698A/turkey/Washington/61-22/2014 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI568697A/chicken/Washington/61-9/2014 (A/H5N2) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI561708A/bean goose/Korea/H40/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI561663A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI561615A/breeder duck/Korea/H158/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI561608A/broiler duck/Korea/H145/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI561545A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI561518A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI561363A/broiler duck/Korea/H49/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)EPI561356A/broiler duck/Korea/H48/2014 (A/H5N8) segment 7 (MP)1792.40.000000e+00978/982 (99%)
  7. DescriptionsAlignSegment-IDNameScoreE-ValueIdentityEPI588954A/goose/Taiwan/a015/2015 (A/H5N8) segment 6 (NA)2599.40.000000e+001411/1413 (99%)EPI588978A/duck/Taiwan/a068/2015 (A/H5N8) segment 6 (NA)2593.80.000000e+001410/1413 (99%)EPI573640A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 6 (NA)2549.50.000000e+001400/1410 (99%)EPI587523A/American wigeon/BC/050-31/2015 (A/H5N8) segment 6 (NA)2532.90.000000e+001399/1413 (99%)EPI569378A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 6 (NA)2527.30.000000e+001398/1413 (98%)EPI569374A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 6 (NA)2527.30.000000e+001398/1413 (98%)EPI553210A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 6 (NA)2527.30.000000e+001396/1410 (99%)EPI569392A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 6 (NA)2516.30.000000e+001396/1413 (98%)EPI585086A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)EPI561669A/mallard/Korea/H297/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)EPI561544A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 6 (NA)2505.20.000000e+001394/1413 (98%)EPI585633A/baikal teal/Korea/2417/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI585632A/baikal teal/Korea/2416/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI585630A/baikal teal/Korea/2406/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI585629A/baikal teal/Korea/2403/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI585628A/baikal teal/Korea/2402/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI585626A/baikal teal/Korea/1458/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI585624A/baikal teal/Korea/1456/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI585623A/baikal teal/Korea/1454/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI585620A/baikal teal/Korea/1448/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI585619A/baikal teal/Korea/1447/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI585617A/baikal teal/Korea/1445/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI585616A/baikal teal/Korea/1441/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI561676A/bean goose/Korea/H328/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI561662A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI561655A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI561648A/breeder duck/Korea/H249/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI561635A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI561628A/mallard/Korea/H207/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI561621A/breeder duck/Korea/H200/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI561614A/breeder duck/Korea/H158/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI561579A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI561510A/bean goose/Korea/H53/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI561362A/broiler duck/Korea/H49/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI561355A/broiler duck/Korea/H48/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI561350A/broiler duck/Korea/H47/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI561343A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI561209A/broiler duck/Korea/H31/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI561198A/broiler duck/Korea/H29/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI509714A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI509706A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 6 (NA)2499.60.000000e+001393/1413 (98%)EPI585627A/baikal teal/Korea/2399/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)EPI585625A/baikal teal/Korea/1457/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)EPI585622A/baikal teal/Korea/1452/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)EPI561707A/bean goose/Korea/H40/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)EPI561699A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)EPI561683A/tundra swan/Korea/H411/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)EPI561607A/broiler duck/Korea/H145/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)EPI561600A/broiler duck/Korea/H133/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001393/1414 (98%)EPI561593A/breeder duck/Korea/H128/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)EPI561572A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)EPI561565A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)EPI561558A/Coot/Korea/H81/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)EPI561551A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)EPI561531A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)EPI561524A/broiler duck/Korea/H65/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)EPI561517A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)EPI553345A/chicken/Miyazaki/7/2014 (A/H5N8) segment 6 (NA)2494.10.000000e+001392/1413 (98%)EPI595143A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)EPI595135A/greater white-fronted goose/Korea/K14-372-2/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)EPI595130A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)EPI595121A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)EPI595113A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)EPI595104A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)EPI595096A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)EPI595084A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)EPI595068A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)EPI585631A/baikal teal/Korea/2414/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)EPI585621A/baikal teal/Korea/1449/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)EPI585618A/baikal teal/Korea/1446/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)EPI585615A/baikal teal/Korea/1437/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)EPI561692A/common teal/Korea/H455-30/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)EPI561189A/waterfowl/Korea/S005/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)EPI542632A/mallard/Korea/W452/2014 (A/H5N8) segment 6 (NA)2488.60.000000e+001391/1413 (98%)EPI517163A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 6 (NA)2483.00.000000e+001390/1413 (98%)EPI573655A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)EPI573648A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)EPI552748A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)EPI544759A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001389/1413 (98%)EPI543012A/duck/Beijing/CT01/2014 (A/H5N8) segment 6 (NA)2477.50.000000e+001387/1410 (98%)EPI573682A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)EPI573674A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)EPI558000A/duck/England/36226/14 (A/H5N8) segment 6 (NA)2471.90.000000e+001388/1413 (98%)EPI543004A/duck/Beijing/FS01/2014 (A/H5N8) segment 6 (NA)2471.90.000000e+001386/1410 (98%)EPI595060A/common teal/Korea/KU-12/2015 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)EPI573666A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)EPI573167A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)EPI558007A/duck/England/36038/14 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)EPI553364A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)EPI553350A/wigeon/Sakha/1/2014 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)EPI548495A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)EPI548487A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)EPI547683A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 6 (NA)2466.40.000000e+001387/1413 (98%)EPI595076A/mallard/Korea/N15-99/2015 (A/H5N8) segment 6 (NA)2460.90.000000e+001386/1413 (98%)EPI576393A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 6 (NA)2460.90.000000e+001386/1413 (98%)EPI576382A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 6 (NA)2460.90.000000e+001386/1413 (98%)EPI573181A/duck/Netherlands/14015898/2014 (A/H5N8) segment 6 (NA)2460.90.000000e+001386/1413 (98%)EPI573173A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 6 (NA)2460.90.000000e+001386/1413 (98%)EPI548626A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 6 (NA)2460.90.000000e+001386/1413 (98%)EPI553152A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 6 (NA)2455.30.000000e+001386/1414 (98%)
  8. DescriptionsAlignSegment-IDNameScoreE-ValueIdentityEPI588968A/chicken/Taiwan/a174/2015 (A/H5N3) segment 4 (HA)3131.20.000000e+001701/1704 (99%)EPI573638A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 4 (HA)3131.20.000000e+001701/1704 (99%)EPI588976A/duck/Taiwan/a068/2015 (A/H5N8) segment 4 (HA)3114.60.000000e+001698/1704 (99%)EPI588960A/duck/Taiwan/a043/2015 (A/H5N2) segment 4 (HA)3114.60.000000e+001698/1704 (99%)EPI553208A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA)3105.30.000000e+001695/1702 (99%)EPI588952A/goose/Taiwan/a015/2015 (A/H5N8) segment 4 (HA)3098.00.000000e+001695/1704 (99%)EPI586534A/chicken/BC/FAV22/2014 (A/H5N2) segment 4 (HA)3088.70.000000e+001693/1704 (99%)EPI590712A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 4 (HA)3086.90.000000e+001693/1704 (99%)EPI586550A/chicken/BC/FAV24/2014 (A/H5N2) segment 4 (HA)3086.90.000000e+001693/1704 (99%)EPI586518A/chicken/BC/FAV20/2014 (A/H5N2) segment 4 (HA)3086.90.000000e+001693/1704 (99%)EPI586509A/poultry/BC/FAV19/2014 (A/H5N2) segment 4 (HA)3086.90.000000e+001693/1704 (99%)EPI584079A/turkey/BC/FAV14/2014 (A/H5N2) segment 4 (HA)3086.90.000000e+001693/1704 (99%)EPI573298A/turkey/BC/FAV10/2014 (A/H5N2) segment 4 (HA)3086.90.000000e+001693/1704 (99%)EPI569383A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 4 (HA)3086.90.000000e+001693/1704 (99%)EPI662744A/chicken/Wisconsin/15-012160-1/2015 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)EPI662723A/turkey/South Dakota/15-010371/2015 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)EPI590740A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)EPI590733A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)EPI590719A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)EPI586542A/chicken/BC/FAV23/2014 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)EPI586526A/chicken/BC/FAV21/2014 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)EPI586493A/poultry/BC/FAV15/2014 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)EPI585092A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)EPI576470A/chicken/BC/FAV8/2014 (A/H5N2) segment 4 (HA)3081.30.000000e+001692/1704 (99%)EPI569390A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 4 (HA)3081.30.000000e+001692/1704 (99%)EPI569376A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 4 (HA)3081.30.000000e+001692/1704 (99%)EPI569372A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 4 (HA)3081.30.000000e+001692/1704 (99%)EPI662737A/chicken/Wisconsin/15-011595-1/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)EPI662701A/turkey/Wisconsin/15-012012-2/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)EPI620408A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)EPI590726A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)EPI590699A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)EPI590692A/chicken/Washington/3490-18/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)EPI587633A/chicken/Iowa/04-20/2015 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)EPI587521A/American wigeon/BC/050-31/2015 (A/H5N8) segment 4 (HA)3075.80.000000e+001691/1704 (99%)EPI586501A/poultry/BC/FAV17/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)EPI585084A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 4 (HA)3075.80.000000e+001691/1704 (99%)EPI576477A/chicken/BC/FAV9/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)EPI573281A/turkey/Washington/61-22/2014 (A/H5N2) segment 4 (HA)3075.80.000000e+001691/1704 (99%)EPI662709A/turkey/North Dakota/15-013049-1/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)EPI662688A/turkey/North Dakota/15-011420-13/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)EPI590685A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)EPI586558A/chicken/BC/FAV25/2014 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)EPI573271A/chicken/Washington/61-9/2014 (A/H5N2) segment 4 (HA)3070.30.000000e+001690/1704 (99%)EPI573208A/gadwall/Korea/H1351/2014 (A/H5N8) segment 4 (HA)3070.30.000000e+001690/1704 (99%)EPI561570A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA)3070.30.000000e+001690/1704 (99%)EPI662730A/chicken/Nebraska/15-017990-5/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001690/1705 (99%)EPI662716A/chicken/Minnesota/15-013533-1/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)EPI662694A/chicken/Nebraska/15-017897-1/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001690/1705 (99%)EPI620422A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 4 (HA)3064.70.000000e+001690/1705 (99%)EPI585595A/baikal teal/Korea/2417/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)EPI585589A/baikal teal/Korea/2399/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)EPI585586A/baikal teal/Korea/1456/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)EPI573276A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 4 (HA)3064.70.000000e+001689/1704 (99%)EPI573242A/Common Teal/Korea/H844/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)EPI561646A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)EPI561626A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)EPI561605A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)EPI561591A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)EPI561529A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)EPI561508A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)EPI561341A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA)3064.70.000000e+001689/1704 (99%)EPI620436A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 4 (HA)3059.20.000000e+001689/1705 (99%)EPI585594A/baikal teal/Korea/2416/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI585592A/baikal teal/Korea/2406/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI585591A/baikal teal/Korea/2403/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI585590A/baikal teal/Korea/2402/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI585582A/baikal teal/Korea/1448/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI585581A/baikal teal/Korea/1447/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI585579A/baikal teal/Korea/1445/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI585577A/baikal teal/Korea/1437/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI573286A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI573199A/breeder chicken/Korea/H1068/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI573197A/chicken/Korea/H881/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI561674A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI561612A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI561577A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI561563A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI561542A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI561522A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA)3059.20.000000e+001688/1704 (99%)EPI620457A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 4 (HA)3053.60.000000e+001688/1705 (99%)EPI620450A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 4 (HA)3053.60.000000e+001688/1705 (99%)EPI620443A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 4 (HA)3053.60.000000e+001688/1705 (99%)EPI620415A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 4 (HA)3053.60.000000e+001688/1705 (99%)EPI585593A/baikal teal/Korea/2414/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)EPI585587A/baikal teal/Korea/1457/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)EPI585584A/baikal teal/Korea/1452/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)EPI585583A/baikal teal/Korea/1449/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)EPI561705A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)EPI561667A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001688/1705 (99%)EPI561653A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)EPI561633A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)EPI509704A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA)3053.60.000000e+001687/1704 (99%)EPI662681A/chicken/Montana/15-010559-1/2015 (A/H5N2) segment 4 (HA)3048.10.000000e+001686/1704 (98%)EPI620429A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 4 (HA)3048.10.000000e+001687/1705 (98%)EPI585580A/baikal teal/Korea/1446/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)EPI573200A/Korean native chicken/Korea/H1139/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)EPI573196A/broiler duck/Korea/H651/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)EPI573194A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)EPI561697A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA)3048.10.000000e+001686/1704 (98%)
  9. LOCUS KT388444 1704 bp cRNA linear VRL 17-DEC-2015 DEFINITION Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) segment 4 cRNA sequence. ACCESSION KT388444 VERSION KT388444.1 GI:923093318 KEYWORDS . SOURCE Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) ORGANISM Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE 1 (bases 1 to 1704) AUTHORS Huang,P.Y., Lee,C.C., Yip,C.H., Cheung,C.L., Yu,G., Lam,T.Y., Smith,D.K., Zhu,H. and Guan,Y. TITLE Genetic characterization of highly pathogenic H5 influenza viruses from poultry in Taiwan, 2015 JOURNAL Infect. Genet. Evol. (2015) In press REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 1704) AUTHORS Huang,P.Y., Lee,C.C., Yip,C.H., Cheung,C.L., Yu,G., Lam,T.Y., Smith,D.K., Zhu,H. and Guan,Y. TITLE Direct Submission JOURNAL Submitted (14-AUG-2015) Centre of Influenza Research, School of Public Health, The University of Hong Kong, Laboratory Block, LKS Faculty of Medicine Building, 21 Sassoon Road, Pokfulam, Hong Kong SAR, China COMMENT GenBank Accession Numbers KT388441-KT388448 represent sequences from the 8 segments of Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)). ##Assembly-Data-START## Assembly Method :: Lasergene v. 9.0 Sequencing Technology :: Sanger dideoxy sequencing; 454; Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1704 /organism="Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8))" /mol_type="viral cRNA" /strain="A/goose/Taiwan/TNC1/2015" /serotype="H5N8" /isolation_source="cloacal" /host="goose" /db_xref="taxon:1701764" /segment="4" /country="Taiwan" /collection_date="17-Jan-2015" /note="passage details: E1" gene 1..1704 /gene="HA" CDS 1..1704 /gene="HA" /function="receptor binding and fusion protein" /codon_start=1 /product="hemagglutinin" /protein_id="ALB07376.1" /db_xref="GI:923093319" /translation="MEKIVLLLAVISPVKSDQICIGYHANNSTKQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC I" sig_peptide 1..48 /gene="HA" mat_peptide 49..1035 /gene="HA" /product="HA1" mat_peptide 1036..1701 /gene="HA" /product="HA2" ORIGIN 1 atggagaaaa tagtgcttct tcttgcagtg attagccctg ttaaaagtga tcagatttgc 61 attggttacc atgcaaacaa ctcaacaaag caggttgaca cgataatgga gaaaaacgtc 121 actgttacac atgcccaaga catactggaa aagacacaca acgggaagct ctgcgatctt 181 aatggagtga agcccctgat tctaaaggat tgtagcgtag ctgggtggct ccttggaaat 241 ccaatgtgcg acgagttcat cagggtgccg gaatggtctt acatcgtgga gagggctaac 301 ccagccaacg acctctgtta cccagggacc ctcaatgact atgaggaact gaaacaccta 361 ttgagcagaa taaatcattt tgagaaaact ctgatcatcc ccaggagttc ttggcccaat 421 catgaaacat cattaggggt gagcgcagca tgtccatacc agggagcatc ctcatttttc 481 agaaatgtgg tatggctcat caaaaagaac gatgcatacc cgacaataaa gataagctac 541 aataatacca atcgggaaga tcttttgata ctgtggggga ttcatcattc caacaatgca 601 gcagagcaga caaatctcta taaaaaccca gacacttatg tttccgtggg gacatcaaca 661 ttaaaccaga gattggtgcc aaaaatagct actagatccc aagtaaacgg gcaaagagga 721 agaatggatt tcttctggac aattttaaaa ccgaatgatg caatccactt tgagagtaat 781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt 841 atgaaaagtg aaatggagta tggccactgc aacaccaaat gtcaaactcc aataggggcg 901 ataaactcta gcatgccatt ccacaatata caccctctca ccatcgggga atgccccaaa 961 tacgtgaagt caaacaaatt agtccttgcg actgggctca gaaatagtcc tctaagagaa 1021 agaagaagaa aaagaggact atttggagct atagcagggt ttatagaggg aggatggcag 1081 ggaatggtag acggttggta tgggtatcat catagcaatg agcaggggag tggatacgct 1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcaatc 1201 attgacaaaa tgaacactca atttgaggcc gttggaaggg aatttaataa cttagaaagg 1261 agaatagaga atttaaacaa gaaaatggaa gacggattcc tagatgtctg gacttataat 1321 gctgaacttt tagttctcat ggaaaatgag agaactctag atttccatga ctcaaatgtc 1381 aagaaccttt acgacaaagt ccggctacag cttagggata atgcaaaaga gctgggtaat 1441 ggttgtttcg agttctatca caaatgtgat aacgaatgta tggagagcgt aagaaatggg 1501 acgtatgact accctaagta ttcagaagaa gcaatattaa aaagagaaga aataagcgga 1561 gtgaaattag aatcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt 1621 tccctagcac tggcaatcat agtggctggt ctatctttat ggatgtgctc taatgggtcg 1681 ttacaatgca gaatttgcat ctaa
  10. January 17 2015 H5N8 sequences (33 full sets) from Taiwan have two constellations. One matches Crane in all 8 gene segments.The other has Asian wild bird sequences for PB1 and NP. http://www.sciencedirect.com/science/article/pii/S1567134815300721
  11. KT388441 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) c KT388442 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) c KT388443 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) c KT388444 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) c KT388445 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) c KT388446 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) c KT388447 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) c KT388448 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) c KT388513 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNC10/2015(H5N8)) c KT388514 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNC10/2015(H5N8)) c KT388515 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNC10/2015(H5N8)) c KT388516 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNC10/2015(H5N8)) c KT388517 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNC10/2015(H5N8)) c KT388518 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNC10/2015(H5N8)) c KT388519 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNC10/2015(H5N8)) c KT388520 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNC10/2015(H5N8)) c KT388521 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNC11/2015(H5N8)) c KT388522 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNC11/2015(H5N8)) c KT388523 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNC11/2015(H5N8)) c KT388524 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNC11/2015(H5N8)) c KT388525 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNC11/2015(H5N8)) c KT388526 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNC11/2015(H5N8)) c KT388527 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNC11/2015(H5N8)) c KT388528 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNC11/2015(H5N8)) c KT388529 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNC12/2015(H5N8)) c KT388530 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNC12/2015(H5N8)) c KT388531 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNC12/2015(H5N8)) c KT388532 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNC12/2015(H5N8)) c KT388533 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNC12/2015(H5N8)) c KT388534 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNC12/2015(H5N8)) c KT388535 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNC12/2015(H5N8)) c KT388536 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNC12/2015(H5N8)) c KT388537 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNC13/2015(H5N8)) c KT388538 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNC13/2015(H5N8)) c KT388539 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNC13/2015(H5N8)) c KT388540 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNC13/2015(H5N8)) c KT388541 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNC13/2015(H5N8)) c KT388542 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNC13/2015(H5N8)) c KT388543 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNC13/2015(H5N8)) c KT388544 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNC13/2015(H5N8)) c KT388545 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNC14/2015(H5N8)) c KT388546 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNC14/2015(H5N8)) c KT388547 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNC14/2015(H5N8)) c KT388548 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNC14/2015(H5N8)) c KT388549 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNC14/2015(H5N8)) c KT388550 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNC14/2015(H5N8)) c KT388551 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNC14/2015(H5N8)) c KT388552 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNC14/2015(H5N8)) c KT388449 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNC2/2015(H5N8)) c KT388450 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNC2/2015(H5N8)) c KT388451 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNC2/2015(H5N8)) c KT388452 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNC2/2015(H5N8)) c KT388453 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNC2/2015(H5N8)) c KT388454 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNC2/2015(H5N8)) c KT388455 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNC2/2015(H5N8)) c KT388456 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNC2/2015(H5N8)) c KT388457 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNC3/2015(H5N8)) c KT388458 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNC3/2015(H5N8)) c KT388459 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNC3/2015(H5N8)) c KT388460 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNC3/2015(H5N8)) c KT388461 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNC3/2015(H5N8)) c KT388462 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNC3/2015(H5N8)) c KT388463 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNC3/2015(H5N8)) c KT388464 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNC3/2015(H5N8)) c KT388465 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNC4/2015(H5N8)) c KT388466 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNC4/2015(H5N8)) c KT388467 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNC4/2015(H5N8)) c KT388468 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNC4/2015(H5N8)) c KT388469 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNC4/2015(H5N8)) c KT388470 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNC4/2015(H5N8)) c KT388471 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNC4/2015(H5N8)) c KT388472 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNC4/2015(H5N8)) c KT388473 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNC5/2015(H5N8)) c KT388474 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNC5/2015(H5N8)) c KT388475 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNC5/2015(H5N8)) c KT388476 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNC5/2015(H5N8)) c KT388477 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNC5/2015(H5N8)) c KT388478 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNC5/2015(H5N8)) c KT388479 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNC5/2015(H5N8)) c KT388480 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNC5/2015(H5N8)) c KT388481 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNC6/2015(H5N8)) c KT388482 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNC6/2015(H5N8)) c KT388483 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNC6/2015(H5N8)) c KT388484 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNC6/2015(H5N8)) c KT388485 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNC6/2015(H5N8)) c KT388486 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNC6/2015(H5N8)) c KT388487 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNC6/2015(H5N8)) c KT388488 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNC6/2015(H5N8)) c KT388489 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNC7/2015(H5N8)) c KT388490 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNC7/2015(H5N8)) c KT388491 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNC7/2015(H5N8)) c KT388492 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNC7/2015(H5N8)) c KT388493 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNC7/2015(H5N8)) c KT388494 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNC7/2015(H5N8)) c KT388495 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNC7/2015(H5N8)) c KT388496 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNC7/2015(H5N8)) c KT388497 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNC8/2015(H5N8)) c KT388498 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNC8/2015(H5N8)) c KT388499 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNC8/2015(H5N8)) c KT388500 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNC8/2015(H5N8)) c KT388501 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNC8/2015(H5N8)) c KT388502 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNC8/2015(H5N8)) c KT388503 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNC8/2015(H5N8)) c KT388504 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNC8/2015(H5N8)) c KT388505 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNC9/2015(H5N8)) c KT388506 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNC9/2015(H5N8)) c KT388507 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNC9/2015(H5N8)) c KT388508 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNC9/2015(H5N8)) c KT388509 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNC9/2015(H5N8)) c KT388510 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNC9/2015(H5N8)) c KT388511 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNC9/2015(H5N8)) c KT388512 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNC9/2015(H5N8)) c KT388553 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO1/2015(H5N8)) c KT388554 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO1/2015(H5N8)) c KT388555 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO1/2015(H5N8)) c KT388556 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO1/2015(H5N8)) c KT388557 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO1/2015(H5N8)) c KT388558 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO1/2015(H5N8)) c KT388559 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO1/2015(H5N8)) c KT388560 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO1/2015(H5N8)) c KT388625 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO10/2015(H5N8)) c KT388626 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO10/2015(H5N8)) c KT388627 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO10/2015(H5N8)) c KT388628 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO10/2015(H5N8)) c KT388629 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO10/2015(H5N8)) c KT388630 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO10/2015(H5N8)) c KT388631 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO10/2015(H5N8)) c KT388632 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO10/2015(H5N8)) c KT388633 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO11/2015(H5N8)) c KT388634 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO11/2015(H5N8)) c KT388635 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO11/2015(H5N8)) c KT388636 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO11/2015(H5N8)) c KT388637 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO11/2015(H5N8)) c KT388638 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO11/2015(H5N8)) c KT388639 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO11/2015(H5N8)) c KT388640 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO11/2015(H5N8)) c KT388641 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO12/2015(H5N8)) c KT388642 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO12/2015(H5N8)) c KT388643 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO12/2015(H5N8)) c KT388644 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO12/2015(H5N8)) c KT388645 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO12/2015(H5N8)) c KT388646 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO12/2015(H5N8)) c KT388647 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO12/2015(H5N8)) c KT388648 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO12/2015(H5N8)) c KT388649 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO13/2015(H5N8)) c KT388650 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO13/2015(H5N8)) c KT388651 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO13/2015(H5N8)) c KT388652 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO13/2015(H5N8)) c KT388653 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO13/2015(H5N8)) c KT388654 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO13/2015(H5N8)) c KT388655 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO13/2015(H5N8)) c KT388656 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO13/2015(H5N8)) c KT388657 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO14/2015(H5N8)) c KT388658 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO14/2015(H5N8)) c KT388659 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO14/2015(H5N8)) c KT388660 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO14/2015(H5N8)) c KT388661 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO14/2015(H5N8)) c KT388662 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO14/2015(H5N8)) c KT388663 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO14/2015(H5N8)) c KT388664 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO14/2015(H5N8)) c KT388665 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO15/2015(H5N8)) c KT388666 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO15/2015(H5N8)) c KT388667 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO15/2015(H5N8)) c KT388668 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO15/2015(H5N8)) c KT388669 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO15/2015(H5N8)) c KT388670 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO15/2015(H5N8)) c KT388671 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO15/2015(H5N8)) c KT388672 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO15/2015(H5N8)) c KT388673 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO16/2015(H5N8)) c KT388674 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO16/2015(H5N8)) c KT388675 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO16/2015(H5N8)) c KT388676 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO16/2015(H5N8)) c KT388677 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO16/2015(H5N8)) c KT388678 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO16/2015(H5N8)) c KT388679 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO16/2015(H5N8)) c KT388680 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO16/2015(H5N8)) c KT388681 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO17/2015(H5N8)) c KT388682 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO17/2015(H5N8)) c KT388683 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO17/2015(H5N8)) c KT388684 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO17/2015(H5N8)) c KT388685 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO17/2015(H5N8)) c KT388686 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO17/2015(H5N8)) c KT388687 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO17/2015(H5N8)) c KT388688 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO17/2015(H5N8)) c KT388689 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO18/2015(H5N8)) c KT388690 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO18/2015(H5N8)) c KT388691 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO18/2015(H5N8)) c KT388692 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO18/2015(H5N8)) c KT388693 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO18/2015(H5N8)) c KT388694 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO18/2015(H5N8)) c KT388695 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO18/2015(H5N8)) c KT388696 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO18/2015(H5N8)) c KT388697 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO19/2015(H5N8)) c KT388698 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO19/2015(H5N8)) c KT388699 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO19/2015(H5N8)) c KT388700 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO19/2015(H5N8)) c KT388701 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO19/2015(H5N8)) c KT388702 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO19/2015(H5N8)) c KT388703 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO19/2015(H5N8)) c KT388704 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO19/2015(H5N8)) c KT388561 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO2/2015(H5N8)) c KT388562 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO2/2015(H5N8)) c KT388563 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO2/2015(H5N8)) c KT388564 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO2/2015(H5N8)) c KT388565 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO2/2015(H5N8)) c KT388566 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO2/2015(H5N8)) c KT388567 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO2/2015(H5N8)) c KT388568 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO2/2015(H5N8)) c KT388705 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO20/2015(H5N8)) c KT388706 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO20/2015(H5N8)) c KT388707 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO20/2015(H5N8)) c KT388708 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO20/2015(H5N8)) c KT388709 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO20/2015(H5N8)) c KT388710 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO20/2015(H5N8)) c KT388711 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO20/2015(H5N8)) c KT388712 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO20/2015(H5N8)) c KT388569 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO3/2015(H5N8)) c KT388570 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO3/2015(H5N8)) c KT388571 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO3/2015(H5N8)) c KT388572 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO3/2015(H5N8)) c KT388573 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO3/2015(H5N8)) c KT388574 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO3/2015(H5N8)) c KT388575 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO3/2015(H5N8)) c KT388576 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO3/2015(H5N8)) c KT388577 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO4/2015(H5N8)) c KT388578 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO4/2015(H5N8)) c KT388579 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO4/2015(H5N8)) c KT388580 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO4/2015(H5N8)) c KT388581 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO4/2015(H5N8)) c KT388582 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO4/2015(H5N8)) c KT388583 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO4/2015(H5N8)) c KT388584 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO4/2015(H5N8)) c KT388585 Avian 1 H5N8 Taiwan 2015/01/17 505 Influenza A virus (A/goose/Taiwan/TNO5/2015(H5N8)) p KT388586 Avian 2 H5N8 Taiwan 2015/01/17 1694 Influenza A virus (A/goose/Taiwan/TNO5/2015(H5N8)) p KT388587 Avian 3 H5N8 Taiwan 2015/01/17 450 Influenza A virus (A/goose/Taiwan/TNO5/2015(H5N8)) p KT388588 Avian 4 H5N8 Taiwan 2015/01/17 628 Influenza A virus (A/goose/Taiwan/TNO5/2015(H5N8)) p KT388589 Avian 5 H5N8 Taiwan 2015/01/17 455 Influenza A virus (A/goose/Taiwan/TNO5/2015(H5N8)) p KT388590 Avian 6 H5N8 Taiwan 2015/01/17 487 Influenza A virus (A/goose/Taiwan/TNO5/2015(H5N8)) p KT388591 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO5/2015(H5N8)) c KT388592 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO5/2015(H5N8)) c KT388593 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO6/2015(H5N8)) c KT388594 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO6/2015(H5N8)) c KT388595 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO6/2015(H5N8)) c KT388596 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO6/2015(H5N8)) c KT388597 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO6/2015(H5N8)) c KT388598 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO6/2015(H5N8)) c KT388599 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO6/2015(H5N8)) c KT388600 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO6/2015(H5N8)) c KT388601 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO7/2015(H5N8)) c KT388602 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO7/2015(H5N8)) c KT388603 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO7/2015(H5N8)) c KT388604 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO7/2015(H5N8)) c KT388605 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO7/2015(H5N8)) c KT388606 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO7/2015(H5N8)) c KT388607 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO7/2015(H5N8)) c KT388608 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO7/2015(H5N8)) c KT388609 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO8/2015(H5N8)) c KT388610 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO8/2015(H5N8)) c KT388611 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO8/2015(H5N8)) c KT388612 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO8/2015(H5N8)) c KT388613 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO8/2015(H5N8)) c KT388614 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO8/2015(H5N8)) c KT388615 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO8/2015(H5N8)) c KT388616 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO8/2015(H5N8)) c KT388617 Avian 1 H5N8 Taiwan 2015/01/17 2280 Influenza A virus (A/goose/Taiwan/TNO9/2015(H5N8)) c KT388618 Avian 2 H5N8 Taiwan 2015/01/17 2277 Influenza A virus (A/goose/Taiwan/TNO9/2015(H5N8)) c KT388619 Avian 3 H5N8 Taiwan 2015/01/17 2151 Influenza A virus (A/goose/Taiwan/TNO9/2015(H5N8)) c KT388620 Avian 4 H5N8 Taiwan 2015/01/17 1704 Influenza A virus (A/goose/Taiwan/TNO9/2015(H5N8)) c KT388621 Avian 5 H5N8 Taiwan 2015/01/17 1497 Influenza A virus (A/goose/Taiwan/TNO9/2015(H5N8)) c KT388622 Avian 6 H5N8 Taiwan 2015/01/17 1413 Influenza A virus (A/goose/Taiwan/TNO9/2015(H5N8)) c KT388623 Avian 7 H5N8 Taiwan 2015/01/17 982 Influenza A virus (A/goose/Taiwan/TNO9/2015(H5N8)) c KT388624 Avian 8 H5N8 Taiwan 2015/01/17 838 Influenza A virus (A/goose/Taiwan/TNO9/2015(H5N8)) c
  12. Highlights •Clade 2.3.4.4 H5 influenza virus was introduced to Taiwan most likely by migratory birds. •These viruses were closely related with the Japanese and North American isolates. •Multiple variants were generated after the reassortment with Eurasian gene pool. •Co-circulation of Mexcian/95-like H5N2 viruses was identified during the outbreak. •Clade 2.3.4.4 H5 virus could potentially become established and enzootic in Taiwan.
  13. AbstractPhylogenetic analysis of the highly pathogenic avian influenza (HPAI) H5 viruses causing recent outbreaks in Taiwan showed that they belonged to the Asian HPAI H5 lineage, clade 2.3.4.4 viruses, and were apparently introduced by migratory birds. These viruses reassorted with Eurasian influenza gene pool viruses and formed five genotypic variants. As Taiwan has a similar influenza ecosystem to southern China, the HPAI H5 lineage could become established and enzootic in the island.
  14. Genetic characterization of highly pathogenic H5 influenza viruses from poultry in Taiwan, 2015 Pei-Yu Huang a,b , Chang-Chun David Lee c , Chun-Hung Yip b,d , Chung-Lam Cheung b , Guangchuang Yu b , Tommy Tsan-Yuk Lam b , David K. Smith b , Huachen Zhu a,b,d*, Yi Guan a,b,d* a Joint Influenza Research Centre, Shantou University Medical College, Shantou, Guangdong, Chinab Centre of Influenza Research, School of Public Health, The University of Hong Kong, Hong Kong SAR c Genomics Research Center, Academia Sinica, Taipei, Taiwand State Key Laboratory of Emerging Infectious Diseases (Shenzhen Base), Shenzhen Third People’s Hospital, Shenzhen, China * Corresponding authors. Address: 5 th Floor, Lab Block, 21 Sassoon Road, Pokfulam, Hong Kong SAR. E-mail address: [email protected] (H. Zhu), [email protected] (Y. Guan)
  15. Sequence analysis of Fijuan clade 2.3.4.4 poultry outbreaks in Taiwan identify multiple reassortants.
  16. Dec 8, 1:30 PM EST OREGON DUCK POSITIVE FOR BIRD FLU; STRAIN OF VIRUS SALEM, Ore. (AP) -- A wild duck found last month in Morrow County has tested positive for Eurasian bird flu, but the U.S. Department of Agriculture was not able to determine whether the strain was a danger to poultry. The Capital Press reports (http://is.gd/IatSzh ) that Oregon Department of Fish and Wildlife State Veterinarian Colin Gillin said Friday that the preliminary tests from the hunter-shot mallard collected Nov. 7 caused concern. The duck would have been the first confirmed case of highly pathogenic bird flu in the country since July. The USDA declared the U.S. was free of bird flu on Nov. 18. There are dozens of bird flu strains. The strains that killed millions of birds last winter and spring were H5N8, a Eurasian virus, and H5N2, a mix of Eurasian and North American strains. --- Information from: Capital Press, http://www.capitalpress.com/washington http://hosted.ap.org/dynamic/stories/O/OR_BIRD_FLU_OROL-?SITE=AP&SECTION=HOME&TEMPLATE=DEFAULT&CTIME=2015-12-08-13-30-28
  17. Biosecurity breaches exposed within Fraser Valley poultry industry Rodent infestations and improper disposal of dead birds among issues, freedom of information documents reveal BY LARRY PYNN, VANCOUVER SUN DECEMBER 19, 2015 1 12 STORYPHOTOS ( 6 ) Poultry farmers in the Fraser Valley are on special alert this winter to the presence of avian flu and the need to observe strict biosecurity protocols.Wild birds nesting in poultry barns, rodent infestations, improper disposal of dead birds and domestic dogs in restricted areas are among the biosecurity breaches on Fraser Valley poultry farms, freedom of information documents reveal. Annual biosecurity audits obtained by The Vancouver Sun show that poultry farmers also failed to ensure all materials and equipment entering farms are clean and to conduct required bacteriological water quality tests in the months leading up to the outbreak last December of avian influenza. Wild waterfowl can carry avian flu without showing signs of the disease, which thrives under the Fraser Valley’s cool, wet conditions in winter. Poultry flocks can be infected by waterfowl feces, including on infected machinery, someone’s shoes, feed or wood shavings. Rodents and birds are capable of introducing the disease into barns on their feet and bodies. Poultry officials acknowledge that the failure of even one farm to maintain biosecurity standards can prove costly — for farmers and taxpayers alike. “Any chink in the armour may cause a problem,” confirmed Jim Collins, executive director of the province’s Farm Industry Review Board. He noted that the biosecurity breaches outlined in the FOI documents show the importance of continued communications with industry “because we all get a little sloppy if we are not reminded from time to time what our obligations are.” The federal government spent $20.7 million on the 2014 outbreak, including the Canadian Food Inspection Agency (CFIA)’s response and compensation payments to farmers. Dwight Yochim, executive director of the BC Egg Marketing Board, said industry is constantly sending out newsletters on biosecurity. “It’s human nature to just kind of say, ‘I’ve done something before, I’ll do it again.’ And it’s the 10th time that it gets you. We try to keep it front and centre all year.” Officials also noted that the marketing board audits show that the majority of farmers are doing a good job on biosecurity and that the extent of the avian flu outbreak in 2014 paled in comparison with the 2004 event. “There was a big difference,” said Bill Vanderspek, executive director of the B.C. Chicken Marketing Board. “It’s a testament to the biosecurity program” throughout the poultry industry. The 2014 avian flu hammered 11 commercial poultry farms, resulting in the slaughter of about 250,000 birds. In comparison, 42 farms were directly hit in 2004 — the first such major event in the Fraser Valley — which ultimately resulted in the killing of more than 14 million birds from 410 farms and the loss of $300 million in economic opportunity. Industry argues biosecurity measures are designed to reduce the disease risk as much as reasonably possible but that perfection is unattainable. “We think of these programs as black and white,” said Ray Nickel, president of the BC Poultry Association. “But you can’t 100-per-cent guarantee that I don’t have rodents or a potential bird won’t get in. The intent of the program is to minimize risk and everyone shares in that together.” Farms on alert Fraser Valley poultry producers are on heightened alert after confirmation of avian flu in a wild mallard duck shot by a hunter in Abbotsford in November. “We’re telling the growers to be even more vigilant,” said Michel Benoit, general manager of the BC Turkey Marketing Board. “Minimize contact with other farmers, definitely change clothes and wash up before going anywhere near the barns.” The federal and provincial governments are providing $300,000 to increase surveillance, early detection, and response measures to avian flu, including specialized equipment at the Ministry of Agriculture’s Animal Health Centre in Abbotsford to diagnose sediment samples at ponds and wetlands used by wild waterfowl. A 2013 PricewaterhouseCoopers study pegged the B.C. poultry industry at 583 farms with farm gate receipts of $569 million, based on 2011 figures. An estimated 80 per cent of poultry farms are located in the Fraser Valley, Nickel said. Four marketing boards overseeing turkey and chicken production in B.C., including eggs, initially resisted The Sun’s request for copies of the 2014 audits, but agreed to a compromise in which the names and addresses of farms were removed from hundreds of pages of documents. The Farm Industry Review Board also emphasized the need for increased transparency in marketing board operations and decision-making. The biosecurity checklist includes some 55 categories, ranging from paperwork requirements such as up-to-date logbooks and standard operating procedures to more critical issues designed to keep farms safe from diseases that could endanger flocks. Marketing boards began to conduct mandatory biosecurity audits in 2006 in response to the 2004 massive outbreak. Almost 10 per cent of the audits conducted by the BC Broiler Hatching Egg Commission (BCBHEC) at 62 farms required corrective actions. Stephanie Nelson, executive director of BCBHEC, said the most common issues involved incomplete signage, failure to conduct water tests and lack of documentation. Water tests are required even for farms on municipal water systems due to potential for problems within a water line on the farm. The Sun culled 24 audits from more than 300 chicken farms that cited biosecurity breaches including the need to change boots when crossing a demarkation line into the bird area, unscreened access point to barns, lack of hand sanitizers, squirrel holes, improper disposal of dead birds, insufficient cleaning of fans and servicing rooms, and bird nests in barns. ‘Nasty’ rodents Kathy Erickson, manager of field services for the BC Chicken Marketing Board, said she’s aware of at least one starling nest located in a barn loft above — but not directly within — the chicken area. The concern is for feces to find their way to the chickens, including via rodents. Auditors with an eye for detail often notice issues that farmers do not, including holes created due to missing boards or mesh screens. “You can get birds in any situation where you don’t have screens ...” Erickson said. “Starlings are notorious for breaking into barns through tiny holes.” Several poultry farmers failed to keep grass cut around barns, fill in potholes and conduct other measures such as maintaining bait traps as a way to avoid rodent infestations. “Rodents are nasty little buggers,” said Katie Lowe, operations manager of the BC Egg Marketing Board. Benoit observed that barns represent a “warm environment with food and water” for rodents. “Our growers are trying really hard. Are they perfect? We’re talking about a virus and it’s difficult to control. It’s a big challenge.” The BC Egg Marketing Board documented biosecurity issues at 16 of more than 130 table egg farms, including two cases where dogs were allowed into biosecurity areas such as where special boots are put on to reduce disease transfer. “Dogs are absolutely not allowed in a restricted access zone,” Lowe insisted. How is it transmitted? Although an official federal report on the 2014 avian flu outbreak event won’t be released until 2016, Abed Harchaoui, senior staff veterinarian with the CFIA, told The Sun that most of the 11 farms directly affected last winter obtained the disease from wild waterfowl. Airborne transmissions were not determined. “We don’t have any evidence ...” Harchaoui said from Ottawa. That naturally turns the suspicion to humans, animals, equipment and materials for bringing the disease into poultry operations — exactly the sorts of biosecurity breaches found in the audits. “CFIA is not looking to blame any of the stakeholders,” Harchaoui said. “We are looking collectively to prevent any further outbreaks and to prevent any further spread.” The Ministry of Agriculture’s chief veterinary officer, Jane Pritchard, said from Abbotsford that eight of the 11 cases in 2014 involved direct transfer from wild flocks into barns rather than from poultry farm to poultry farm. Airborne transmission cannot be ruled out over short distances between barns but neither can transmission by people and rodents, she said. Pritchard added that an element of luck is involved, noting that a poultry farmer’s location may have as much to do with getting avian flu as biosecurity measures. “We probably have many bad operators who have never had avian influenza because they are in an area of lower risk and are not exposed to a high density of migratory water fowl or are sitting on dry land,” she said. The Food and Agriculture Organization of the United Nations says it is unclear how highly pathogenic avian influenza is initially introduced into poultry flocks, although the spread between poultry facilities usually results from the movement of infected birds or contaminated people and equipment, including clothing, boots and vehicles, even the outer surface of egg shells. “Airborne transmission of avian influenza virus from farm to farm is not likely,” the organization states. The 2014 disease event also caused widespread economic and logistical chaos beyond the 11 farms affected, including a federal imposition of security zones that required permits for the movement of birds. With export markets closed, the industry also had to scramble to find alternative buyers at significantly lower prices. “You have no choice but to take the sale,” Benoit said. Backyard chickens There can be literally thousands of strains of avian flu, some low pathogenic, some high pathogenic, and some low path capable of becoming high path. The strains last year in the Fraser Valley did not harm humans, but other strains globally have caused flu-like symptoms and even death, especially in areas such as Asia. In Alberta last year, a woman with H5N1 avian influenza died after returning from Beijing, China. Nickel of the BC Poultry Association added that the public wants backyard free-range chickens, but those operations pose a risk to traditional commercial poultry operations. Organic products are a growing segment of the commercial poultry industry. A certified organic chicken is fed organic grains, receives no antibiotics even during sickness and has access to the outside. The organic share of the market has grown from 0.25 per cent to more than two per cent over six years. Due to the 2004 avian flu outbreak, even small backyard free-range operations are required to obtained permits from the marketing board. “You want to have no breaches, you want a secure environment, but we’re going to let birds pasture outside almost on a regular basis,” Nickel said. “It’s still not an excuse for our commercial guys to be laissez-faire about how they deal with and manage those potential risk areas.” Pritchard confirmed the added biosecurity risks when chickens are allowed outside. “It’s very challenging to do very good rodent control and bird control if you have an open door or an open wall.” Emily Robertson of True North Heritage Hatchery in Langley said scientific research does not support backyard flocks and rodents as serious threats to commercial production. "The commercial poultry farmers do not want to blame their staff for lax biosecurity," she said. "They would much rather blame rats and sparrows and the organic farm next door. High path AI is a nasty disease, and I would like to see the commercial sector look in the mirror and face this threat rationally." None of the 11 farms infected in 2014 involved free-range poultry outside of barns. Nickel noted that industry is also working on a mandatory insurance that would provide compensation for future avian flu losses. Biosecurity measures help minimize risk Vic Redekop says avian flu has done more than kill millions of poultry and create havoc in the Fraser Valley during the last decade. It’s put up a barrier between the farmer and the public and helped to disconnect society from food production in the province. “It’s really unfortunate,” Redekop said in an interview from his south Langley turkey farm. “We used to have kindergarten classes come by. They’d get to see the turkeys and baby chicks. It fostered an identity with what farming is all about, and that’s lost.” It’s got to the point where he doesn’t like to invite anyone over to his farm — especially given a close call during the December 2014 outbreak — which started the same day on a turkey farm in Abbotsford and a broiler breeder farm in Chilliwack and eventually spread to 11 commercial farms, three of them turkey. “It was very close to this farm, within a mile,” he said. “We become very frightened, I guess is the word.” Redekop has been in the poultry business all his life and says that formal biosecurity protocols are an accepted part of doing business. “Everyone is apprehensive, right? Avian flu presents a real and present danger to poultry in the Fraser Valley.” Mandatory biosecurity measures are designed to minimize the risk of avian flu and other diseases being transported onto a poultry farm. Redekop maintains a closed gate to prevent anyone from just driving onto the property at will and requires The Vancouver Sun’s reporter and photographer to dip their shoes into a disinfectant foot bath and to put on biosecurity suits and thin plastic booties. Inside the barn’s anteroom — which separate the turkeys from the outside environment — The Sun is required to put on a second pair of booties while crossing a demarcation line on the floor. It’s a cumbersome process and the most difficult part of the biosecurity protocols, Redekop allows. There may be a temptation to cut corners, say, when a farmer or employee crosses the demarcation line then realizes he’s forgotten something on the other side. “The barn entry requirements are difficult. You have to be very conscious of what you’re doing. It seems small, but it isn’t.” The Sun reviewed 40 biosecurity audits of Fraser Valley turkey farmers from last year and found various deficiencies in 18 farms. Beyond the demarcation line, a door opens into the barn proper and about 5,000 female turkeys 83 days old are about to head to the slaughterhouse. “One of the reasons I’m agreeing to this (tour) is the birds are going out to market tomorrow,” Redekop said. “It becomes a moot point.” The rectangular, climate-controlled barn — one of four on this property — is 15,000 square feet and has two large ventilation fans at one end to remove air and 50 side vents along the tops of the walls bringing in fresh air. Dust from movement of the turkeys creates a slight haze, although the presence of The Sun news teams probably makes it worse. The turkeys can eat and drink whenever they like and show no obvious signs of stress. “Turkeys will tell you very quickly if they’re not happy,” Redekop said. The barns are only five years old and in excellent condition, reducing the chance of wild birds and rodents getting inside and potentially transporting disease. “I’ve seen more rodents on Granville Island than I have here,” Redekop allows. This farm produces about 700,000 kilograms of turkey per year. Double that with Redekop’s second turkey farm nearby. He concludes that poultry farmers must appreciate they receive a good, stable income due to a supply-management system governing poultry production. “We have a certain responsibility to provide a good product and be responsible for the privilege we’ve been given.” Ways avian flu can spread through poultry and other birds: • Diseased birds or birds carrying disease. • Farm animals, pets and other wildlife, vermin and insects. • Clothing and shoes of visitors and employees moving from flock to flock. • Contaminated feed, water, bedding and litter. • Carcasses of dead birds. • Contaminated farm equipment and vehicles. • Contact with neighbouring flocks. • Airborne particles. Source: Canadian Food Inspection Agency Tracking the 2014 outbreak in the Fraser Valley Dec. 2, 2014: The Canadian Food Inspection Agency announces the presence of H5 avian flu on two farms in the Fraser Valley — a turkey farm in Abbotsford and a broiler breeder farm in Chilliwack. Tests later confirm the strain as highly-pathogenic H5N2 virus. Dec. 3, 2014: Two additional farms that received birds from one of the original farms are placed under quarantine. Birds on these new farms also show signs of illness. All will be euthanized. Dec. 6, 2014: The flu spreads to a fifth site, a turkey farm in Abbotsford. Dec. 8, 2014: CFIA establishes a primary control zone bordered on the west by the Pacific Ocean, on the south by the U.S. border, on the north by Highway 16, and on the east by the Alberta border. The control zone is divided into three disease control zones: infected, up to three kilometres from an infected site; restricted, up to 10 kilometres; and security, beyond 10 kilometres. Movements of captive birds and poultry products are strictly controlled and require permits. Dec. 10, 2014: The flu is believed to have spread to nine poultry operations. Dec. 17, 2014: Virus sequencing reveals gene segments from the high pathogenic Eurasian H5N8 virus and segments from typical North American viruses, including the N2 gene. This is the first time a Eurasian lineage highly pathogenic H5 virus has caused an outbreak of avian influenza in poultry in North America. Feb. 7, 2015: CFIA confirms the presence of a high pathogenic H5N1 avian influenza on a non-commercial farm in Chilliwack for the first time during the outbreak in the Fraser Valley. A similar discovery was made one month earlier on a farm in Washington state. March 9, 2015: CFIA removes the avian influenza primary control zone. Permits are no longer required for the movement of birds and bird products in B.C. Export restrictions continue. June 3, 2015: CFIA notifies the World Organisation for Animal Health that the province is free of detectable avian flu after a three-month surveillance period. [email protected] http://www.vancouversun.com/health/biosecurity+breaches+exposed+within+fraser+valley+poultry+industry/11600882/story.html
  18. AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KJ713298.1|Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-363, complete genome95489548100%0.099%KJ713298.1Select seq gb|KJ713296.1|Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-378, complete genome95449544100%0.099%KJ713296.1Select seq gb|KJ156942.1|Middle East respiratory syndrome coronavirus isolate Riyadh_8b_2013, partial genome95449544100%0.099%KJ156942.1Select seq gb|KJ156910.1|Middle East respiratory syndrome coronavirus isolate Hafr-Al-Batin_2_2013, complete genome95449544100%0.099%KJ156910.1Select seq gb|KJ156874.1|Middle East respiratory syndrome coronavirus isolate Hafr-Al-Batin_6_2013, complete genome95449544100%0.099%KJ156874.1Select seq gb|KF600652.1|Middle East respiratory syndrome coronavirus isolate Riyadh_2_2012, complete genome95449544100%0.099%KF600652.1Select seq gb|KF600630.1|Middle East respiratory syndrome coronavirus isolate Buraidah_1_2013, complete genome95449544100%0.099%KF600630.1Select seq gb|KF600628.1|Middle East respiratory syndrome coronavirus isolate Hafr-Al-Batin_1_2013, complete genome95449544100%0.099%KF600628.1Select seq gb|KF192507.1|Middle East respiratory syndrome coronavirus, complete genome95449544100%0.099%KF192507.1Select seq gb|KM210277.1|Middle East respiratory syndrome coronavirus isolate England/4/2013, complete genome95399539100%0.099%KM210277.1Select seq gb|KP223131.1|Middle East respiratory syndrome coronavirus isolate Florida/USA-2_Saudi Arabia_2014, complete genome95399539100%0.099%KP223131.1Select seq gb|KM027261.1|Middle East respiratory syndrome coronavirus isolate Makkah_C9355/KSA/Makkah/2014-04-15, complete genome95399539100%0.099%KM027261.1Select seq gb|KM027259.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C9055/KSA/2014-04-14, complete genome95399539100%0.099%KM027259.1Select seq gb|KM027258.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C8826/KSA/2014-04-12, complete genome95399539100%0.099%KM027258.1Select seq gb|KM027256.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C7569/KSA/2014-04-03, complete genome95399539100%0.099%KM027256.1Select seq gb|KM027255.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C7149/KSA/2014-04-05, complete genome95399539100%0.099%KM027255.1Select seq gb|KM015348.1|Middle East respiratory syndrome coronavirus isolate England/2/2013, complete genome95399539100%0.099%KM015348.1Select seq gb|KJ829365.1|Middle East respiratory syndrome coronavirus strain Florida/USA-2_Saudi Arabia_2014, complete genome95399539100%0.099%KJ829365.1Select seq gb|KJ477102.1|Middle East respiratory syndrome coronavirus, complete genome95399539100%0.099%KJ477102.1Select seq gb|KJ156916.1|Middle East respiratory syndrome coronavirus isolate Madinah_3b_2013, partial genome95399539100%0.099%KJ156916.1Select seq gb|KJ156952.1|Middle East respiratory syndrome coronavirus isolate Riyadh_4_2013, complete genome95399539100%0.099%KJ156952.1Select seq gb|KJ156881.1|Middle East respiratory syndrome coronavirus isolate Wadi-Ad-Dawasir_1_2013, complete genome95399539100%0.099%KJ156881.1Select seq gb|KJ156866.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_25_2013, complete genome95399539100%0.099%KJ156866.1Select seq gb|KF961222.1|Middle East respiratory syndrome coronavirus isolate Qatar4, complete genome95399539100%0.099%KF961222.1Select seq gb|KF600651.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_18_2013, complete genome95399539100%0.099%KF600651.1Select seq gb|KF600636.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_11c_2013, partial genome95399539100%0.099%KF600636.1Select seq gb|KF600634.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_21_2013, complete genome95399539100%0.099%KF600634.1Select seq gb|KF600627.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_12_2013, complete genome95399539100%0.099%KF600627.1Select seq gb|KF186565.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_3_2013, complete genome95399539100%0.099%KF186565.1Select seq gb|KF186567.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_1_2013, complete genome95399539100%0.099%KF186567.1Select seq gb|KF186566.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_2_2013, complete genome95399539100%0.099%KF186566.1Select seq gb|KF186564.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_4_2013, complete genome95399539100%0.099%KF186564.1Select seq gb|KM210278.1|Middle East respiratory syndrome coronavirus isolate England/3/2013, complete genome95379537100%0.099%KM210278.1Select seq gb|KT121581.1|Middle East respiratory syndrome coronavirus isolate KFMC-7, complete genome95359535100%0.099%KT121581.1Select seq gb|KT121580.1|Middle East respiratory syndrome coronavirus isolate KFMC-1, complete genome95359535100%0.099%KT121580.1Select seq gb|KT121579.1|Middle East respiratory syndrome coronavirus isolate KFMC-8, complete genome95359535100%0.099%KT121579.1Select seq gb|KT121577.1|Middle East respiratory syndrome coronavirus isolate KFMC-2, complete genome95359535100%0.099%KT121577.1Select seq gb|KT121576.1|Middle East respiratory syndrome coronavirus isolate KFMC-6, complete genome95359535100%0.099%KT121576.1Select seq gb|KT121575.1|Middle East respiratory syndrome coronavirus isolate KFMC-4, complete genome95359535100%0.099%KT121575.1Select seq gb|KT121574.1|Middle East respiratory syndrome coronavirus isolate KFMC-9, complete genome95359535100%0.099%KT121574.1Select seq gb|KT121573.1|Middle East respiratory syndrome coronavirus isolate KFMC-3, complete genome95359535100%0.099%KT121573.1Select seq gb|KT121572.1|Middle East respiratory syndrome coronavirus isolate KFMC-5, complete genome95359535100%0.099%KT121572.1Select seq gb|KT156560.1|Middle East respiratory syndrome coronavirus strain Hu/Oman_2285_2013, complete genome95359535100%0.099%KT156560.1Select seq gb|KM027257.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C7770/KSA/2014-04-07, complete genome95359535100%0.099%KM027257.1Select seq gb|KJ650098.1|Middle East respiratory syndrome coronavirus isolate Camel/Qatar_2_2014, complete genome95359535100%0.099%KJ650098.1Select seq gb|KJ713297.1|Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-503, complete genome95359535100%0.099%KJ713297.1Select seq gb|KJ614529.1|Human betacoronavirus 2c Jordan-N3/2012 isolate MG167, complete genome95359535100%0.099%KJ614529.1Select seq gb|KF917527.1|Middle East respiratory syndrome coronavirus isolate MERS-CoV-Jeddah-Camel-1, complete genome95359535100%0.099%KF917527.1Select seq gb|KJ156941.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_26b_2013 ORF1ab gene, partial cds95359535100%0.099%KJ156941.1Select seq gb|KJ156949.1|Middle East respiratory syndrome coronavirus isolate Taif_1_2013, complete genome95359535100%0.099%KJ156949.1Select seq gb|KJ156944.1|Middle East respiratory syndrome coronavirus isolate Riyadh_5_2013, complete genome95359535100%0.099%KJ156944.1Select seq gb|KJ156869.1|Middle East respiratory syndrome coronavirus isolate Riyadh_9_2013, complete genome95359535100%0.099%KJ156869.1Select seq gb|KF600645.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_15_2013, complete genome95359535100%0.099%KF600645.1Select seq gb|KF600644.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_16_2013, complete genome95359535100%0.099%KF600644.1Select seq gb|KF600632.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_19_2013, complete genome95359535100%0.099%KF600632.1Select seq gb|KF600613.1|Middle East respiratory syndrome coronavirus isolate Riyadh_3_2013, complete genome95359535100%0.099%KF600613.1Select seq gb|KC164505.2|Betacoronavirus England 1, complete genome95359535100%0.099%KC164505.2Select seq gb|KC776174.1|Human betacoronavirus 2c Jordan-N3/2012, complete genome95359535100%0.099%KC776174.1Select seq gb|KC667074.1|Human betacoronavirus 2c England-Qatar/2012, complete genome95359535100%0.099%KC667074.1Select seq gb|KF600643.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_14b_2013, partial genome95339533100%0.099%KF600643.1Select seq gb|KF961221.1|Middle East respiratory syndrome coronavirus isolate Qatar3, complete genome95329532100%0.099%KF961221.1Select seq gb|KT121578.1|Middle East respiratory syndrome coronavirus isolate KFMC-10, complete genome95309530100%0.099%KT121578.1Select seq gb|KT029139.1|Middle East respiratory syndrome coronavirus isolate MERS-CoV/KOR/KNIH/002_05_2015, complete genome95309530100%0.099%KT029139.1Select seq gb|KJ361503.1|Middle East respiratory syndrome coronavirus isolate Hu-France - FRA2_130569-2013_Isolate_Sanger, complete genome95309530100%0.099%KJ361503.1Select seq gb|KJ361502.1|Middle East respiratory syndrome coronavirus isolate Hu-France - FRA2_130569-2013_InSpu_Sanger, complete genome95309530100%0.099%KJ361502.1Select seq gb|KJ361500.1|Middle East respiratory syndrome coronavirus isolate Hu-France (UAE) - FRA1_1627-2013_BAL_Sanger, complete genome95309530100%0.099%KJ361500.1Select seq gb|KJ361499.1|Middle East respiratory syndrome coronavirus isolate Hu-France (UAE) - FRA1_1627-2013_BAL_HTS, partial genome95309530100%0.099%KJ361499.1Select seq gb|KP209312.1|Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_9_2013, complete genome95309530100%0.099%KP209312.1Select seq gb|KM027260.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C10306/KSA/2014-04-20, complete genome95309530100%0.099%KM027260.1Select seq gb|KJ713295.1|Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-505, complete genome95309530100%0.099%KJ713295.1Select seq gb|KJ650297.1|Middle East respiratory syndrome coronavirus isolate KFU-HKU 1, complete genome95309530100%0.099%KJ650297.1Select seq gb|KJ650296.1|Middle East respiratory syndrome coronavirus isolate KFU-HKU 19Dam, complete genome95309530100%0.099%KJ650296.1Select seq gb|KJ650295.1|Middle East respiratory syndrome coronavirus isolate KFU-HKU 13, complete genome95309530100%0.099%KJ650295.1Select seq gb|KJ156934.1|Middle East respiratory syndrome coronavirus isolate Riyadh_14_2013, complete genome95309530100%0.099%KJ156934.1Select seq gb|KF600647.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_17_2013, complete genome95309530100%0.099%KF600647.1Select seq gb|KF600612.1|Middle East respiratory syndrome coronavirus isolate Riyadh_1_2012, complete genome95309530100%0.099%KF600612.1Select seq gb|KT374057.1|Middle East respiratory syndrome coronavirus isolate KOREA/Seoul/168-2-2015, complete genome95269526100%0.099%KT374057.1Select seq gb|KT374056.1|Middle East respiratory syndrome coronavirus isolate KOREA/Seoul/168-1-2015, complete genome95269526100%0.099%KT374056.1Select seq gb|KT374055.1|Middle East respiratory syndrome coronavirus isolate KOREA/Seoul/035-2-2015, complete genome95269526100%0.099%KT374055.1Select seq gb|KT374054.1|Middle East respiratory syndrome coronavirus isolate KOREA/Seoul/035-1-2015, complete genome95269526100%0.099%KT374054.1Select seq gb|KT374052.1|Middle East respiratory syndrome coronavirus isolate KOREA/Seoul/014-1-2015, complete genome95269526100%0.099%KT374052.1Select seq gb|KT374051.1|Middle East respiratory syndrome coronavirus isolate KOREA/Seoul/163-1-2015, complete genome95269526100%0.099%KT374051.1Select seq gb|KT374050.1|Middle East respiratory syndrome coronavirus isolate KOREA/Seoul/163-2-2015, complete genome95269526100%0.099%KT374050.1Select seq gb|KT156561.1|Middle East respiratory syndrome coronavirus strain Hu/Oman_2874_2013, complete genome95269526100%0.099%KT156561.1Select seq gb|KT036374.1|Middle East respiratory syndrome coronavirus isolate ChinaGD01 variant 2, partial genome95269526100%0.099%KT036374.1Select seq gb|KT036373.1|Middle East respiratory syndrome coronavirus isolate ChinaGD01 variant 1, partial genome95269526100%0.099%KT036373.1Select seq gb|KT036372.1|Middle East respiratory syndrome coronavirus isolate ChinaGD01, partial genome95269526100%0.099%KT036372.1Select seq gb|KT006149.2|Middle East respiratory syndrome coronavirus strain ChinaGD01, complete genome95269526100%0.099%KT006149.2Select seq gb|KJ361501.1|Middle East respiratory syndrome coronavirus isolate Hu-France - FRA2_130569-2013_IS_HTS, complete genome95269526100%0.099%KJ361501.1Select seq gb|KP209313.1|Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_26_2014, complete genome95269526100%0.099%KP209313.1Select seq gb|KP209309.1|Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_30_2014, complete genome95269526100%0.099%KP209309.1Select seq gb|KP209307.1|Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_18_2014, complete genome95269526100%0.099%KP209307.1Select seq gb|KP209306.1|Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_8_2014, complete genome95269526100%0.099%KP209306.1Select seq gb|KJ813439.1|Middle East respiratory syndrome coronavirus strain Indiana/USA-1_Saudi Arabia_2014, complete genome95269526100%0.099%KJ813439.1Select seq gb|KF745068.1|Middle East respiratory syndrome coronavirus isolate FRA/UAE, complete genome95269526100%0.099%KF745068.1Select seq gb|KJ556336.1|Middle East respiratory syndrome coronavirus isolate Jeddah_1_2013, complete genome95239523100%0.099%KJ556336.1Select seq gb|KT374053.1|Middle East respiratory syndrome coronavirus isolate KOREA/Seoul/014-2-2015, complete genome95219521100%0.099%KT374053.1Select seq gb|KT026453.1|Middle East respiratory syndrome coronavirus strain Hu/Riyadh_KSA_2959_2015, complete genome95219521100%0.099%KT026453.1Select seq gb|KP719933.1|Middle East respiratory syndrome coronavirus isolate Camel/UAE/D1209/2014, complete genome95219521100%0.099%KP719933.1Select seq gb|KP719932.1|Middle East respiratory syndrome coronavirus isolate Camel/UAE/D1243.12/2014, complete genome95219521100%0.099%KP719932.1
  19. LOCUS KU201959 5347 bp RNA linear VRL 16-DEC-2015 DEFINITION Middle East respiratory syndrome coronavirus isolate Nigeria-HKU004 ORF1b gene, partial cds. ACCESSION KU201959 VERSION KU201959.1 GI:961442039 KEYWORDS . SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV) ORGANISM Middle East respiratory syndrome coronavirus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus; unclassified Betacoronavirus. REFERENCE 1 (bases 1 to 5347) AUTHORS Chu,D.K., Oladipo,J.O., Perera,R.A., Kuranga,S.A., Chan,S.M., Poon,L.L. and Peiris,M. TITLE Middle East respiratory syndrome coronavirus (MERS-CoV) in dromedary camels in Nigeria, 2015 JOURNAL Euro Surveill. 20 (49), 3 (2015) REFERENCE 2 (bases 1 to 5347) AUTHORS Chu,D.K.W., Oladipo,J.O., Perera,R.A.P.M., Kuranga,S.A., Chan,S.M.S., Poon,L.L.M. and Peiris,M. TITLE Direct Submission JOURNAL Submitted (27-NOV-2015) School of Public Health, The University of Hong Kong, No. 21, Sassoon Road, Pokfulam, Hong Kong SAR COMMENT ##Assembly-Data-START## Assembly Method :: Geneious v. 8.1.7 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5347 /organism="Middle East respiratory syndrome coronavirus" /mol_type="genomic RNA" /isolate="Nigeria-HKU004" /host="Camelus dromedarius" /db_xref="taxon:1335626" /country="Nigeria" /collection_date="13-Jan-2015" CDS <1..>5347 /codon_start=3 /product="ORF1b" /protein_id="ALS20356.1" /db_xref="GI:961442040" /translation="NLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGAT CVIGTTKFYGGWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGT CCTTRDRFYRLANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTA NVSALMGANGNKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSD DGVVCYNSDYAAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTL YIKDGDDGYFLPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIE YQNVFWVYLQYIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAV GSCVVCHSQTSLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDV TKLYLGGMSYFCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESG DYTLANTTTEPLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPL NRNYVFTGYHITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVAT LMAPTIVNQERYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFA IGLAIYYPTARVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNE TNSQYLFSTINALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAP RTLLTRGTLEPENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKE LSGQCFKILYKGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARS ILGLTTQTVDSSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALF DSLEFTELSFTNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVN LNLPANVPYSRVISRMGFKLDATIPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNA CGTNVPLQLGFSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAA WPIVRRRIVQMLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAA YSSPLQSYACWTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDA IMTRCLAIHSCFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDI GNPKGIPIVDDPVVDWHYFDAQPLTRKVQQLFYTEDMASSFADGLCLFWNCNVPKYPN NAIVCRFDTRVHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPC EVHGNGSMIEDIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLW CYKTFDIYNLWSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDI CMFENKTTLPTNIAFELYAKRAVRSHPDFKFLHNLQADICYKFVLWDYERSNIYGTAT IGVCKYTDIDVNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCMVGPDYAYF NGAIIRDSDVVKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFD SDVFIKKYGLEKYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSS" ORIGIN 1 tgaatctaaa atatgctatt agtgctaaga atagagctcg cactgttgca ggcgtgtcca 61 tacttagcac aatgactaat cgccagtacc atcagaaaat gcttaagtcc atggctgcaa 121 ctcgtggagc gacttgcgtc attggtacta caaagttcta tggtggctgg gatttcatgc 181 ttaaaacatt gtacaaagat gttgataatc cgcatcttat gggttgggat taccctaagt 241 gtgatagagc tatgcctaat atgtgtagaa tcttcgcttc actcatatta gctcgtaaac 301 atggcacttg ttgtactaca agggacagat tttatcgctt ggcaaatgag tgtgctcagg 361 tgctaagcga atatgttcta tgtggtggtg gttactacgt caaacctgga ggtaccagta 421 gcggagatgc caccactgca tatgccaata gtgtctttaa cattttgcag gcgacaactg 481 ctaatgtcag tgcacttatg ggtgctaatg gcaacaagat tgttgacaaa gaagttaaag 541 acatgcagtt tgatttgtat gtcaatgttt acaggagcac tagcccagac cccaaatttg 601 ttgataaata ctatgctttt cttaataagc acttttctat gatgatactg tctgatgacg 661 gtgtcgtttg ctataatagt gattatgcag ctaagggtta cattgctgga atacagaatt 721 ttaaggaaac gctgtattat cagaacaatg tctttatgtc tgaagctaaa tgctgggtgg 781 aaaccgatct gaagaaaggg ccacatgaat tctgttcaca gcatacgctt tatattaagg 841 atggcgacga tggttacttc cttccttatc cagacccttc aagaattttg tctgccggtt 901 gctttgtaga tgacatcgtt aagactgacg gtacactcat ggtagagcgg tttgtgtctt 961 tggctataga tgcttaccct ctcacaaagc atgaagatat agaataccag aatgtattct 1021 gggtctactt acagtatata gaaaaactgt ataaagacct tacaggacac atgcttgaca 1081 gttattctgt catgctatgt ggtgataatt ctgctaagtt ttgggaagag gcattctata 1141 gagatctcta tagttcgcct accactttgc aggctgtcgg ttcatgcgtt gtatgccatt 1201 cacagacttc cttacgctgt gggacatgca tccgtagacc atttctctgt tgtaaatgct 1261 gctatgatca tgttatagca actccacata agatggtttt gtctgtttct ccttacgttt 1321 gtaatgcccc tggttgtggc gtttcagacg ttactaagct atatttaggt ggtatgagct 1381 acttttgtgt agatcataga cctgtgtgta gttttccact ttgcgctaat ggtcttgtat 1441 tcggcttata caagaatatg tgcacaggta gtccttctat agttgaattt aataggttgg 1501 ctacctgtga ctggactgaa agtggtgatt acacccttgc caatactaca acagaaccac 1561 tcaaactttt tgctgctgag actttacgtg ccactgaaga ggcgtctaag cagtcttatg 1621 ctattgccac catcaaagaa attgttggtg agcgccaact attacttgtg tgggaggctg 1681 gcaagtccaa accaccactc aatcgtaatt atgtttttac tggttatcat ataaccaaaa 1741 atagtaaagt gcagctcggt gagtacatct tcgagcgcat tgattatagt gatgctgtat 1801 cctacaagtc tagtacaacg tataaactga ctgtaggtga catcttcgta cttacctctc 1861 actcggtggc taccttgatg gcgcccacaa ttgtgaatca agagaggtat gttaaaatta 1921 ctgggttgta cccaaccatt acggtacctg aagagttcgc aagtcatgtt gccaacttcc 1981 aaaaatcagg ttatagtaaa tatgtcactg ttcagggacc acctggcact ggcaaaagtc 2041 attttgctat agggttagcg atttactacc ctacagcacg tgttgtttat acagcatgtt 2101 cacacgcagc tgttgacgct ttgtgtgaaa aagcttttaa atatttgaac attgctaaat 2161 gttcccgtat cattcctgca aaggcacgtg ttgagtgcta tgacaggttt aaagttaatg 2221 agacaaattc tcaatatttg tttagtacta ttaatgctct accagaaact tctgccgata 2281 ttctggtggt tgatgaggtt agtatgtgca ctaattatga tctttcaatt attaatgcac 2341 gtattaaagc taagcacatt gtctatgtag gagatccagc acagttgcca gctcctagga 2401 ctttgttgac tagaggcaca ttggaaccag aaaatttcaa tagtgtcact agattgatgt 2461 gtaacttagg tcctgacata tttttaagta tgtgctacag gtgtcctaag gaaatagtaa 2521 gcactgtgag tgctcttgtc tacaataata aattgttagc caagaaggag ctttcaggcc 2581 agtgctttaa aatactctat aagggcaatg tgacgcatga tgctagctct gccattaata 2641 gaccacaact cacatttgtg aagaatttta ttactgccaa tccggcatgg agtaaggcag 2701 tctttatttc gccttataat tcacagaatg ctgtggctcg ttcaattctg ggtcttacca 2761 ctcagactgt tgattcctca cagggttcag aataccagta tgttatcttc tgtcaaacag 2821 cagatacggc acatgctaac aacattaaca gatttaatgt tgcaatcact cgtgcccaaa 2881 aaggtattct ttgtgttatg acatctcagg cactctttga ttccttagag tttactgaat 2941 tgtcttttac taattacaag ctccagtctc agattgtaac tggccttttt aaagattgct 3001 ctagagaaac ttctggcctc tcacctgctt atgcaccaac atacgttagt gttgatgaca 3061 agtataagac gagtgatgag ctttgcgtga atcttaattt acccgcaaat gtcccatact 3121 ctcgtgttat ttccaggatg ggctttaaac tcgatgcaac aattcctgga tatcctaagc 3181 ttttcattac tcgtgaagag gctgtaaggc aagttcgaag ctggataggc ttcgatgttg 3241 agggtgctca tgcttcccgt aatgcatgtg gcaccaatgt gcctctacaa ttaggatttt 3301 caactggtgt gaactttgtt gttcagccag ttggtgttgt agacactgag tggggtaaca 3361 tgttaacggg cattgctgcc cgtcctccac caggtgaaca gtttaagcac ctcgtgcctc 3421 ttatgcataa gggggctgca tggcctattg ttagacgacg tatagtgcaa atgttgtccg 3481 acactttaga caaattgtct gattactgta cgtttgtttg ttgggctcat ggctttgaat 3541 taacgtctgc atcatacttt tgcaagatag gtaaggaaca gaagtgttgc atgtgcaata 3601 gacgcgctgc agcgtactct tcacctctgc aatcttatgc ctgctggact cattcctgcg 3661 gttatgatta tgtctacaac cctttctttg tcgatgttca acagtggggt tatgtaggca 3721 atcttgctac taatcacgat cgttattgct ctgtccatca aggagctcat gtggcttcta 3781 atgatgcaat aatgactcgt tgtttagcta ttcattcttg ttttatagaa cgtgtggatt 3841 gggatataga gtatccttat atctcacatg aaaagaaatt gaattcctgt tgtagaatcg 3901 ttgagcgcaa cgtcgtacgt gctgctcttc ttgccggttc atttgacaaa gtctatgata 3961 ttggcaatcc taaaggaatt cctattgttg atgaccctgt ggttgattgg cattattttg 4021 atgcacagcc cttgaccagg aaggtacaac agcttttcta tacagaggac atggcctcaa 4081 gttttgctga tgggctctgc ttattttgga actgtaatgt accaaaatat cctaataatg 4141 caattgtatg caggtttgac acacgtgtgc attctgagtt caatttgcca ggttgtgatg 4201 gcggtagttt gtatgttaac aagcacgctt ttcatacacc agcatatgat gtgagtgcat 4261 tccgtgatct gaaaccttta ccattctttt attattctac tacaccatgt gaagtgcatg 4321 gtaatggtag tatgatagag gatattgatt atgtacccct aaaatctgca gtctgtatta 4381 cagcttgtaa tttagggggc gctgtttgta ggaagcatgc tacagagtac agagagtata 4441 tggaagcata taatcttgtc tctgcatcag gtttccgcct ttggtgttat aagacctttg 4501 atatttataa tctctggtct acttttacaa aagttcaagg tttggaaaac attgctttta 4561 atgttgttaa acaaggccat tttattggtg ttgagggtga actacctgta gctgtagtca 4621 atgataagat cttcaccaag agtggcgtta atgacatttg tatgtttgag aataaaacca 4681 ctttgcctac taatatagct tttgaactct atgctaagcg tgccgtacgc tcgcatcccg 4741 atttcaaatt tctacacaat ttacaagcag acatttgtta taagttcgtc ctttgggatt 4801 atgaacgtag caatatttat ggtactgcta ctattggtgt atgtaagtac actgatattg 4861 atgttaattc agctttgaat atatgttttg acatacgcga taatggttca ttggagaaat 4921 tcatgtctac tcccaatgcc atctttattt ctgatagaaa aatcaagaaa tacccttgta 4981 tggtaggtcc tgattatgct tacttcaatg gtgctatcat ccgtgatagt gatgttgtta 5041 aacaaccagt gaagttctac ttgtataaga aagtcaataa tgagtttatt gatcctactg 5101 agtgtattta cactcagagt cgctcttgta gtgacttcct acccctgtct gacatggaga 5161 aagactttct atcttttgat agtgatgttt tcattaagaa gtatggcttg gaaaaatatg 5221 cttttgagca cgtagtctat ggagacttct ctcatactac gttaggcggt cttcacttgc 5281 ttattggttt atacaagaag caacaggaag gtcatattat tatggaagaa atgctaaaag 5341 gtagctc
  20. Select seq gb|KC776174.1|Human betacoronavirus 2c Jordan-N3/2012, complete genome72457245100%0.099%KC776174.1Select seq gb|KJ614529.1|Human betacoronavirus 2c Jordan-N3/2012 isolate MG167, complete genome72407240100%0.099%KJ614529.1Select seq gb|JX869059.2|Human betacoronavirus 2c EMC/2012, complete genome72367236100%0.099%JX869059.2Select seq gb|KF917527.1|Middle East respiratory syndrome coronavirus isolate MERS-CoV-Jeddah-Camel-1, complete genome72217221100%0.099%KF917527.1Select seq gb|KJ556336.1|Middle East respiratory syndrome coronavirus isolate Jeddah_1_2013, complete genome72217221100%0.099%KJ556336.1Select seq gb|KJ156949.1|Middle East respiratory syndrome coronavirus isolate Taif_1_2013, complete genome72217221100%0.099%KJ156949.1Select seq gb|KJ156944.1|Middle East respiratory syndrome coronavirus isolate Riyadh_5_2013, complete genome72187218100%0.099%KJ156944.1Select seq gb|KJ156881.1|Middle East respiratory syndrome coronavirus isolate Wadi-Ad-Dawasir_1_2013, complete genome72187218100%0.099%KJ156881.1Select seq gb|KF192507.1|Middle East respiratory syndrome coronavirus, complete genome72187218100%0.099%KF192507.1Select seq gb|KC164505.2|Betacoronavirus England 1, complete genome72187218100%0.099%KC164505.2Select seq gb|KC667074.1|Human betacoronavirus 2c England-Qatar/2012, complete genome72187218100%0.099%KC667074.1Select seq gb|KP966104.1|Middle East respiratory syndrome coronavirus isolate Al-Ahsa KSA_Camel_C23 spike protein gene, complete cds72127212100%0.099%KP966104.1Select seq gb|KJ361503.1|Middle East respiratory syndrome coronavirus isolate Hu-France - FRA2_130569-2013_Isolate_Sanger, complete genome72127212100%0.099%KJ361503.1Select seq gb|KJ713296.1|Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-378, complete genome72127212100%0.099%KJ713296.1Select seq gb|KJ156952.1|Middle East respiratory syndrome coronavirus isolate Riyadh_4_2013, complete genome72127212100%0.099%KJ156952.1Select seq gb|KF600652.1|Middle East respiratory syndrome coronavirus isolate Riyadh_2_2012, complete genome72127212100%0.099%KF600652.1Select seq gb|KF600620.1|Middle East respiratory syndrome coronavirus isolate Bisha_1_2012, complete genome72127212100%0.099%KF600620.1Select seq gb|KF600612.1|Middle East respiratory syndrome coronavirus isolate Riyadh_1_2012, complete genome72127212100%0.099%KF600612.1Select seq gb|KJ361500.1|Middle East respiratory syndrome coronavirus isolate Hu-France (UAE) - FRA1_1627-2013_BAL_Sanger, complete genome72117211100%0.099%KJ361500.1Select seq gb|KJ361499.1|Middle East respiratory syndrome coronavirus isolate Hu-France (UAE) - FRA1_1627-2013_BAL_HTS, partial genome72117211100%0.099%KJ361499.1Select seq gb|KR011266.1|Middle East respiratory syndrome coronavirus strain Hu/Riyadh-KSA-2049/2015, complete genome72097209100%0.099%KR011266.1Select seq gb|KR011264.1|Middle East respiratory syndrome coronavirus strain Hu/Riyadh-KSA-2343/2015, complete genome72097209100%0.099%KR011264.1Select seq gb|KR011263.1|Middle East respiratory syndrome coronavirus strain Hu/Riyadh-KSA-2345/2015, complete genome72097209100%0.099%KR011263.1Select seq gb|KJ361501.1|Middle East respiratory syndrome coronavirus isolate Hu-France - FRA2_130569-2013_IS_HTS, complete genome72097209100%0.099%KJ361501.1Select seq gb|KM027261.1|Middle East respiratory syndrome coronavirus isolate Makkah_C9355/KSA/Makkah/2014-04-15, complete genome72097209100%0.099%KM027261.1Select seq gb|KM027260.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C10306/KSA/2014-04-20, complete genome72097209100%0.099%KM027260.1Select seq gb|KM027259.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C9055/KSA/2014-04-14, complete genome72097209100%0.099%KM027259.1Select seq gb|KM027257.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C7770/KSA/2014-04-07, complete genome72097209100%0.099%KM027257.1Select seq gb|KM027256.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C7569/KSA/2014-04-03, complete genome72097209100%0.099%KM027256.1Select seq gb|KM027255.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C7149/KSA/2014-04-05, complete genome72097209100%0.099%KM027255.1Select seq gb|KM027263.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C7058/KSA/2014 spike protein (S) gene, complete cds72097209100%0.099%KM027263.1Select seq gb|KJ650098.1|Middle East respiratory syndrome coronavirus isolate Camel/Qatar_2_2014, complete genome72097209100%0.099%KJ650098.1Select seq gb|KJ713295.1|Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-505, complete genome72097209100%0.099%KJ713295.1Select seq gb|KJ156876.1|Middle East respiratory syndrome coronavirus isolate Taif_2b_2013 ORF1ab gene, partial cds; and S protein, ORF3, ORF4a, ORF4b, ORF5, E protein, M protein, N protein, and ORF8b genes, complete cds72097209100%0.099%KJ156876.1Select seq gb|KF745068.1|Middle East respiratory syndrome coronavirus isolate FRA/UAE, complete genome72097209100%0.099%KF745068.1Select seq gb|KF600630.1|Middle East respiratory syndrome coronavirus isolate Buraidah_1_2013, complete genome72097209100%0.099%KF600630.1Select seq gb|KR011265.1|Middle East respiratory syndrome coronavirus strain Hu/Riyadh-KSA-2466/2015, complete genome72057205100%0.099%KR011265.1Select seq gb|KJ782549.1|Middle East respiratory syndrome coronavirus strain Greece-Saudi Arabia_2014 S protein (S) gene, complete cds72057205100%0.099%KJ782549.1Select seq gb|KF600613.1|Middle East respiratory syndrome coronavirus isolate Riyadh_3_2013, complete genome72057205100%0.099%KF600613.1Select seq gb|KT121580.1|Middle East respiratory syndrome coronavirus isolate KFMC-1, complete genome72037203100%0.099%KT121580.1Select seq gb|KT121577.1|Middle East respiratory syndrome coronavirus isolate KFMC-2, complete genome72037203100%0.099%KT121577.1Select seq gb|KT121576.1|Middle East respiratory syndrome coronavirus isolate KFMC-6, complete genome72037203100%0.099%KT121576.1Select seq gb|KT121575.1|Middle East respiratory syndrome coronavirus isolate KFMC-4, complete genome72037203100%0.099%KT121575.1Select seq gb|KT121574.1|Middle East respiratory syndrome coronavirus isolate KFMC-9, complete genome72037203100%0.099%KT121574.1Select seq gb|KT121573.1|Middle East respiratory syndrome coronavirus isolate KFMC-3, complete genome72037203100%0.099%KT121573.1Select seq gb|KT121572.1|Middle East respiratory syndrome coronavirus isolate KFMC-5, complete genome72037203100%0.099%KT121572.1Select seq gb|KP223131.1|Middle East respiratory syndrome coronavirus isolate Florida/USA-2_Saudi Arabia_2014, complete genome72037203100%0.099%KP223131.1Select seq gb|KM027262.1|Middle East respiratory syndrome coronavirus isolate Riyadh_2014KSA_683/KSA/2014, complete genome72037203100%0.099%KM027262.1Select seq gb|KM027258.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C8826/KSA/2014-04-12, complete genome72037203100%0.099%KM027258.1Select seq gb|KM027281.1|Middle East respiratory syndrome coronavirus isolate Riyadh_2014KSA_158/KSA/2014 spike protein (S) gene, complete cds72037203100%0.099%KM027281.1Select seq gb|KM027278.1|Middle East respiratory syndrome coronavirus isolate Riyadh_2014KSA_057/KSA/2014 spike protein (S) gene, complete cds72037203100%0.099%KM027278.1Select seq gb|KM027276.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C9313/KSA/2014 spike protein (S) gene, complete cds72037203100%0.099%KM027276.1Select seq gb|KM027275.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C9282/KSA/2014 spike protein (S) gene, complete cds72037203100%0.099%KM027275.1Select seq gb|KM027274.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C8978/KSA/2014 spike protein (S) gene, complete cds72037203100%0.099%KM027274.1Select seq gb|KM027271.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C8237/KSA/2014 spike protein (S) gene, complete cds72037203100%0.099%KM027271.1Select seq gb|KM027270.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C7773/KSA/2014 spike protein (S) gene, complete cds72037203100%0.099%KM027270.1Select seq gb|KM027268.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C7554/KSA/2014 spike protein (S) gene, complete cds72037203100%0.099%KM027268.1Select seq gb|KJ829365.1|Middle East respiratory syndrome coronavirus strain Florida/USA-2_Saudi Arabia_2014, complete genome72037203100%0.099%KJ829365.1Select seq gb|KJ813439.1|Middle East respiratory syndrome coronavirus strain Indiana/USA-1_Saudi Arabia_2014, complete genome72037203100%0.099%KJ813439.1Select seq gb|KJ713298.1|Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-363, complete genome72037203100%0.099%KJ713298.1Select seq gb|KM027273.1|Middle East respiratory syndrome coronavirus isolate Jeddah_C8965/KSA/2014 spike protein (S) gene, complete cds72027202100%0.099%KM027273.1Select seq gb|KF811036.1|Middle East respiratory syndrome coronavirus strain Tunisia-Qatar_2013 spike protein gene, complete cds72027202100%0.099%KF811036.1Select seq gb|KM210278.1|Middle East respiratory syndrome coronavirus isolate England/3/2013, complete genome72007200100%0.099%KM210278.1Select seq gb|KM015348.1|Middle East respiratory syndrome coronavirus isolate England/2/2013, complete genome72007200100%0.099%KM015348.1Select seq gb|KF600645.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_15_2013, complete genome71967196100%0.099%KF600645.1Select seq gb|KT121578.1|Middle East respiratory syndrome coronavirus isolate KFMC-10, complete genome71947194100%0.099%KT121578.1Select seq gb|KM210277.1|Middle East respiratory syndrome coronavirus isolate England/4/2013, complete genome71947194100%0.099%KM210277.1Select seq gb|KJ713297.1|Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-503, complete genome71947194100%0.099%KJ713297.1Select seq gb|KJ156939.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_27b_2013 ORF1ab gene, partial cds; and S protein, ORF3, ORF4a, ORF4b, ORF5, E protein, M protein, N protein, and ORF8b genes, complete cds71947194100%0.099%KJ156939.1Select seq gb|KJ156872.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_26c_2013 ORF1ab gene, partial cds; and S protein, ORF3, ORF4a, ORF4b, ORF5, E protein, M protein, N protein, and ORF8b genes, complete cds71947194100%0.099%KJ156872.1Select seq gb|KJ156869.1|Middle East respiratory syndrome coronavirus isolate Riyadh_9_2013, complete genome71947194100%0.099%KJ156869.1Select seq gb|KJ156866.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_25_2013, complete genome71947194100%0.099%KJ156866.1Select seq gb|KF600651.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_18_2013, complete genome71947194100%0.099%KF600651.1Select seq gb|KF600647.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_17_2013, complete genome71947194100%0.099%KF600647.1Select seq gb|KF600644.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_16_2013, complete genome71947194100%0.099%KF600644.1Select seq gb|KF600636.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_11c_2013, partial genome71947194100%0.099%KF600636.1Select seq gb|KF600632.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_19_2013, complete genome71947194100%0.099%KF600632.1Select seq gb|KF600627.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_12_2013, complete genome71947194100%0.099%KF600627.1Select seq gb|KF600623.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_7b_2013, partial genome71947194100%0.099%KF600623.1Select seq gb|KF186565.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_3_2013, complete genome71947194100%0.099%KF186565.1Select seq gb|KF186567.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_1_2013, complete genome71947194100%0.099%KF186567.1Select seq gb|KF186566.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_2_2013, complete genome71947194100%0.099%KF186566.1Select seq gb|KF186564.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_4_2013, complete genome71947194100%0.099%KF186564.1Select seq gb|KT121581.1|Middle East respiratory syndrome coronavirus isolate KFMC-7, complete genome71917191100%0.099%KT121581.1Select seq gb|KT225476.2|Middle East respiratory syndrome coronavirus isolate MERS-CoV/THA/CU/17_06_2015, complete genome71917191100%0.099%KT225476.2Select seq gb|KT026453.1|Middle East respiratory syndrome coronavirus strain Hu/Riyadh_KSA_2959_2015, complete genome71917191100%0.099%KT026453.1Select seq gb|KP209313.1|Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_26_2014, complete genome71917191100%0.099%KP209313.1Select seq gb|KP209309.1|Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_30_2014, complete genome71917191100%0.099%KP209309.1Select seq gb|KP209306.1|Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_8_2014, complete genome71917191100%0.099%KP209306.1Select seq gb|KJ156901.1|Middle East respiratory syndrome coronavirus isolate Riyadh_12b_2013 ORF1ab gene, partial cds; and S protein, ORF3, ORF4a, ORF4b, ORF5, E protein, M protein, N protein, and ORF8b genes, complete cds71917191100%0.099%KJ156901.1Select seq gb|KJ156874.1|Middle East respiratory syndrome coronavirus isolate Hafr-Al-Batin_6_2013, complete genome71917191100%0.099%KJ156874.1Select seq gb|KF600643.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_14b_2013, partial genome71917191100%0.099%KF600643.1Select seq gb|KF600634.1|Middle East respiratory syndrome coronavirus isolate Al-Hasa_21_2013, complete genome71917191100%0.099%KF600634.1Select seq gb|KP209308.1|Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_16_2014, complete genome71877187100%0.099%KP209308.1Select seq gb|KT121579.1|Middle East respiratory syndrome coronavirus isolate KFMC-8, complete genome71857185100%0.099%KT121579.1Select seq gb|KP405226.1|Middle East respiratory syndrome coronavirus isolate Al-Ahsa KSA_Camel_C7 spike protein gene, complete cds71857185100%0.099%KP405226.1Select seq gb|KP405225.1|Middle East respiratory syndrome coronavirus isolate Al-Ahsa KSA_Camel_C8 spike protein gene, complete cds71857185100%0.099%KP405225.1Select seq gb|KT156561.1|Middle East respiratory syndrome coronavirus strain Hu/Oman_2874_2013, complete genome71857185100%0.099%KT156561.1Select seq gb|KT156560.1|Middle East respiratory syndrome coronavirus strain Hu/Oman_2285_2013, complete genome71857185100%0.099%KT156560.1Select seq gb|KT026454.1|Middle East respiratory syndrome coronavirus strain Hu/Riyadh_KSA_4050_2015, complete genome71857185100%0.099%KT026454.1
  21. LOCUS KU201953 4062 bp RNA linear VRL 16-DEC-2015 DEFINITION Middle East respiratory syndrome coronavirus isolate Nigeria-HKU004 spike protein (S) gene, complete cds. ACCESSION KU201953 VERSION KU201953.1 GI:961442027 KEYWORDS . SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV) ORGANISM Middle East respiratory syndrome coronavirus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus; unclassified Betacoronavirus. REFERENCE 1 (bases 1 to 4062) AUTHORS Chu,D.K., Oladipo,J.O., Perera,R.A., Kuranga,S.A., Chan,S.M., Poon,L.L. and Peiris,M. TITLE Middle East respiratory syndrome coronavirus (MERS-CoV) in dromedary camels in Nigeria, 2015 JOURNAL Euro Surveill. 20 (49), 3 (2015) REFERENCE 2 (bases 1 to 4062) AUTHORS Chu,D.K.W., Oladipo,J.O., Perera,R.A.P.M., Kuranga,S.A., Chan,S.M.S., Poon,L.L.M. and Peiris,M. TITLE Direct Submission JOURNAL Submitted (27-NOV-2015) School of Public Health, The University of Hong Kong, No. 21, Sassoon Road, Pokfulam, Hong Kong SAR COMMENT ##Assembly-Data-START## Assembly Method :: Geneious v. 8.1.7 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..4062 /organism="Middle East respiratory syndrome coronavirus" /mol_type="genomic RNA" /isolate="Nigeria-HKU004" /host="Camelus dromedarius" /db_xref="taxon:1335626" /country="Nigeria" /collection_date="13-Jan-2015" gene 1..4062 /gene="S" CDS 1..4062 /gene="S" /codon_start=1 /product="spike protein" /protein_id="ALS20350.1" /db_xref="GI:961442028" /translation="MIHSVFLLMFLLTPTESYVDVGPDSAKSACIEVDIQQTFFDKTW PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNYCPAGNSYTSFATYHTPATDCSDGN YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVTVPVSVIYDKETKTHATLFGSVACEHI SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSY QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMH QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFQKVQDAVNNNA QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH IEVVSAYGLCDLANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSFNTKY VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH" ORIGIN 1 atgatacact cagtgtttct actgatgttc ttgttaacac ctacagaaag ttacgttgat 61 gtagggccag attctgctaa gtctgcttgt attgaggttg atatacaaca gactttcttt 121 gataaaactt ggcctaggcc aattgatgtt tctaaggctg acggtattat ataccctcaa 181 ggccgtacat attctaacat aactatcact tatcaaggtc tttttcccta tcagggagac 241 catggtgata tgtatgttta ctctgcagga catgctacag gcacaactcc acaaaagttg 301 tttgtagcta actattctca ggacgtcaaa cagtttgcta atgggtttgt cgtccgtata 361 ggagcagctg ccaattccac tggcactgtt attattagcc catctaccag cgctactata 421 cgaaaaattt accctgcttt tatgctgggt tcttcagttg gtaatttctc agatggtaaa 481 atgggccgct tcttcaatca tactctagtt cttttgcccg atggatgtgg cactttactt 541 agagcttttt attgtattct agagcctcgc tctggaaatt attgtcctgc tggcaattcc 601 tatacttctt ttgccactta tcacactcct gcaacagatt gttctgatgg caattacaat 661 cgtaatgcca gtctgaactc ttttaaggag tattttaatt tacgtaactg cacctttatg 721 tacacttata acattaccga agatgagatt ttagagtggt ttggcattac acaaactgct 781 caaggtgttc acctcttctc atctcggtat gttgatttgt acggcggcaa tatgtttcaa 841 tttgccacct tgcctgttta tgatactatt aagtattatt ctatcattcc tcacagtatt 901 cgttctatcc aaagtgatag aaaagcttgg gctgccttct acgtatataa acttcaaccg 961 ttaactttcc tgttggattt ttctgttgat ggttatatac gcagagctat agactgtggt 1021 tttaatgatt tgtcacaact ccactgctca tatgaatcct tcgatgttga atctggagtt 1081 tattcagttt cgtctttcga agcaaaacct tctggctcag ttgtggaaca ggctgaaggt 1141 gttgaatgtg atttttcacc tcttctgtct ggcacacctc ctcaggttta taatttcaag 1201 cgtttggttt ttaccaattg caattataat cttaccaaat tgctttcact tttttctgtg 1261 aatgatttca cttgtagtca aatatctcca gcagcaattg ctagcaactg ttattcttca 1321 ctgattttgg attacttttc atacccactt agtatgaaat ccgatctcag tgttagttct 1381 gctggtccaa tatcccagtt taattataaa cagtcctttt ctaatcccac atgtttgatt 1441 ttagcgactg ttcctcataa ccttactact attactaagc ctcttaagta cagctatatt 1501 aacaagtgct ctcgtcttct ttctgatgat cgtactgaag tacctcagtt agtgaacgct 1561 aatcaatact caccctgtgt atccattgtc ccatccactg tgtgggaaga cggtgattat 1621 tataggaaac aactatctcc acttgaaggt ggtggctggc ttgttgctag tggctcaact 1681 gttgccatga ctgagcaatt acagatgggc tttggtatta cagttcaata tggtacagac 1741 accaatagtg tttgccccaa gcttgaattt gctaatgaca caaaaattgc ctctcaatta 1801 ggcaattgcg tggaatattc cctctatggt gtttcgggcc gtggtgtttt tcagaattgc 1861 acagctgtag gtgttcgaca gcagcgcttt gtttatgatg cgtaccagaa tttagttggc 1921 tattattctg atgatggcaa ctactactgt ttgcgtgctt gtgttactgt tcctgtttct 1981 gtcatctatg ataaagaaac taaaacccac gctactctat ttggtagtgt tgcatgtgaa 2041 cacatttctt ctaccatgtc tcaatactcc cgttctacgc gatcaatgct taaacggcga 2101 gattctacat atggccccct tcagacacct gttggttgtg tcctaggact tgttaattcc 2161 tctttgttcg tagaggactg caagttgcct cttggtcaat ctctctgtgc tcttcctgac 2221 acacctagta ctctcacacc tcgcagtgtg cgctctgttc caggtgaaat gcgcttggca 2281 tccattgctt ttaatcatcc tattcaggtt gatcaactta atagtagtta ttttaaatta 2341 agtataccca ctaatttttc ctttggtgtg actcaggagt acattcagac aaccattcag 2401 aaagttactg ttgattgtaa acagtacgtt tgcaatggtt ttcagaagtg tgagcaatta 2461 ctgcgcgagt atggccagtt ttgttccaaa ataaaccagg cgctccatgg tgccaattta 2521 cgccaggatg attctgtacg taatttgttt gcgagcgtga aaagctatca atcatctcct 2581 atcataccag gttttggagg tgactttaat ttgacacttc tagaacctgt ttctatatct 2641 actggcagtc gtagtgcacg tagtgctatt gaggatttgc tatttgacaa agtcactata 2701 gctgatcctg gttatatgca aggttacgat gattgcatgc atcaaggtcc agcatcagct 2761 cgtgatctta tttgtgctca atatgtggct ggttacaaag tattacctcc tcttatggat 2821 gttaatatgg aagccgcgta tacttcatct ttgcttggca gcatagcagg tgttggctgg 2881 actgctgggt tatcctcctt tgctgctatt ccatttgcac agagtatctt ttataggtta 2941 aacggtgttg gcattactca acaggttctt tcagagaacc aaaagcttat tgccaataag 3001 tttaatcagg ctctgggagc tatgcaaaca ggcttcacta caactaatga agcttttcag 3061 aaggttcagg atgctgtgaa caacaatgca caggctctat ccaaattagc tagcgagcta 3121 tctaatacct ttggtgctat ttccgcctct attggagaca tcatacaacg tcttgatgtt 3181 ctcgaacagg acgcccaaat agacagactt attaatggcc gtttgacaac actaaatgct 3241 tttgttgcgc agcagcttgt tcgttccgaa tcagctgctc tttcggctca attggctaaa 3301 gataaagtca atgagtgtgt caaggcacaa tccaagcgtt ctggattttg cggtcaaggc 3361 acacatatag tgtcctttgt tgtaaatgcc cctaatggcc tttacttcat gcatgttggt 3421 tattacccta gcaaccacat tgaggttgtt tctgcttatg gtctttgcga tttagctaac 3481 cctactaatt gtatagcccc tgttaatggc tactttatta aaactaataa cactaggatt 3541 gttgatgagt ggtcatatac tggctcgtcc ttctatgcac ctgagcccat cacctccttt 3601 aatactaagt atgttgcacc acaggtgaca taccaaaaca tttctactaa cctccctcct 3661 cctcttctcg gcaattccac cgggattgac tttcaagatg agttggatga gtttttcaaa 3721 aatgttagca ccagtatacc taattttggt tctctaacac agattaatac tacattactc 3781 gatcttacct acgagatgtt gtctcttcaa caagttgtta aagcccttaa tgagtcttac 3841 atagacctta aagagcttgg caattatact tattacaaca aatggccgtg gtacatttgg 3901 cttggtttca ttgctgggct tgttgcctta gctctatgcg tcttcttcat actgtgctgc 3961 actggttgtg gcacaaattg tatgggaaaa cttaagtgta atcgttgttg tgatagatat 4021 gaggaatacg acctcgagcc gcataaggtt catgttcact aa
  22. A full S gene sequences as well as a a partial ORF1b sequences from Nigeria-HKU004,as well as closely related partial S gene sequences from camels in Nigeria in association with Eurosurveillance paper have been released. http://eurosurveillance.org/ViewArticle.aspx?ArticleId=21327
  23. References World Health Organization (WHO). Middle East respiratory syndrome coronavirus (MERS-CoV): Summary of Current Situation, Literature Update and Risk Assessment. 7 July 2015. [Accessed 23 Oct 2015]. Available from:http://apps.who.int/iris/bitstream/10665/179184/2/WHO_MERS_RA_15.1_eng.pdf World Health Organization (WHO). Middle East respiratory syndrome coronavirus (MERS-CoV) – Saudi Arabia. Disease outbreak news. 13 November 2015. Available from: http://www.who.int/csr/don/13-november-2015-mers-saudi-arabia/en/ Haagmans BL, Al Dhahiry SHS, Reusken CBEM, Raj VS, Galiano M, Myers R, et al. Middle East respiratory syndrome coronavirus in dromedary camels: an outbreak investigation. Lancet Infect Dis. 2014;14(2):140-5. DOI: 10.1016/S1473-3099(13)70690-X PMID: 24355866Reusken CB, Haagmans BL, Müller MA, Gutierrez C, Godeke GJ, Meyer B, et al. Middle East respiratory syndrome coronavirus neutralising serum antibodies in dromedary camels: a comparative serological study. Lancet Infect Dis. 2013;13(10):859-66. DOI: 10.1016/S1473-3099(13)70164-6 PMID: 23933067Perera RA, Wang P, Gomaa MR, El-Shesheny R, Kandeil A, Bagato O, et al. Seroepidemiology for MERS coronavirus using microneutralisation and pseudoparticle virus neutralisation assays reveal a high prevalence of antibody in dromedary camels in Egypt, June 2013. Euro Surveill. 2013;18(36):20574. DOI: 10.2807/1560-7917.ES2013.18.36.20574 PMID: 24079378Chu DKW, Poon LLM, Gomaa MM, Shehata MM, Perera RAPM, Abu Zeid D, et al. MERS coronaviruses in dromedary camels, Egypt. Emerg Infect Dis. 2014;20(6):1049-53. DOI: 10.3201/eid2006.140299 PMID: 24856660Faye B, Bonnet P. Camel sciences and economy in the world: Current situation and perspectives. In: Johnson EH, Mascarina CS, Eds. Proceedings of Emerging Diseases of Camelids, 3rd Conference on the International Society of Camelid Research and Development; 29 January–1 February 2012, Muscat, Oman. p 2-15. Reusken CB, Messadi L, Feyisa A, Ularamu H, Godeke GJ, Danmarwa A, et al. Geographic distribution of MERS coronavirus among dromedary camels, Africa. Emerg Infect Dis. 2014;20(8):1370-4. DOI: 10.3201/eid2008.140590 PMID: 25062254Chan RW, Hemida MG, Kayali G, Chu DK, Poon LL, Alnaeem A, et al. Tropism and replication of Middle East respiratory syndrome coronavirus from dromedary camels in the human respiratory tract: an in-vitro and ex-vivo study. Lancet Respir Med. 2014;2(10):813-22. DOI: 10.1016/S2213-2600(14)70158-4 PMID: 25174549Smits SL, Raj VS, Pas SD, Reusken CB, Mohran K, Farag EA, et al. Reliable typing of MERS-CoV variants with a small genome fragment. J Clin Virol. 2015;64:83-7. DOI: 10.1016/j.jcv.2014.12.006 PMID: 25728084
  24. DiscussionWe report high MERS-CoV seroprevalence in camels gathered in an abattoir in Nigeria with relatively high detection rates of virus in nasal swabs. Phylogenetic analysis revealed that these viruses are genetically distinct from viruses reported from camels or humans in the Arabia peninsula and cluster with, but are clearly distinct from those reported from Egypt. However, it is important to note that these Nigerian viruses remain genetically closely related to other MERS-CoV with an overall nt similarity of > 0.98 for the S2 gene. Thus these are almost certainly pertaining to one viral species, and very likely (though not directly studied in the present work) also form one serotype. Although the animals in this study were sampled in Kano, Nigeria, some animals originated from neighbouring African countries. The camels are kept within the abattoir for a number of days before slaughter allowing opportunity for virus cross-infection and amplification. Thus the viruses detected in this study may reflect viruses circulating in this wider region. A limitation of this study is the short period within which the sampling was carried out. Thus it is unclear whether the high rate of virus detection reflects an all year-round pattern or if there are seasonal differences in virus activity. It has been suspected that virus activity in camels may increase during the calving season. In Nigeria, as in the Arabian peninsula, camel calving peaks during the January to March period. Thus it is possible that the rate of virus detection observed in this study reflects a seasonal peak. Indeed this was the rationale for targeting sampling within this time frame. Even if the observations of this study reflect a seasonal peak, the detection of MERS-CoV in camels slaughtered on five of seven days sampled, suggests intense exposure of humans to virus infected camels, whether seasonally or year round, and thus potentially a significant zoonotic threat. It is not known if the MERS-CoV in Nigeria has similar zoonotic potential to viruses currently circulating in the Arabian peninsula. Other explanations for the lack of zoonotic MERS in Africa include differences in patterns of exposure to infected animals or animal products or differences in human susceptibility to MERS-CoV. Alternatively, MERS may indeed be occurring but unrecognised in Africa due to lack of awareness or diagnostic testing. A second limitation of this study is that there were no virus isolates available for phenotypic characterisation and full genome sequence data were not available for genetic comparison across the whole genome with viruses known to infect humans. Comparison of the sequence of the spike gene with other MERS-CoV suggests that the virus isolated in Nigeria appears to have competence to bind the dipeptidyl peptidase (DPP)-4 receptor. Viruses isolated from Egypt, though genetically distinct, had comparable tropism and replication competence in ex vivo cultures of the human bronchus and lung to those viruses isolated from humans in Saudi Arabia [9]. Thus zoonotic potential of these viruses cannot be excluded. Further studies to determine the genetic diversity and biological characterisation of MERS-CoV across Africa are urgently needed. Studies looking into seroprevalence of humans exposed to settings associated with such high levels of exposure to MERS-CoV such as camel abattoirs across Africa are also important to assess the extent of zoonotic spill-over, if any. AcknowledgementsThis study is supported by a research grant from the US National Institutes of Health (contract No. HHSN272201400006C).
  25. ResultsOverall, 132 of the 385 animals slaughtered during this period (34%; daily range: 24%–43%) were sampled shortly after slaughter. Nasal swabs were collected from all 132 camels, while serum samples were obtained from 131. MERS-CoV RNA was detected by both UpE and ORF-1a RT-qPCR assays in 14 (11%), nasal swabs with positive samples being found in five of the seven days sampled (Table). Threshold cycles of the positives by UpE assay ranged from 23.8 to 37.4, which represented 3.54x102 to 2.60x106 copies of virus RNA per 1 mL of original swab sample. Ages of the MERS-CoV positive animals ranged from three to 12 years-old. TableSwabs and sera collected from dromedary camels and results of reverse transcription-quantitative polymerase chain reaction and serology for Middle East respiratory syndrome coronavirus, Nigeria, January 2015 Sampling dateNumber of camels slaughteredSwabs sampledSwabs positive n (%)Sera sampledSera positive n (%)13 Jan 201545114 (36)119 (82)14 Jan 201554176 (35)1716 (94)15 Jan 201550180 (0)1818 (100)16 Jan 201548151 (7)1515 (100)17 Jan 201570302 (7)3028 (93)18 Jan 201555191 (5)1919 (100)19 Jan 201563220 (0)2120 (95)Total38513214 (11)131125 (95) On a daily basis, the seroprevalence ranged from 82% to 100%, giving an overall seroprevalence of 95% (Table). All 14 animals positive by RT-qPCR were also positive for MERS-CoV antibody by ppNT. The highest MERS-CoV RNA positive rate by RT-qPCR was detected on the days with lowest seroprevalence. We sequenced a 600 bp region in S2 gene of six selected RT-qPCR positive samples, representing at least one positive sample from each day with PCR-positive samples. Phylogenetic analysis showed that these six viruses formed two distinct lineages, the virus from a camel sampled on 16 January being distinct from the others (Figure 1). Figure 1Phylogenetic analysis of the Middle East respiratory syndrome coronaviruses (MERS-CoVs) recovered from Nigeria Phylogenetic tree of S2 (600 bp) gene sequences obtained by neighbour-joining method with bootstrap values >60 indicated. The tree is mid-point rooted. Sequences generated from this study are in bold with GenBank accession numbers: KU201953–58. Accession numbers of other sequences retrieved from GenBank are shown in brackets. Both of the Nigerian virus groups were distinct from previously known virus lineages. The Nigerian camel viruses were most closely related to virus NRCE-HKU270 previously found in Egypt with nt sequence similarity of 99.3 to 99.6%. MERS-CoV in Nigeria were genetically distinct from viruses found in camels in the Middle East and viruses detected in humans in more recent years (nt sequence similarity ranging from 98.4 to 99.4%) (Figure 2). Figure 2Pairwise similarities between nucleotide sequences of spike S2 region of Middle East respiratory syndrome coronaviruses, including several recovered from Nigeria and other representative viruses ID: identical virus. The time-resolved phylogeny of the ORF1b region of one virus confirms these overall findings (Figure 3). Figure 3Time resolved phylogenetic tree of open reading frame (ORF)1b of Middle East respiratory syndrome coronaviruses (MERS-CoVs) recovered in Africa and the Middle East, 2012–2015 The time resolved phylogenetic tree was constructed using Bayesian evolutionary analysis by sampling trees (BEAST) with an uncorrelated lognormal relaxed clock based on open reading frame (ORF)1b (5,347 bp) gene sequences of representative MERS-CoVs. Median ages of the nodes with respective to MERS-CoV ChinaGD (the latest virus included) are shown. The tree is rooted to bat coronavirus Neoromicia. The sequence generated from this study (Nigeria-HKU004) is in bold and has GenBank accession number KU201959. GenBank accession numbers of other sequences retrieved for the phylogenetic analysis are shown in brackets. We derived the nt sequence of the full spike gene of one virus Nigeria HKU004 and the deduced amino acid sequence is aligned and compared to those of other human and animal MERS-CoV in Figure 4. This reveals that the receptor binding domain, which is crucial for virus host range and tropism, is fully conserved. There are only two amino acid residues not previously reported in other MERS-CoV spike proteins; these being S 656 T and L 1200 F. Figure 4Alignment of the full spike protein amino acid sequence of a Middle East respiratory syndrome coronavirus (MERS-CoV) found in Nigeria with those of other MERS-CoVs GenBank accession number for MERS-CoV Nigeria HKU004 was KU201953. RBD: receptor binding domain; UD: undefined.

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.