Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. 1 agtgaatagc ttggctatct cacttcccct cgttctcttg cagaactttg attttaacga 61 acttaaataa aagccctgtt gtttagcgta ttgttgcact tgtctggtgg gattgtggca 121 ctaatttgcc tgctcatcta ggcagtggac atatgctcaa cactgggtat aattctaatt 181 gaatactatt tttcagttag agcgtcgtgt ctcttgtacg tctcggtcac aatatacggt 241 ttcgtccggt gcgtggcaat tcggggcaca tcatgtcttt cgtggctggt gtgatcgcgc 301 aaggtgcgcg cggtacgtat cgagcagcgc tcaactctga aaaacatcaa gaccatgtgt 361 ctctaactgt gccactctgt ggttcaggaa acctggttga aaaactttca ccatggttca 421 tggatggcga aaatgcctat gaagtggtca aggccatgtt acttaaaaaa gagccacttc 481 tctatgtgcc catccggctg gctggacaca ctagacacct cccaggtcct cgtgtgtacc 541 tggttgagag gctcattgct tgtgaaaatc cattcatggt taaccaattg gcttatagct 601 ctagtgcaaa tggcagcctg gttggcacaa ctttgcaggg caagcctatt ggtatgttct 661 tcccttatga catcgaactt gtcacaggaa agcaaaatat tctcctgcgc aagtatggcc 721 gtggtggtta tcactacacc ccagtccact atgagcgaga caacacctct tgccctgagt 781 ggatggacga ttttgaggcg gatcctaaag gcaaatatgc ccagaatctg cttaagaagt 841 tgattggcgg tgatgtcact ccagttgacc aatacatgtg tggcgttgat ggaaaaccca 901 ttagtgccta cgcattttta atggccaagg atggaataac caaactggct gatgttgaag 961 cggacgtcgc agcacgtgct gatgacgaag gcttcatcac attaaagaac aatctatata 1021 gattggtttg gcatgttgag cgtaaagacg ttccatatcc taagcaatct atttttacta 1081 ttaatagtgt ggtccaaaag gatggtgttg aaaacactcc tcctcactat tttactcttg 1141 gatgcaaaat tttaacgctc accccacgca acaagtggag tggcgtttct gacttgtccc 1201 tcaaacaaaa actcctttac accttctatg gtaaggagtc acttgagaac ccaacctaca 1261 tttaccactc cgcattcatt gagtgtggaa gttgtggtaa tgattcctgg cttacaggga 1321 atgctatcca agggtttgcc tgtggatgtg gggcatcata tacagctaat gatgtcgaag 1381 tccaatcatc tggcatgatt aagccaaatg ctcttctttg tgctacttgc ccctttgcta 1441 agggtgacag ctgttcttct aattgcaaac attcagttgc tcagttggtt agttaccttt 1501 ctgaacgctg taatgttatt gctgattcta agtccttcac acttatcttt ggtggcgtag 1561 cttacgccta ctttggatgt gaggaaggta ctatgtactt tgtgcctaga gctaagtctg 1621 ttgtctcaag gattggagac tccatcttta caggctgtac tggctcttgg aacaaggtca 1681 ctcaaattgc taacatgttc ttggaacaga ctcagcattc ccttaacttt gtgggagagt 1741 tcgttgtcaa cgatgttgtc ctcgcaattc tctctggaac cacaactaat gttgacaaaa 1801 tacgccagct tctcaaaggt gtcaccattg acaagttgcg tgattattta gctgactatg 1861 acgtagcagt cactgccggc ccattcatgg ataatgctat taatgttggt ggtacaggat 1921 tacagtatgc cgccattact gcaccttatg tagttctcac tggcttaggt gagtccttta 1981 agaaagttgc aaccataccg tacaaggttt gcaactctgt taaggatact ctgacttatt 2041 atgctcacag cgtgttgtac agagtttttc cttatgacat ggattctggt gtgtcatcct 2101 ttagtgaact actttttgat tgcgttgatc tttcagtagc ttctacctat tttttagtcc 2161 gcctcttgca agataagact ggcgacttta tgtctacaat tattacttcc tgccaaactg 2221 ctgttagtaa gcttctagat acatgttttg aagctacaga agcaacattt aacttcttgt 2281 tagatttggc aggattgttc agaatctttc ttcgcaatgc ctatgtgtac acttcacaag 2341 ggtttgtggt ggtcaatggc aaagtttcta cacttgtcaa acaagtgtta gacttgctta 2401 ataagggtat gcaacttttg catacaaagg tctcctgggc tggttctaat atcagtgctg 2461 ttatctacag cggcagggag tctctaatat tcccatcggg aacctattac tgtgtcacca 2521 ctaaggctaa gtccgttcaa caagatcttg acgttatttt gcctggtgag ttttccaaga 2581 agcagttagg actgctccaa cctactgaca attctacaac tgttagtgtt actgtatcca 2641 gtaacatggt tgaaactgtt gtgggtcaac ttgagcaaac taatatgcat agtcctgatg 2701 ttatagtagg tgactatgtc attattagtg aaaaattgtt tgtgcgtagt aaggaagaag 2761 acggattcgc cttctaccct gcttgcacta atggtcatgc tgtaccgact ctctttagac 2821 ttaagggagg tgcacctgta aaaaaagtag cctttggcgg tgatcaagta catgaggttg 2881 ctgctgtaag aagtgttact gtcgagtaca acattcatgc tgtattagac acactacttg 2941 cttcttctag tcttagaacc tttgttgtag ataagtcttt gtcaattgag gagtttgctg 3001 acgtagtaaa ggaacaagtc tcagacttgc ttgttaaatt actgcgtgga atgccgattc 3061 cagattttga tttagacgat tttattgacg caccatgcta ttgctttaac gctgagggtg 3121 atgcatcttg gtcttctact atgatcttct ctcttcaccc cgtcgagtgt gacgaggagt 3181 gttctgaagt agaggcttca gatttagaag aaggtgaatc agagtgcatt tctgagactt 3241 caactgaaca agttgacgtt tctcatgaga tttctgacga cgagtgggct gctgcagttg 3301 atgaagcgtt ccccctcgat gaagcagaag atgttactga atctgtgcaa gaagaagcac 3361 aaccagtaga agtacctgtt gaagatattg cgcaggttgt catagctgac accttacagg 3421 aaactcctgt tgtgtctgat actgttgaag tcccaccgca agtggtgaaa cttccgtctg 3481 aacctcagac tatccagccc gaggtaaaag aagttgcacc tgtctatgag gctgataccg 3541 aacagacaca gagtgttact gttaaaccta agaggttacg caaaaagcgt aatgttgacc 3601 ctttgtccaa ttttgaacat aaggttatta cagagtgcgt taccatagtt ttaggtgacg 3661 caattcaagt agccaagtgc tatggggagt ctgtgttagt taatgctgct aacacacatc 3721 ttaagcatgg cggtggtatc gctggtgcta ttaatgcggc ttcaaaaggg gctgtccaaa 3781 aagagtcaga tgagtatatt ctggctaaag ggccgttaca agtaggagat tcagttctct 3841 tgcaaggcca ttctctagct aagaatatcc tgcatgtcgt aggcccagat gcccgcgcta 3901 aacaggatgt ttctctcctt agtaagtgct ataaggctat gaatgcatat cctcttgtag 3961 tcactcctct tgtttcaaca ggcatatttg gtgtaaaacc agctgtgtct tttgattatc 4021 ttattagaga ggctaagact agagttttag tcgtcgttaa ttcccaagat gtctataaga 4081 gtcttaccat agttgacatt ccacagagtt tgactttttc atatgatggg ttacgtggcg 4141 caatacgtaa agctaaagat tatggtttta ctgtttttgt gtgcacagac aactctgcta 4201 acactaaagt tcttaggaac aagggtgttg attatactaa gaagtttctt acagttgacg 4261 gtgtgcaata ttattgctac acgtctaagg acactttaga tgatatctta caacaggcta 4321 ataagtctgt tggtattata tctatgcctt tgggatatgt gtctcatggt ttagacttaa 4381 ttcaagcagg gagtgtcgtg cgtagagtta acgtgcccta cgtgtgtctc ctagctaata 4441 aagagcaaga agctattttg atgtctgaag acgttaagtt aaacccttca gaagatttta 4501 taaagcacgt ccgcactaat ggtggttaca attcttggca tttagtcgag ggtgaactat 4561 tggtgcaaga cttacgctta aataagctcc tgcattggtc tgatcaaacc atatgctaca 4621 aggatagtgt gttttatgtt gtaaagaata gtacagcttt tccatttgaa acactttcag 4681 catgtcgtgc gtatttggat tcacgcacga cacagcagtt aacaatcgaa gtcttagtga 4741 ctgtcgatgg tgtaaatttt agaacagtcg ttctaaataa taagaacact tatagatcac 4801 agcttggatg cgttttcttt aatggtgctg atatttctga taccattcct gatgagaaac 4861 agaatggtca cagtttatat ctagcagaca atttgactgc tgatgaaaca aaggcgctta 4921 aagagttata tggccccgtt gatcctactt tcttacacag attctattca cttaaggctg 4981 cagtccataa gtggaagatg gttgtgtgtg ataaggtacg ttctctcaaa ttgagtgata 5041 ataattgtta tcttaatgca gttattatga cacttgattt attgaaggac attaaatttg 5101 ttatacctgc tctacagcat gcatttatga aacataaggg cggtgattca actgacttca 5161 tagccctcat tatggcttat ggcaattgca catttggtgc tccagatgat gcctctcggt 5221 tacttcatac cgtgcttgca aaggctgagt tatgctgttc tgcacgcatg gtttggagag 5281 agtggtgcaa tgtctgtggc ataaaagatg ttgttctaca aggcttaaaa gcttgttgtt 5341 acgtgggtgt gcaaactgtt gaagatctgc gtgctcgcat gacatatgta tgccagtgtg 5401 gtggtgaacg tcatcggcaa atagtcgaac acaccacccc ctggttgctg ctctcaggca 5461 caccaaatga aaaattggtg acaacctcca cggcgcctga ttttgtagcg tttaatgtct 5521 ttcagggcat tgaaacggct gttggccatt atgttcatgc tcgcctgaag ggtggtctta 5581 ttttaaagtt tgactctggc accgttagca agacttcaga ctggaagtgc aaggtgacag 5641 atgtactttt ccccggccaa aaatacagta gcgattgtaa tgtcgtacgg tattctttgg 5701 acggtaattt cagaacagag gttgatcccg acctatctgc tttctatgtt aaggatggta 5761 aatactttac aagtgaacca cccgtaacat attcaccagc tacaatttta gctggtagtg 5821 tctacactaa tagctgcctt gtatcgtctg atggacaacc tggcggtgat gctattagtt 5881 tgagttttaa taacctttta gggtttgatt ctagtaaacc agtcactaag aaatacactt 5941 actccttctt gcctaaagaa gacggcgatg tgttgttggc tgagtttgac acttatgacc 6001 ctatttataa gaatggtgcc atgtataaag gcaaaccaat tctttgggtc aacaaagcat 6061 cttatgatac taatcttaat aagttcaata gagctagttt gcgtcaaatt tttgacgtag 6121 cccccattga actcgaaaat aaattcacac ctttgagtgt ggcgtccaca ccagttgaac 6181 ctccaactgt agatgtggta gcacttcaac aggaaatgac aattgtcaaa tgtaagggtt 6241 taaataaacc tttcgtgaag gacaatgtca gtttcgttgc tgatgactca ggtactcccg 6301 ttgttgagta tctgtctaaa gaagatctac atacattgta tgtagaccct aagtatcaag 6361 tcattgtctt aaaagacaat gtactttctt ctatgcttag attgcacacc gttgagtcag 6421 gtgatattaa cgttgttgca gcttccggat ctttgacacg taaagtgaag ttactattta 6481 gggcttcatt ttatttcaaa gaatttgcta cccgcacttt cactgctacc actgctgtag 6541 gtagttgtat aaagagtgta gtgcggcatc taggtgttac taaaggcata ttgacaggct 6601 gttttagttt tgtcaagatg ttatttattc ttccactagc ttactttagt gattcaaaaa 6661 tcggcaccac agaggttaaa gtgagtgctt tgaaaacagc tggcgttgtg acaggtaatg 6721 ttgtaaaaca gtgttgcact gctgctgttg atttaagtat ggataagttg cgccgtgtgg 6781 attggaaatc aaccctacgg ttgttactta tgttatgcac aactatggta ttgttgtctt 6841 ctgtgtatca cttgtatgtc ttcaatcagg tcttatcaag tgatgttatg tttgaagatg 6901 cccaaggttt gaaaaagttc tacaaagaag ttagagctta cctaggaatc tcttctgctt 6961 gtgacggtct tgcttcagct tatagggcga attcatttga tgtacctaca ttctgcgcaa 7021 accgttctgc aatgtgtaat tggtgcttga ttagccaaga ttccataact cactacccag 7081 ctcttaagat ggttcaaaca catcttagcc actatgttct taacatagat tggttgtggt 7141 ttgcatttga gactggtttg gcatacatgc tctatacctc ggccttcaac tggttgttgt 7201 tggcaggtac attgcattat ttctttgcac agacttccat atttgtagac tggcggtcat 7261 gcaattatgc tgtgtctagt gccttctggt tatttaccca cattccaatg gcgggtttgg 7321 tacgaatgta taatttgtta gcatgccttt ggcttttacg caagttttat cagcatgtaa 7381 tcaatggttg caaagatacg gcatgcttgc tctgctataa gaggaaccga cttactagag 7441 ttgaagcttc taccgttgtc tgtggtggaa aacgtacgtt ttatatcaca gcaaatggcg 7501 gtatttcatt ctgtcgtagg cataattgga attgtgtgga ttgtgacatt gcaggtgtgg 7561 ggaatacctt catctgtgaa gaagtcgcaa atgacctcac taccgcccta cgcaggccta 7621 ttaacgctac ggatagatca cattattatg tggattccgt tacagttaaa gagactgttg 7681 ttcagtttaa ttatcgtaga gacggtcaac cattctacga gccgtttccc ctctgcgctt 7741 ttacaaatct agataagttg aagttcaaag aggtctgtaa aactactact ggtatacctg 7801 aatacaactt tatcatctac gactcatcag atcgtggcca ggaaagttta gctaggtctg 7861 catgtgttta ttattctcaa gtcttgtgta aatcaattct tttggttgac tcaagtttgg 7921 ttacttctgt tggtgattct agtgaaatcg ccactaaaat gtttgattcc tttgttaata 7981 gtttcgtctc gctgtataat gtcacacgcg aaaagttgga aaaacttatc tctactgctc 8041 gtgatggcgt aaggcgaggc gataacttcc atagtgtctt aacaacattc attgacgcag 8101 cacgaggccc cgcaggtgtg gagtctgatg ttgagaccaa tgaaattgtt gactctgtgc 8161 agtatgctca taaacatgac atacaaatta ctaatgagag ttacaataat tatgtaccct 8221 catatgttaa acctgatagt gtgtctacca gtgatttagg tagtctcatt gattgtaatg 8281 cggcttcagt taaccaaatt gtcttgcgta attctaatgg tgcttgtatt tggaacgctg 8341 ctgcatatat gaaactctcg gatgcactta aacgacagat tcgcattgca tgccgtaagt 8401 gtaatttagc tttccggtta accacctcaa agctacgcgc taatgataat atcttatcag 8461 ttagattcac tgctaacaaa attgttggtg gtgctcctac atggtttaat gtgttgcgtg 8521 actttacgtt aaagggttac gttcttgcta ccattattgt gtttctgtgt gctgtactga 8581 tgtatttgtg tttacctaca ttttctatgg tacctgttga attttatgaa gaccgcatct 8641 tggactttaa agttcttgat aatggtatca ttagggatgt aaatcctgat gataagtgct 8701 ttgctaataa gcaccggtcc ttcacacaat ggtatcatga gcatgttggt ggtgtctatg 8761 acaactctat cacatgccca ttgacagttg cagtaattgc tggagttgct ggtgctcgca 8821 ttccagacgt acctactaca ttggcttggg tgaacaatca gataattttc tttgtttctc 8881 gagtctttgc taatacaggc agtgtttgct acactcctat agatgagata ccctataaga 8941 gtttctctga tagtggttgc attcttccat ctgagtgcac tatgtttagg gatgcagagg 9001 gccgtatgac accatactgc catgatccta ctgttttgcc tggggctttt gcgtacagtc 9061 agatgaggcc tcatgttcgt tacgacttgt atgatggtaa catgtttatt aaatttcctg 9121 aagtagtatt tgaaagtaca cttaggatta ctagaactct gtcaactcag tactgccggt 9181 tcggtagttg tgagtatgca caagagggtg tttgtattac cacaaatggc tcgtgggcca 9241 tttttaatga ccaccatctt aatagacctg gtgtctattg tggctctgat tttattgaca 9301 ttgtcaggcg gttagcagta tcactgttcc agcctattac ttatttccaa ttgactacct 9361 cattggtctt gggtataggt ttgtgtgcat tcctgacttt gctcttctat tatattaata 9421 aagtaaaacg tgcttttgca gattacaccc agtgtgctgt aattgctgtt gttgctgctg 9481 ttcttaatag cttgtgcatc tgctttgttg cctctatacc attgtgtata ttaccttaca 9541 ctgcattgta ctattatgct acattctatt ttactaatga gcctgcattt attatgcatg 9601 tttcttggta cattatgttc gggcctatcg ttcccatatg gatgacctgc gtctatacag 9661 ttgcaatgtg ctttagacac ttcttctggg ttttagctta ttttagtaag aaacatgtag 9721 aagtttttac tgatggtaag cttaattgta gtttccagga cgctgcctct aatatctttg 9781 ttattaacaa ggacacttat gcagctctta gaaactcttt aactaatgat gcctattcac 9841 gatttttggg gttgtttaac aagtataagt acttctctgg tgctatggaa acagccgctt 9901 atcgtgaagc tgcagcatgt catcttgcta aagccttaca aacatacagc gagactggta 9961 gtgatcttct ttaccaacca cccaactgta gcataacctc tggcgtgttg caaagcggtt 10021 tggtgaaaat gtcacatccc agtggagatg ttgaggcttg tatggttcag gttacctgcg 10081 gtagcatgac tcttaatggt ctttggcttg acaacacagt ctggtgccca cgacacgtaa 10141 tgtgcccggc tgaccagttg tctgatccta attatgatgc cttgttgatt tctatgacta 10201 atcatagttt cagtgtgcaa aaacacattg gcgctccagc aaacttgcgt gttgttggtc 10261 atgccatgca aggcactctt ttgaagttga ctgtcgatgt tgctaaccct agcactccag 10321 cctacacttt tacaacagtg aaacctggcg cagcatttag tgtgttagca tgctataatg 10381 gtcgtccgac tggtacattc actgttgtaa tgcgccctaa ctacacaatt aagggttcct 10441 ttctgtgtgg ttcttgtggt agtgttggtt acaccaagga gggtagtgtg atcaattttt 10501 gttacatgca tcaaatggaa cttgctaatg gtacacatac cggttcagca tttgatggta 10561 ctatgtatgg tgcctttatg gataaacaag tgcaccaagt tcagttaaca gacaaatact 10621 gcagtgttaa tgtagtagct tggctttacg cagcaatact taatggttgc gcttggtttg 10681 taaaacctaa tcgcactagt gttgtttctt ttaatgaatg ggctcttgcc aaccaattca 10741 ctgaatttgt tggcactcaa tccgttgaca tgttagctgt caaaacaggc gttgctattg 10801 aacagctgct ttatgcgatc caacaacttt atactgggtt ccagggaaag caaatccttg 10861 gcagtactat gttggaagat gaattcacac ctgaggatgt taatatgcag attatgggtg 10921 tggttatgca gagtggtgtg agaaaagtta catatggtac tgcgcattgg ttgttcgcga 10981 cccttgtctc aacctatgtg ataatcttac aagccactaa atttactttg tggaactact 11041 tgtttgagac tattcccaca cagttgttcc cactcttatt tgtgactatg gccttcgtta 11101 tgttgttggt taaacacaaa cacacctttt tgacactttt cttgttgcct gtggctattt 11161 gtttgactta tgcaaacata gtctacgagc ccactactcc catttcgtca gcgctgattg 11221 cagttgcaaa ttggcttgcc cccactaatg cttatatgcg cactacacat actgatattg 11281 gtgtctacat tagtatgtca cttgtattag tcattgtagt gaagagattg tacaacccat 11341 cactttctaa ctttgcgtta gcattgtgca gtggtgtaat gtggttgtac acttatagca 11401 ttggagaagc ctcaagtccc attgcctatc tggtttttgt cactacactc actagtgatt 11461 atacgattac agtctttgtt actgtcaacc ttgcaaaagt ttgcacttat gccatctttg 11521 cttactcacc acagcttaca cttgtgtttc cggaagtgaa gatgatactt ttattataca 11581 catgtttagg tttcatgtgt acttgctatt ttggtgtctt ctctcttttg aaccttaagc 11641 ttagagcacc tatgggtgtc tatgacttta aggtctcaac acaagagttc agattcatga 11701 ctgctaacaa tctaactgca cctagaaatt cttgggaggc tatggctctg aactttaagt 11761 taataggtat tggcggtaca ccttgtataa aggttgctgc tatgcagtct aaacttacag 11821 atcttaaatg cacatctgtg gttctcctct ctgtgctcca acagttacac ttagaggcta 11881 atagtagggc ctgggctttc tgtgttaaat gccataatga tatattggca gcaacagacc 11941 ccagtgaggc tttcgagaaa ttcgtaagtc tctttgccac tttaatgact ttttctggta 12001 atgtagatct tgatgcgtta gctagtgata tttttgacac tcctagcgta cttcaagcta 12061 ctctttctga gttttcacac ttagctacct ttgctgagtt ggaagctgcg cagaaagcct 12121 atcaggaagc tatggactct ggtgacacct caccacaagt tcttaaggct ttgcagaagg 12181 ctgttaatat agctaaaaac gcctatgaga aggataaggc agtggcccgt aagttagaac 12241 gtatggctga tcaggctatg acttctatgt ataagcaagc acgtgctgaa gacaagaaag 12301 caaaaattgt cagtgctatg caaactatgt tgtttggtat gattaagaag ctcgacaacg 12361 atgttcttaa tggtatcatt tctaacgcta ggaatggttg tatacctctt agtgtcattc 12421 cactgtgtgc ttcaaataaa cttcgcgttg taattcctga cttcaccgtc tggaatcagg 12481 tagtcacata tccctcgctt aactacgctg gggctttgtg ggacattaca gttataaaca 12541 atgtggacaa tgaaattgtt aagtcttcag atgttgtaga cagcaatgaa aatttaccat 12601 ggccccttgt tttagaattc gctagggcat ccacttctgc cgctaagttg caaaataatg 12661 agatcaaacc ttcaggttta aaaaccatgg ttgtgtctgc aggtcaagag caaactaact 12721 gtaatactag ttccttagct tattacgaac ctgtgcaggg tcgtaaaatg ctgatggctc 12781 ttctttctga taatgcctat ctcaaatggg cgcgtgttga aggtaaggac ggatttgtta 12841 gtgtagagct acaacctcct tgcaaattct tgattgcggg accaaaagga cctgaaatcc 12901 gatatctcta ttttgttaaa aatcttaaca accttcatcg cgggcaagtg ttagggcaca 12961 ttgctgcgac tgttagattg caagctggtt ctaacaccga gtttgcctct aattcttcgg 13021 tgttgtcact tgttaacttc accgttgatc ctcaaaaagc ttatctcgat ttcgtcaatg 13081 cgggaggtgc cccattgaca aattgtgtta agatgcttac tcctaaaact ggtacaggta 13141 tagctatatc tgttaaacca gagagtacag ctgatcaaga gacttatggt ggagcttcag 13201 tgtgtctcta ttgccgtgcg catatagaac atcctgatgt ctctggtgtt tgtaaatata 13261 agggtaagtt tgtccaaatc cctgctcagt gtgtccgtga ccctgtggga ttttgtttgt 13321 caaatacccc ctgtaatgtc tgtcaatatt ggattggata tgggtgcaat tgtgactcgc 13381 ttaggcaagt agcactgccc caatctaaag attccaattt tttaaacgag tccggggttc 13441 tattgtaaat gcccgaatag aaccctgttc aagtggtttg tccactgatg tcgtctttag 13501 ggcatttgac atctgcaact ataaggctaa ggttgctggt attggaaaat actacaagac 13561 taatacttgt aggtttgtag aattagatga ccaagggcat catttagact cctattttgt 13621 cgttaagagg catactatgg agaattatga actagagaag cactgttacg atttgttacg 13681 tgactgtgat gctgtagctc cccatgattt cttcatcttt gatgtagaca aagttaaaac 13741 acctcatatt gtacgtcagc gtttaactga gtacactatg atggatcttg tatatgccct 13801 gaggcacttt gatcaaaata gcgaagtgct taaggctatc ttagtgaagt atggttgctg 13861 tgatgttacc tactttgaaa ataaactctg gtttgatttt gttgaaaatc ccagtgttat 13921 tggtgtttat cataaacttg gagaacgtgt acgccaagct atcttaaaca ctgttaaatt 13981 ttgtgaccac atggtcaagg ctggtttagt cggtgtgctc acactagaca accaggacct 14041 taatggcaag tggtatgatt ttggtgactt cgtaatcact caacctggtt caggagtagc 14101 tatagttgat agctactatt cttatttgat gcctgtgctc tcaatgaccg attgtctggc 14161 cgctgagaca catagggatt gtgattttaa taaaccactc attgagtggc cacttactga 14221 gtatgatttt actgattata aggtacaact ctttgagaag tactttaaat attgggatca 14281 gacgtatcac gcaaattgcg ttaattgtac tgatgaccgt tgtgtgttac attgtgctaa 14341 tttcaatgta ttgtttgcta tgaccatgcc taagacttgt ttcggaccca tagtccgaaa 14401 gatctttgtt gatggcgtgc catttgtagt atcttgtggt tatcactaca aagaattagg 14461 tttagtcatg aatatggatg ttagtctcca tagacatagg ctctctctta aggagttgat 14521 gatgtatgcc gctgatccag ccatgcacat tgcctcctct aacgcttttc ttgatttgag 14581 gacatcatgt tttagtgtcg ctgcacttac aactggtttg acttttcaaa ctgtgcggcc 14641 tggcaatttt aaccaagact tctatgattt cgtggtatct aaaggtttct ttaaggaggg 14701 ctcttcagtt acgctcaaac attttttctt tgctcaagat ggtaatgctg ctattacaga 14761 ttataattac tattcttata atctgcctac tatgtgtgac atcaaacaaa tgttgttctg 14821 catggaagtt gtaaacaagt acttcgaaat ctatgacggt ggttgtctta atgcttctga 14881 agtggttgtt aataatttag acaagagtgc tggccatcct tttaataagt ttggcaaagc 14941 tcgtgtctat tatgagagca tgtcttacca ggagcaagat gaactctttg ccatgacaaa 15001 gcgtaacgtc attcctacca tgactcaaat gaatctaaaa tatgctatta gtgctaagaa 15061 tagagctcgc actgttgcag gcgtgtccat acttagcaca atgactaatc gccagtacca 15121 tcagaaaatg cttaagtcca tggctgcaac tcgtggagcg acttgcgtca ttggtactac 15181 aaagttctat ggtggctggg atttcatgct taaaacattg tacaaagatg tcgataatcc 15241 gcatcttatg ggttgggatt accctaagtg tgatagagct atgcctaata tgtgtagaat 15301 cttcgcttca ctcatattag ctcgtaaaca tggcacttgt tgtactacaa gggacagatt 15361 ttatcgcttg gcaaatgagt gtgctcaggt gctaagcgaa tatgttctat gtggtggtgg 15421 ttactacgtc aaacctggag gtaccagtag cggagatgcc accactgcat atgccaatag 15481 tgtctttaac attttgcagg cgacaactgc taatgtcagt gcacttatgg gtgctaatgg 15541 caacaagatt gttgacaaag aagttaaaga catgcagttt gatttgtatg tcaatgttta 15601 caggagcact agcccagacc ccaaatttgt tgataaatac tatgcttttc ttaataagca 15661 cttttctatg atgatactgt ctgatgacgg tgtcgtttgc tataatagtg attatgcagc 15721 taagggttac attgctggaa tacagaattt taaggaaacg ctgtattatc agaacaatgt 15781 ctttatgtct gaagctaaat gctgggtgga aaccgatctg aagaaagggc cacatgaatt 15841 ctgttcacag catacgcttt atattaagga tggcgacgat ggttacttcc ttccttatcc 15901 agacccttca agaattttgt ctgccggttg ctttgtagat gatatcgtta agactgacgg 15961 tacactcatg gtagagcggt ttgtgtcttt ggctatagat gcttaccctc tcacaaagca 16021 tgaagatata gaataccaga atgtattctg ggtctactta cagtatatag aaaaactgta 16081 taaagacctt acaggacaca tgcttgacag ttattctgtc atgctatgtg gtgataattc 16141 tgctaagttt tgggaagagg cattctacag agatctctat agttcgccta ccactttgca 16201 ggctgtcggt tcatgcgttg tatgccattc acagacttcc ctacgctgtg ggacatgcat 16261 ccgtagacca tttctctgct gtaaatgctg ctatgatcat gttatagcaa ctccacataa 16321 gatggttttg tctgtttctc cttacgtttg taatgcccct ggttgtggcg tttcagacgt 16381 tactaagcta tatttaggtg gtatgagcta cttttgtgta gatcatagac ctgtgtgtag 16441 ttttccactt tgcgctaatg gtcttgtatt cggcttatac aagaatatgt gcacaggtag 16501 tccttctata gttgaattta ataggttggc tacctgtgac tggactgaaa gtggtgatta 16561 cacccttgcc aatactacaa cagaaccact caaacttttt gctgctgaga ctttacgtgc 16621 cactgaagag gcgtctaagc agtcttatgc tattgccacc atcaaagaaa ttgttggtga 16681 gcgccaacta ttacttgtgt gggaggctgg caagtccaaa ccaccactca atcgtaatta 16741 tgtttttact ggttatcata taaccaaaaa tagtaaagtg cagctcggtg agtacatctt 16801 cgagcgcatt gattatagtg atgctgtatc ctacaagtct agtacaacgt ataaactgac 16861 tgtaggtgac atcttcgtac ttacctctca ctctgtggct accttgacgg cgcccacaat 16921 tgtgaatcaa gagaggtatg ttaaaattac tgggttgtac ccaaccatta cggtacctga 16981 agagttcgca agtcatgttg ccaacttcca aaaatcaggt tatagtaaat atgtcactgt 17041 tcagggacca cctggcactg gcaaaagtca ttttgctata gggttagcga tttactaccc 17101 tacagcacgt gttgtttata cagcatgttc acacgcagct gttgatgctt tgtgtgaaaa 17161 agcttttaaa tatttgaaca ttgctaaatg ttcccgtatc attcctgcaa aggcacgtgt 17221 tgagtgctat gacaggttta aagttaatga gacaaattct caatatttgt ttagtactat 17281 taatgctcta ccagaaactt ctgccgatat tctggtggtt gatgaggtta gtatgtgcac 17341 taattatgat ctttcaatta ttaatgcacg tattaaagct aagcacattg tctatgtagg 17401 agatccagca cagttgccag ctcctaggac tttgttgact agaggcacat tggaaccaga 17461 aaatttcaat agtgtcacta gattgatgtg taacttaggt cctgacatat ttttaagtat 17521 gtgctacagg tgtcctaagg aaatagtaag cactgtgagc gctcttgtct acaataataa 17581 attgttagcc aagaaggagc tttcaggcca gtgctttaaa atactctata agggcaatgt 17641 gacgcatgat gctagctctg ccattaatag accacaactc acatttgtga agaattttat 17701 tactgccaat ccggcatgga gtaaggcagt ctttatttcg ccttataatt cacagaatgc 17761 tgtggctcgt tcaatgctgg gtcttactac tcagactgtt gattcctcac agggttcaga 17821 ataccagtac gttatcttct gtcaaacagc agatacggca catgctaaca acattaacag 17881 atttaatgtt gcaatcactc gtgcccaaaa aggtattctt tgtgttatga catctcaggc 17941 actctttgag tccttagagt ttactgaatt gtcttttact aattacaagc tccagtctca 18001 gattgtaact ggccttttta aagattgctc tagagaaact tctggcctct cacctgctta 18061 tgcaccaaca tacgttagtg ttgatgacaa gtataagacg agtgatgagc tttgcgtgaa 18121 tcttaattta cccgcaaata tcccatactc tcgtgttatt tccaggatgg gctttaaact 18181 cgatgcaaca gttcctggat atcctaagct tttcattact cgtgaagagg ctgtaaggca 18241 agttcgaagc tggataggct tcgatgttga gggtgctcat gcttcccgta atgcatgtgg 18301 caccaatgtg cctctacaat taggattttc aactggtgtg aactttgttg ttcagccagt 18361 tggtgttgta gacactgagt ggggtaacat gttaacgggc attgctgccc gtcctccacc 18421 aggtgaacag tttaagcacc tcgtgcctct tatgcataag ggggctgcgt ggcctattgt 18481 tagacgacgt atagtgcaaa tgttgtcaga cactttagac aaattgtctg attactgtac 18541 gtttgtttgt tgggctcatg gctttgaatt aacgtctgca tcatactttt gcaagatagg 18601 taaggaacag aagtgttgca tgtgcaatag acgcgctgta gcgtactctt cgcctctgca 18661 atcttatgcc tgctggactc attcctgcgg ttatgattat gtctacaacc ctttctttgt 18721 cgatgttcaa cagtggggtt atgtaggcaa tcttgctact aatcacgatc gttattgctc 18781 tgtccatcaa ggagctcatg tggcttctaa tgatgcaata atgactcgtt gtttagctat 18841 tcattcttgt tttatagaac gtgtggattg ggatatagag tatccttata tctcacatga 18901 aaagaaattg aattcctgtt gtagaatcgt tgagcgcaac gtcgtacgtg ctgctcttct 18961 tgccggttca tttgacaaag tctatgatat tggcaatcct aaaggaattc ctattgttga 19021 tgaccctgtg gttgattggc attattttga tgcacagccc ttgaccagaa aggtacaaca 19081 gcttttctat acagaggaca tggcctcaag atttgctgat gggctctgct tattttggaa 19141 ctgtaatgta ccaaaatatc ctaataatgc aattgtatgc aggtttgaca cacgtgtgca 19201 ttctgagttc aatttgccag gttgtgatgg cggtagtttg tatgttaaca agcacgcttt 19261 tcatacacca gcatatgatg tgagtgcatt ccgtgatctg aaacctttac cattctttta 19321 ttattctact acaccatgtg aagtgcatgg taatggtagt atgatagagg atattgatta 19381 tgtaccccta aaatctgcag tctgtattac agcttgtaat ttagggggcg ctgtttgtag 19441 gaagcatgct acagagtaca gagagtatat ggaagcatat aatcttgtct ctgcatcagg 19501 tttccgcctt tggtgttata agacctttga tatttataat ctctggtcta cttttacaaa 19561 agttcaaggt ttggaaaaca ttgcttttaa tgttgttaaa caaggccatt ttattggtgt 19621 tgagggtgaa ctacctgtag ctgtagtcaa tgataagatc ttcaccaaga gtggcgttaa 19681 tgacatttgt atgtttgaga ataaaaccac tttgcctact aatatagctt ttgaactcta 19741 tgctaagcgt gctgtacgct cgcatcctga tttcaaattg ctacacaatt tacaagcaga 19801 catttgctac aagttcgtcc tttgggatta tgaacgtagc aatatttatg gtactgctac 19861 tattggtgta tgtaagtaca ctgatattga tgttaattca gctttgaata tatgttttga 19921 catacgcgat aatggttcat tggagaagtt catgtctact cccaatgcca tctttatttc 19981 tgatagaaaa attaagaaat acccttgtat tgtaggtcct gattatgctt acttcaatgg 20041 tgctatcatc cgtgatagtg atgttgttaa acaaccagtg aagttctact tgtataagaa 20101 agtcaataat gagtttattg atcctactga gtgtatttac actcagagtc gctcttgtag 20161 tgacttccta cccctgtctg acatggagaa agactttcta tcttttgata gtgatgtttt 20221 cattaagaag tatggcttgg aaaactatgc ttttgagcac gtagtctatg gagacttctc 20281 tcatactacg ttaggcggtc ttcacttgct tattggttta tacaagaagc aacaggaagg 20341 tcatattatt atggaagaaa tgctaaaagg tagctcaact attcataact attttattac 20401 tgagactaac acagcggctt ttaaggcggt gtgttctgtt atagatttaa agcttgacga 20461 ctttgttatg attttaaaga gtcaagacct tggcgtagta tccaaggttg tcaaggttcc 20521 tattgactta acaatgattg agtttatgtt atggtgtaag gatggacagg ttcaaacctt 20581 ctaccctcga ctccaggctt ctgcagattg gaaacctggt catgcaatgc catccctctt 20641 taaagttcaa aatgtaaacc ttgaacgttg tgagcttgct aattacaagc aatctattcc 20701 tatgcctcgc ggtgtgcaca tgaacatcgc taaatatatg caattgtgcc agtatttaaa 20761 tacttgcaca ttagccgtgc ctgccaatat gcgtgttata cattttggcg ctggttctga 20821 taaaggtatc gctcctggta catcagtttt acgacagtgg cttcctacag atgccattat 20881 tatagataat gatttaaatg agttcgtgtc agatgctgac ataactttat ttggagattg 20941 tgtaactgta cgtgtcggcc aacaagtgga tcttgttatt tccgacatgt atgatcctac 21001 tactaagaat gtaacaggta gtaatgagtc aaaggcttta ttctttactt acctgtgtaa 21061 cctcattaat aataatcttg ctcttggtgg gtctgttgct attaaaataa cagaacactc 21121 ttggagcgtt gaactttatg aacttatggg aaaatttgct tggtggactg ttttctgcac 21181 caatgcaaat gcatcctcat ctgaaggatt cctcttaggt attaattact tgggtactat 21241 taaagaaaat atagatggtg gtgctatgca cgccaactat atattttgga gaaattccac 21301 tcctatgaat ctgagtactt actcactttt tgatttatcc aagtttcaat taaaattaaa 21361 aggaacacca gttcttcaat taaaggagag tcaaattaac gaactcgtaa tatctctcct 21421 gtcgcagggt aagttactta tccgtgacaa tgatacactc agtgtttcta ctgatgttct 21481 tgttaacacc tacagaaagt tacgttgatg tagggccaga ttctgttaag tctgcttgta 21541 ttgaggttga tatacaacag actttctttg ataaaacttg gcctaggcca attgatgttt 21601 ctaaggctga cggtattata taccctcaag gccgtacata ttctaacata actatcactt 21661 atcaaggtct ttttccctat cagggagacc atggtgatat gtatgtctac tctgcaggac 21721 atgctacagg cacaactcca caaaagttgt ttgtagctaa ctattctcag gacgtcaaac 21781 agtttgctaa tgggtttgtc gtccgtatag gagcagctgc caattccact ggcactgtta 21841 ttattagccc atctaccagc gctactatac gaaaaattta ccctgctttt atgctgggtt 21901 cttcagttgg taatttctca gatggtaaaa tgggccgctt cttcaatcat actctagttc 21961 ttttgcccga tggatgtggc actttactta gagcttttta ttgtattcta gagcctcgct 22021 ctggaaatca ttgtcctgct ggcaattcct atacttcttt tgccacttat cacactcctg 22081 caacagattg ttctgatggc aattacaatc gtaatgccag tctgaactct tttaaggagt 22141 attttaattt acgtaactgc acctttatgt acacttataa cattaccgaa gatgagattt 22201 tagagtggtt tggcattaca caaactgctc aaggtgttca cctcttctca tctcggtatg 22261 ttgatttgta cggcggcaat atgtttcaat ttgccacctt gcctgtttat gatactatta 22321 agtattattc tatcattcct cacagtattc gttctatcca aagtgataga aaagcttggg 22381 ctgccttcta cgtatataaa cttcaaccgt taactttcct gttggatttt tctgttgatg 22441 gttatatacg cagagctata gactgtggtt ttaatgattt gtcacaactc cactgctcat 22501 atgaatcctt cgatgttgaa tctggagttt attcagtttc gtctttcgaa gcaaaacctt 22561 ctggctcagt tgtggaacag gctgaaggtg ttgaatgtga tttttcacct cttctgtctg 22621 gcacacctcc tcaggtttat aatttcaagc gtttggtttt taccaattgc aattataatc 22681 ttaccaaatt gctttcactt ttttctgtga atgattttac ttgtagtcaa atatctccag 22741 cagcaattgc tagcaactgt tattcttcac tgattttgga ttatttttca tacccactta 22801 gtatgaaatc cgatctcagt gttagttctg ctggtccaat atcccagttt aattataaac 22861 agtccttttc taatcccaca tgtttgattt tagcgactgt tcctcataac cttactacta 22921 ttactaagcc tcttaagtac agctatatta acaagtgctc tcgtcttctt tctgatgatc 22981 gtactgaagt acctcagtta gtgaacgcta atcaatactc accctgtgta tccattgtcc 23041 catccactgt gtgggaagac ggtgattatt ataggaaaca actatctcca cttgaaggtg 23101 gtggctggct tgttgctagt ggctcaactg ttgccatgac tgagcaatta cagatgggct 23161 ttggtattac agttcaatat ggtacagaca ccaatagtgt ttgccccaag cttgaatttg 23221 ctaatgacac aaaaattgcc tctcaattag gcaattgcgt ggaatattcc ctctatggtg 23281 tttcgggccg tggtgttttt cagaattgca cagctgtagg tgttcgacag cagcgctttg 23341 tttatgatgc gtaccagaat ttagttggct attattctga tgatggcaac tactactgtt 23401 tgcgtgcttg tgttagtgtt cctgtttctg tcatctatga taaagaaact aaaacccacg 23461 ctactctatt tggtagtgtt gcatgtgaac acatttcctc taccatgtct caatactccc 23521 gttctacgcg atcaatgctt aaacggcgag attctacata tggtcccctt cagacacctg 23581 ttggttgtgt cctaggactt gttaattcct ctttgttcgt agaggactgc aagttgcctc 23641 ttggtcaatc tctctgtgct cttcctgaca cacctagtac tctcacacct cgcagtgtgc 23701 gctctgttcc aggtgaaatg cgcttggcat ccattgcttt taatcatcct attcaggttg 23761 atcaacttaa tagtagttat tttaaattaa gtatacctac taatttttcc tttggtgtga 23821 ctcaggagta cattcagaca accattcaga aagttactgt tgattgtaaa cagtacgttt 23881 gcaatggttt ccagaagtgt gagcaattac tgcgcgagta tggccagttt tgtgccaaaa 23941 taaaccaggc tctccatggt gccaatttac gccaggatga ttctgtacgt aatttgtttg 24001 cgagcgtgaa aagctctcaa tcatctccta tcataccagg ttttggaggt gactttaatt 24061 tgacacttct agaacctgtt tctatatcta ctggcagtcg tagtgcacgt agtgctattg 24121 aggatttgct atttgacaaa gtcactatag ctgatcctgg ttatatgcaa ggttacgatg 24181 attgcatgca gcaaggtcca gcatcagctc gtgatcttat ttgtgctcaa tatgtggctg 24241 gttataaagt attacctcct cttatggatg ttaatatgga agccgcgtac acttcatctt 24301 tgcttggcag catagcaggt gttggctgga ctgctggctt atcctccttt gctgctattc 24361 catttgcaca gagtattttt tataggttaa acggtgttgg cattactcaa caggttcttt 24421 cagagaacca aaagcttatt gccaataagt ttaatcaggc tctgggagct atgcaaacag 24481 gcttcactac aactaatgaa gcttttcgga aggttcagga tgctgtgaac aacaatgcac 24541 aggctctatc caaattagct agcgagctat ctaatacttt tggtgctatt tccgcctcta 24601 ttggagacat catacaacgt cttgatgttc tcgaacagga cgcccaaata gacagactta 24661 ttaatggccg tttgacaaca ctaaatgctt ttgttgcaca gcagcttgtt cgttccgaat 24721 cagctgctct ttccgctcaa ttggctaaag ataaagtcaa tgagtgtgtc aaggcacaat 24781 ccaagcgttc tggattttgc ggtcaaggca cacatatagt gtcctttgtt gtaaatgccc 24841 ctaatggcct ttactttatg catgttggtt attaccctag caaccacatt gaggttgttt 24901 ctgcttatgg tctttgcgat gcagctaacc ctactaattg tatagcccct gttaatggct 24961 actttattaa aactaataac actaggattg ttgatgagtg gtcatatact ggctcgtcct 25021 tctatgcacc tgagcccatc acctctctta atactaagta tgttgcacca caggtgacat 25081 accaaaacat ttctactaac ctccctcctc ctcttctcgg caattccacc gggattgact 25141 tccaagatga gttggatgag tttttcaaaa atgttagcac cagtatacct aattttggtt 25201 ctctaacaca gattaatact acattactcg atcttaccta cgagatgttg tctcttcaac 25261 aagttgttaa agcccttaat gagtcttaca tagaccttaa agagcttggc aattatactt 25321 attacaacaa atggccgtgg tacatttggc ttggtttcat tgctgggctt gttgccttag 25381 ctctatgcgt cttcttcata ctgtgctgca ctggttgtgg cacaaactgt atgggaaaac 25441 ttaagtgtaa tcgttgttgt gatagatacg aggaatacga cctcgagccg cataaggttc 25501 atgttcacta attaacgaac tatcaatgag agttcaaaga ccacccactc tcttgttagt 25561 gttctcactc tcttttttgg tcactgcatt ttcaaaacct ctctatgtac ctgagcattg 25621 tcagaattat tctggttgca tgcttagggc ttgtattaaa actgcccaag ctgatacagc 25681 tggtctttat acaaattttc gaattgacgt cccatctgca gaatcaactg gtactcaatc 25741 agtttctgtc gatcgtgagt ctacttcaac tcatgatggt cttaccgaac atgttactag 25801 tgtgaatctt tttgacgttg gttactcagt taattaacga actctatgga ttacgtgtct 25861 ctgcttaatc aaatttggca gaagtacctt aattcaccgt atactacttg tttgtatatc 25921 cctaaaccca cagctaagta tacaccttta gttggcactt cattgcaccc tgtgctgtgg 25981 aactgtcagc tatcctttgc tggttatact gaatctgctg ttaattctac aaaagctttg 26041 gccaaacagg acgcagctca gcgaatcgct tggttgctac ataaggatgg aggaatccct 26101 gacggatgtt ccctctacct ccggcactca agtttattcg cgcaaagcca ggaagaggag 26161 tcattctcca actaagaaac tgcgctacgt taagcgtaga ttttctcttc tgcgccctga 26221 agaccttagt gttattgtcc aaccaacaca ctatgtcagg gttacatttt cagaccccaa 26281 catgtggtat ctacgttcgg gtcatcattt acactcagtt cacaattggc ttaaacctta 26341 tggcggccaa cctgtttctg agtaccatat tactctagct ttgctaaatc tcactgatga 26401 agatttagct agagattttt cacccattgc gctctttttg cgcaatgtca gatttgagct 26461 acatgagttc gccttgctgc gcaaaactct tgttcttaat gcatcagaga tctactgtgc 26521 taacatacat agatttaagc ctgtgtatag agttaacacg gcaatcccta ctattaagga 26581 ttggcttctc gttcagggat tttcccttta ccatagtggc ctccctttac atatgtcaat 26641 ctctaaattg catgcactgg atgatgttac tcgcaattac atcattacaa tgccatgctt 26701 tagaacttat cctcaacaaa tgtttgttac tcctttggcc gtagatgttg tctccatacg 26761 gtcttccaat cagggtaata aacaaattgt tcattcttac cccattttac atcatccagg 26821 attttaacga actatggctt tctcggcgtc tttatttaaa cccgtccagc tagtcccagt 26881 ttctcccgca tttcatcgca ttgagtctac tgactctatt gttttcacat acattcctgc 26941 tagcggctat gtagctgctt tagctgtcaa tgtgtgtctc attcccctat tattactgct 27001 acgtcaagat acttgtcgtc gcagcattat cagaactatg gttctctatt tccttgttct 27061 ttataacttt ttattagcca ttgtactagt caatggttta cattatccaa ctggaagttg 27121 cctgatagcc ttcttagtta tcctcataat actttggttt gtagatagaa ttcgtttctg 27181 tctcatgctg aattcctaca ttccactgtt tgacatgcgt tctcacttta ttcgtgttag 27241 tacagtttct tctcatggta tggtccctgt catacacacc aaaccattat ttattagaaa 27301 cttcgatcag cgttgcagct gttctcgttg tttttatttg cactcttcta cttatataga 27361 gtgcacttat attagccgtt ttagtaagat tagcctagtt tctgtaactg acttctcctt 27421 aaacggcaat gtttccactg ttttcgtgcc tgcaacgcgc gattcagttc ctcttcacat 27481 aatcgccccg agctcgctta tcgtttaagc agctctgcgc tactatgggt cccgtgtaga 27541 ggctaatcca ttagtctctc tttggacata tggaaaacga actatgttac cctttgtcca 27601 agaacgaata gggttgttca tagtaaactt tttcattttt accgtagtat gtgctataac 27661 actcttggtg tgtatggctt tccttacggc tactagatta tgtgtgcaat gtatgacagg 27721 cttcaatacc ctgttagttc agcccgcatt atacttgtat aatactggac gttcagtcta 27781 tgtaaaattc caggatagta aaccccctct accacctgac gagtgggttt aacgaactcc 27841 ttcataatgt ctaatatgac gcaactcact gaggcgcaga ttattgccat tattaaagac 27901 tggaactttg catggtccct gatctttctc ttaattacta tcgtactaca gtatggatac 27961 ccatcccgta gtatgactgt ctatgtcttt aaaatgtttg ttttatggct cctatggcca 28021 tcttccatgg cgctatcaat atttagcgcc atttatccaa ttgatctagc ttcccagata 28081 atctctggca ttgtagcagc tgtttcagct atgatgtgga tttcctactt tgtgcagagt 28141 atccggctgt ttatgagaac tggatcatgg tggtcattca atcctgagac taattgcctt 28201 ttgaacgttc caattggtgg tacaactgtc gtacgtccac tcgtagagga ctctaccagt 28261 gtaactgctg ttgtaaccaa tggtcacctc aaaatggctg gcatgcattt cggtgcttgt 28321 gactacgaca gacttcctaa tgaagtcacc gtggccaaac ccaatgtgct gattgcttta 28381 aaaatggtga agcggcaaag ctacggaact aattccggcg ttgccattta ccatagatat 28441 aaggcaggta attacaggag tccgcctatt acggcggata ttgaacttgc attgcttcga 28501 gcttaggctc tttagtaaga gtatcttaat tgattttaac gaatctcaat ttcattgtta 28561 tggcatcccc tgctgcacct cgtgctgttt cctttgccga taacaatgat ataacaaata 28621 caaacctgtc tcgaggtaga ggacgtaatc caaaaccacg agctgcacca aataacactg 28681 tctcttggta cactgggctt acccaacacg ggaaagtccc tcttaccttt ccacctgggc 28741 agggtgtacc tcttaatgcc aattccaccc ctgcgcaaaa tgctgggtat tggcggagac 28801 aggacagaaa aattaatacc gggaatggaa ttaagcaact ggctcccagg tggtacttct 28861 actacactgg aactggaccc gaagcagcac tcccattccg ggctgttaag gatggcatcg 28921 tttgggtcca tgaagatggc gccactgatg ctccttcaac ttttgggacg cggaacccta 28981 acaatgattc agctattgtt acacaattcg cgcccggtac taagcttcct aaaaacttcc 29041 acattgaggg gactggaggc aatagtcaat catcttcaag agcctctagc gtaagcagaa 29101 actcttccag atctagttca caaggttcaa gatcaggaaa ctctacccgc ggcacttctc 29161 caggtccatc tggaatcgga gcagtaggag gtgatctact ttaccttgat cttctgaaca 29221 gactacaagc ccttgagtct ggcaaagtaa agcaatcgca gccaaaagta atcactaaga 29281 aagatgctgc tgctgctaaa aataagatgc gccacaagcg cacttccacc aaaagtttca 29341 acatggtgca agcttttggt cttcgcggac caggagacct ccagggaaac tttggtgatc 29401 ttcaattgaa taaactcggc actgaggacc cacgttggcc ccaaattgct gagcttgctc 29461 ctacagccag tgcttttatg ggtatgtcgc aatttaaact tacccatcag aacaatgatg 29521 atcatggcaa ccctgtgtac ttccttcggt acagtggagc cattaaactt gacccaaaga 29581 atcccaacta caataagtgg ttggagcttc ttgagcaaaa tattgatgcc tacaaaacct 29641 tccctaagaa ggaaaagaaa caaaaggcac caaaagaaga atcaacagac caaatgtctg 29701 aacctccaaa ggagcagcgt gtgcaaggta gcatcactca gcgcactcgc acccgtccaa 29761 gtgttcagcc tggtccaatg attgatgtta acactgatta gtgtcactc
  2. LOCUS KT225476 29809 bp RNA linear VRL 10-SEP-2015 DEFINITION Middle East respiratory syndrome coronavirus isolate MERS-CoV/THA/CU/17_06_2015, complete genome. ACCESSION KT225476 VERSION KT225476.2 GI:926663056 KEYWORDS . SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV) ORGANISM Middle East respiratory syndrome coronavirus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus; unclassified Betacoronavirus. REFERENCE 1 (bases 1 to 29809) AUTHORS Plipat,T., Buathong,R., Siriarayapon,P., Wacharapluesadee,S., Kaewpom,T., Prtcharat,S., Ponpinit,T., Jumpasri,J., Joyjinda,Y., Rodpan,A., Jittmitraphap,A., Khongwichit,S., Smith,D.R. and Hemachudha,T. TITLE First imported case of MERS-CoV infection in Thailand, June 2015 JOURNAL Unpublished REFERENCE 2 (bases 1 to 29809) AUTHORS Plipat,T., Buathong,R., Siriarayapon,P., Wacharapluesadee,S., Kaewpom,T., Prtcharat,S., Ponpinit,T., Jumpasri,J., Joyjinda,Y., Rodpan,A., Jittmitraphap,A., Khongwichit,S., Smith,D.R. and Hemachudha,T. TITLE Direct Submission JOURNAL Submitted (30-JUN-2015) Department of Disease Control Ministry of Public Health, Bureau of Epidemiology, Tivanond Road, Muang, Nonthaburi 11000, Thailand REFERENCE 3 (bases 1 to 29809) AUTHORS Plipat,T., Buathong,R., Siriarayapon,P., Wacharapluesadee,S., Kaewpom,T., Prtcharat,S., Ponpinit,T., Jumpasri,J., Joyjinda,Y., Rodpan,A., Jittmitraphap,A., Khongwichit,S., Smith,D.R., Hemachudha,T. and Ghai,S. TITLE Direct Submission JOURNAL Submitted (02-SEP-2015) Department of Disease Control Ministry of Public Health, Bureau of Epidemiology, Tivanond Road, Muang, Nonthaburi 11000, Thailand REMARK Sequence update by submitter COMMENT On Sep 10, 2015 this sequence version replaced gi:861032911. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..29809 /organism="Middle East respiratory syndrome coronavirus" /mol_type="genomic RNA" /isolate="MERS-CoV/THA/CU/17_06_2015" /isolation_source="sputum" /host="Homo sapiens" /db_xref="taxon:1335626" /country="Thailand" /collection_date="17-Jun-2015" CDS join(273..13427,13427..21508) /ribosomal_slippage /codon_start=1 /product="ORF1ab" /protein_id="ALD51902.1" /db_xref="GI:926663057" /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE VEASDLEEGESECISETSTEQVDVSHEISDDEWAAAVDEAFPLDEAEDVTESVQEEAQ PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSK EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKIGT TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN WLLLAGTLHYFFAQTSIFVDWRSCNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP FYEPFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTREKLEKLISTARDGVRRG DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ CAVIAVVAAVLNSLCICFVASIPLCILPYTALYYYATFYFTNEPAFIMHVSWYIMFGP IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS NENLPWPLVLEFARASTSAAKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANIPYS RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAVAYSSPLQSYAC WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE DIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCIVGPDYAYFNGAIIRDSDV VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG DCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT LSVSTDVLVNTYRKLR" CDS 273..13448 /codon_start=1 /product="ORF1a" /protein_id="ALD51903.1" /db_xref="GI:926663058" /translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE VEASDLEEGESECISETSTEQVDVSHEISDDEWAAAVDEAFPLDEAEDVTESVQEEAQ PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSK EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKIGT TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN WLLLAGTLHYFFAQTSIFVDWRSCNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP FYEPFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTREKLEKLISTARDGVRRG DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ CAVIAVVAAVLNSLCICFVASIPLCILPYTALYYYATFYFTNEPAFIMHVSWYIMFGP IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS NENLPWPLVLEFARASTSAAKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL" CDS 21450..25511 /codon_start=1 /product="S protein" /protein_id="ALD51904.1" /db_xref="GI:926663059" /translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT IQKVTVDCKQYVCNGFQKCEQLLREYGQFCAKINQALHGANLRQDDSVRNLFASVKSS QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH" CDS 25526..25837 /codon_start=1 /product="ORF3" /protein_id="ALD51905.1" /db_xref="GI:926663060" /translation="MRVQRPPTLLLVFSLSFLVTAFSKPLYVPEHCQNYSGCMLRACI KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGLTEHVTSVNLFDVGYSV N" CDS 25846..26175 /codon_start=1 /product="ORF4a" /protein_id="ALD51906.1" /db_xref="GI:926663061" /translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSQ EEESFSN" CDS 26087..26827 /codon_start=1 /product="ORF4b" /protein_id="ALD51907.1" /db_xref="GI:926663062" /translation="MEESLTDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA VDVVSIRSSNQGNKQIVHSYPILHHPGF" CDS 26834..27508 /codon_start=1 /product="ORF5" /protein_id="ALD51908.1" /db_xref="GI:926663063" /translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGLHYPTGSCLIAFLV ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA PSSLIV" CDS 27584..27832 /codon_start=1 /product="E protein" /protein_id="ALD51909.1" /db_xref="GI:926663064" /translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV" CDS 27847..28506 /codon_start=1 /product="M protein" /protein_id="ALD51910.1" /db_xref="GI:926663065" /translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF MRTGSWWSFNPETNCLLNVPIGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR A" CDS 28560..29801 /codon_start=1 /product="N protein" /protein_id="AKO73399.1" /db_xref="GI:861032912" /translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI TQRTRTRPSVQPGPMIDVNTD" CDS 28756..29094 /codon_start=1 /product="ORF8b" /protein_id="AKO73400.1" /db_xref="GI:861032913" /translation="MPIPPLRKMLGIGGDRTEKLIPGMELSNWLPGGTSTTLELDPKQ HSHSGLLRMASFGSMKMAPLMLLQLLGRGTLTMIQLLLHNSRPVLSFLKTSTLRGLEA IVNHLQEPLA"
  3. Thailand MoPH has released full MERS June 2015 import sequence, MERS-CoV/THA/CU/17_06_2015, which matches sequences from South Korea and Guangdong Province, China.
  4. http://rense.gsradio.net:8080/rense/special/rense_Niman_091715.mp3
  5. Middle East Respiratory Syndrome coronavirus (MERS-CoV) – Saudi ArabiaDisease outbreak news 17 September 2015 Between 6 and 11 September 2015, the National IHR Focal Point for the Kingdom of Saudi Arabia notified WHO of 22 additional cases of Middle East respiratory syndrome coronavirus (MERS-CoV) infection. Three (3) of these reported cases are associated with a MERS-CoV outbreak currently occurring in a hospital in Riyadh city. Five (5) of these reported cases are associated with another MERS-CoV outbreak occurring in a hospital in Madinah city. Details of the casesA 34-year-old, male, non-national health care worker from Madinah city developed symptoms on 5 September and, on 6 September, was admitted to the hospital where he works. The patient, who has no comorbidities, tested positive for MERS-CoV on 7 September. Currently, he is in critical condition in ICU. The patient provided care to a laboratory-confirmed MERS-CoV case (see DON published on 8 September – case no. 8). He has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 35-year-old, female, non-national health care worker from Madinah city developed symptoms on 5 September and, on 6 September, was admitted to the hospital where she works. The patient, who has no comorbidities, tested positive for MERS-CoV on 7 September. Currently, she is in critical condition in ICU. The patient provided care to a laboratory-confirmed MERS-CoV case (see DON published on 8 September – case no. 8). She has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.An 82-year-old male from Madinah city developed symptoms on 4 September while admitted to hospital due to chronic conditions since 22 August. The patient tested positive for MERS-CoV on 6 September. Currently, he is in critical condition in ICU. The patient has a history of contact with a laboratory-confirmed MERS-CoV case (see below – case no. 6). He has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 45-year-old male from Riyadh city developed symptoms on 31 August and, on 8 September, was admitted to hospital. The patient, who has comorbidities, tested positive for MERS-CoV on 9 September. Investigation of history of exposure to the known risk factors in the 14 days prior to the onset of symptoms is ongoing. Currently, he is in critical condition in ICU.A 33-year-old male from Riyadh city developed symptoms on 4 September while admitted to hospital due to chronic conditions since 29 July. This hospital has been experiencing a MERS-CoV outbreak. The patient tested positive for MERS-CoV on 6 September. Currently, he is in stable condition in a negative pressure isolation room on a ward. Investigation of possible epidemiological links with the MERS-CoV cases in the hospital or with shared health care workers is ongoing. The patient has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 33-year-old, male, non-national health care worker from Madinah city developed symptoms on 5 September and, on 6 September, was admitted to the hospital where he works. This hospital has been experiencing a MERS-CoV outbreak. The patient, who has no comorbidities, tested positive for MERS-CoV on 7 September. Currently, he is in critical condition in ICU. Investigation of possible epidemiological links with the MERS-CoV cases in the hospital is ongoing. The patient has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 61-year-old male from Aldwadmi city developed symptoms on 31 August and, on 6 September, was admitted to hospital. The patient, who has comorbidities, tested positive for MERS-CoV on 8 September. Currently, he is in stable condition in a negative pressure isolation room on a ward. The patient has a history of contact with camels but has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 23-year-old male health care worker from Riyadh city developed symptoms on 4 September and, on 6 September, was admitted to hospital. The hospital where he works has been experiencing a MERS-CoV outbreak. The patient, who has comorbidities, tested positive for MERS-CoV on 8 September. Currently, he is in stable condition in a negative pressure isolation room on a ward. Investigation of possible epidemiological links with the MERS-CoV cases in the hospital is ongoing.A 58-year-old female from Riyadh city developed symptoms on 28 August and, on 5 September, was admitted to hospital. The patient, who has comorbidities, tested positive for MERS-CoV on 6 September. Currently, she is in critical condition in ICU. The patient has a history of frequent contact with camels and consumption of their raw milk. She has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 55-year-old, non-national male from Kharj city developed symptoms on 1 September and, on 5 September, was admitted to hospital. The patient, who has comorbidities, tested positive for MERS-CoV on 7 September. Currently, he is in stable condition in a negative pressure isolation room on a ward. Investigation of history of exposure to the known risk factors in the 14 days prior to the onset of symptoms is ongoing.A 62-year-old female from Riyadh city developed symptoms on 3 September and, on 5 September, was admitted to hospital. The patient, who has comorbidities, tested positive for MERS-CoV on 6 September. Currently, she is in critical condition in ICU. Investigation of history of exposure to the known risk factors in the 14 days prior to the onset of symptoms is ongoing.A 76-year-old female from Madinah city developed symptoms on 5 September while admitted to hospital due to chronic conditions since 16 March. This hospital has been experiencing a MERS-CoV outbreak. The patient tested positive for MERS-CoV on 6 September. Currently, she is in stable condition in a negative pressure isolation room on a ward. Investigation of possible epidemiological links with the MERS-CoV cases in the hospital or with shared health care workers is ongoing. She has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.An 80-year-old male from Riyadh city developed symptoms on 27 August and, on 4 September, was admitted to hospital. The patient, who has comorbidities, tested positive for MERS-CoV on 5 September. Currently, he is in critical condition in ICU. Investigation of history of exposure to the known risk factors in the 14 days prior to the onset of symptoms is ongoing.A 26-year-old female from Shaqra city developed symptoms on 29 August and, on 5 September, was admitted to hospital. The patient, who has no comorbidities, tested positive for MERS-CoV on 6 September. Currently, she is in stable condition in a negative pressure isolation room on a ward. Investigation of history of exposure to the known risk factors in the 14 days prior to the onset of symptoms is ongoing.An 85-year-old male from Riyadh city developed symptoms on 2 September while admitted to hospital due to chronic conditions since 7 August. This hospital has been experiencing a MERS-CoV outbreak. The patient tested positive for MERS-CoV on 4 September. Currently, he is in stable condition in a negative pressure isolation room on a ward. Investigation of possible epidemiological links with the MERS-CoV cases in the hospital or with shared health care workers is ongoing. The patient has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 38-year-old, female, non-national health care worker from Riyadh city developed symptoms on 2 September and, on the same day, was admitted to the hospital where she works. This hospital has been experiencing a MERS-CoV outbreak. The patient, who has no comorbidities, tested positive for MERS-CoV on 4 September. Currently, she is in stable condition in home isolation. Investigation of possible epidemiological links with the MERS-CoV cases in the hospital is ongoing. The patient has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 30-year-old, male, non-national health care worker from Riyadh city developed symptoms on 3 September and, on the same day, was admitted to the hospital where he works. This hospital has been experiencing a MERS-CoV outbreak. The patient, who has no comorbidities, tested positive for MERS-CoV on 5 September. Currently, he is in stable condition in home isolation. Investigation of possible epidemiological links with the MERS-CoV cases in the hospital is ongoing. The patient has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 41-year-old male from Riyadh city developed symptoms on 29 August and, on 4 September, was admitted to hospital. The patient, who has no comorbidities, tested positive for MERS-CoV on 5 September. Currently, he is in stable condition in a negative pressure isolation room on a ward. Investigation of history of exposure to the known risk factors in the 14 days prior to the onset of symptoms is ongoing.A 27-year-old, male health care worker from Riyadh city developed symptoms on 29 August and, on the same day, was admitted to hospital. This hospital has been experiencing a MERS-CoV outbreak. The patient, who has no comorbidities, tested positive for MERS-CoV on 1 September. Currently, he is in stable condition in a negative pressure isolation room on a ward. Investigation of possible epidemiological links with the MERS-CoV cases in the hospital is ongoing. The patient has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 77-year-old male from Riyadh city developed symptoms on 27 August and, on 3 September, was admitted to hospital. The patient, who has comorbidities, tested positive for MERS-CoV on 5 September. Currently, he is in stable condition in a negative pressure isolation room on a ward. Investigation of history of exposure to the known risk factors in the 14 days prior to the onset of symptoms is ongoing.A 30-year-old, female, non-national health care worker from Riyadh city developed symptoms on 3 September and, on the same day, was admitted to the hospital where she works. This hospital has been experiencing a MERS-CoV outbreak. The patient, who has no comorbidities, tested positive for MERS-CoV on 5 September. Currently, she is in stable condition in home isolation. Investigation of possible epidemiological links with the MERS-CoV cases in the hospital is ongoing. The patient has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 48-year-old male from Riyadh city developed symptoms on 29 August and, on 4 September, was admitted to hospital. The patient, who has comorbidities, tested positive for MERS-CoV on 5 September. Currently, he is in critical condition in ICU. Investigation of history of exposure to the known risk factors in the 14 days prior to the onset of symptoms is ongoing.Contact tracing of household and healthcare contacts is ongoing for these cases. The National IHR Focal Point for the Kingdom of Saudi Arabia also notified WHO of the death of 7 MERS-CoV cases that were reported in previous DONs on 9 September (case no. 7, 15, 22), on 8 September (case no. 1, 6, 8) and on 21 August (case no. 11). Globally, since September 2012, WHO has been notified of 1,564 laboratory-confirmed cases of infection with MERS-CoV, including at least 551 related deaths. WHO adviceBased on the current situation and available information, WHO encourages all Member States to continue their surveillance for acute respiratory infections and to carefully review any unusual patterns. Infection prevention and control measures are critical to prevent the possible spread of MERS-CoV in health care facilities. It is not always possible to identify patients with MERS-CoV early because like other respiratory infections, the early symptoms of MERS-CoV are non-specific. Therefore, health-care workers should always apply standard precautions consistently with all patients, regardless of their diagnosis. Droplet precautions should be added to the standard precautions when providing care to patients with symptoms of acute respiratory infection; contact precautions and eye protection should be added when caring for probable or confirmed cases of MERS-CoV infection; airborne precautions should be applied when performing aerosol generating procedures. Until more is understood about MERS-CoV, people with diabetes, renal failure, chronic lung disease, and immunocompromised persons are considered to be at high risk of severe disease from MERS‐CoV infection. Therefore, these people should avoid close contact with animals, particularly camels, when visiting farms, markets, or barn areas where the virus is known to be potentially circulating. General hygiene measures, such as regular hand washing before and after touching animals and avoiding contact with sick animals, should be adhered to. Food hygiene practices should be observed. People should avoid drinking raw camel milk or camel urine, or eating meat that has not been properly cooked. WHO remains vigilant and is monitoring the situation. Given the lack of evidence of sustained human-to-human transmission in the community, WHO does not recommend travel or trade restrictions with regard to this event. Raising awareness about MERS-CoV among travellers to and from affected countries is good public health practice. Public health authorities in host countries preparing for mass gatherings should ensure that all recommendations and guidance issued by WHO with respect to MERS-CoV have been appropriately taken into consideration and made accessible to all concerned officials. Public health authorities should plan for surge capacity to ensure that visitors during the mass gathering can be accommodated by health systems. http://www.who.int/csr/don/17-september-2015-mers-saudi-arabia/en/
  6. Listen live http://www.renseradio.com/listenlive.htm
  7. Interview at 10 PM EDT tonight Dr. Henry L. Niman, PhDBack To School Flu Season
  8. Middle East Respiratory Syndrome coronavirus (MERS-CoV) – Saudi ArabiaDisease outbreak news 9 September 2015 Between 1 and 5 September 2015, the National IHR Focal Point for the Kingdom of Saudi Arabia notified WHO of 25 additional cases of Middle East respiratory syndrome coronavirus (MERS-CoV) infection. Ten (10) of these reported cases are associated with a MERS-CoV outbreak currently occurring in a hospital in Riyadh city. Details of the casesA 51-year-old, non-national male from Riyadh city developed symptoms on 30 August and, on 2 September, was admitted to hospital. The patient tested positive for MERS-CoV on 5 September. Currently, he is in stable condition in a negative pressure isolation room on a ward. In the 14 days prior to the onset of symptoms, the patient frequently visited the hospital that has been experiencing a MERS-CoV outbreak due to his chronic conditions,. Investigation of possible epidemiological links with MERS-CoV cases in the hospital or with shared health care workers is ongoing. The patient has no history of exposure to other known risk factors in the 14 days prior to onset of symptoms.A 61-year-old male from Riyadh city developed symptoms on 1 September and, on 4 September, was admitted to hospital. The patient, who has comorbidities, tested positive for MERS-CoV on 5 September. Currently, he is in stable condition in a negative pressure isolation room on a ward. Investigation of history of exposure to the known risk factors in the 14 days prior to the onset of symptoms is ongoing.A 45-year-old male from Riyadh city developed symptoms on 29 August and, on 3 September, was admitted to hospital. The patient, who has comorbidities, tested positive for MERS-CoV on 4 September. Currently, he is in critical condition in ICU. The patient has history of frequent contact with camels and consumption of their raw milk. He has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 30-year-old male, non-national health care worker from Riyadh city developed symptoms on 3 September and, on the same day, was admitted to the hospital where he works. This hospital has been experiencing a MERS-CoV outbreak. The patient, who has no comorbidities, tested positive for MERS-CoV on 5 September. Currently, he is in stable condition in a negative pressure isolation room on a ward. Investigation of possible epidemiological links with MERS-CoV cases in the hospital is ongoing. The patient has no history of exposure to other known risk factors in the 14 days prior to onset of symptoms.A 45-year-old male from Alkarj city developed symptoms on 1 September and, on 2 September, was admitted to hospital. The patient, who has no comorbidities, tested positive for MERS-CoV on 3 September. Currently, he is in stable condition in a negative pressure isolation room on a ward. Investigation of history of exposure to the known risk factors in the 14 days prior to the onset of symptoms is ongoing.A 24-year-old female, non-national health care worker from Riyadh city developed symptoms on 1 September and, on the same day, was admitted to the hospital where she works. This hospital has been experiencing a MERS-CoV outbreak. The patient, who has no comorbidities, tested positive for MERS-CoV on 3 September. Currently, she is in stable condition in home isolation. Investigation of possible epidemiological links with MERS-CoV cases in the hospital is ongoing. The patient has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 76-year-old male from Riyadh city developed symptoms on 31 August while admitted to hospital due to chronic conditions since 9 August. This hospital has been experiencing a MERS-CoV outbreak. The patient tested positive for MERS-CoV on 2 September. Currently, he is in critical condition in ICU. Investigation of possible epidemiological links with MERS-CoV cases in the hospital or with shared health care workers is ongoing. The patient has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 60-year-old female from Alnmas city developed symptoms on 31 August and, on 1 September, was admitted to hospital. The patient, who has comorbidities, tested positive for MERS-CoV on 3 September. Currently, she is in stable condition in a negative pressure isolation room on a ward. The patient is a contact of a laboratory-confirmed MERS-CoV case (see DON published on 8 September – case no. 14). She has no history of exposure to other known risk factors in the 14 days prior to onset of symptoms.A 65-year-old male from Alnmas city developed symptoms on 31 August and, on 1 September, was admitted to hospital. The patient, who has comorbidities, tested positive for MERS-CoV on 3 September. Currently, he is in stable condition in a negative pressure isolation room on a ward. The patient is a contact of a laboratory-confirmed MERS-CoV case (see DON published on 8 September – case no. 14). He has no history of exposure to other known risk factors in the 14 days prior to onset of symptoms.A 73-year-old male from Riyadh city developed symptoms on 2 September and, on the same day, was admitted to hospital. The patient, who has comorbidities, tested positive for MERS-CoV on 3 September. Currently, he is in critical condition in ICU. The patient has a history of frequent contact with camels and consumption of their raw milk. He has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 46-year-old male from Najran city developed symptoms on 31 August and, on 1 September, was admitted to hospital. The patient, who has no comorbidities, tested positive for MERS-CoV on 2 September. Currently, he is in stable condition in a negative pressure isolation room on a ward. The patient is a contact of a laboratory-confirmed MERS-CoV case (see DON published on 8 September – case no. 11). He has no history of exposure to other known risk factors in the 14 days prior to onset of symptoms.A 36-year-old female from Al-Kharj city developed symptoms on 24 August and, on 29 August, was admitted to hospital. The patient, who has comorbidities, tested positive for MERS-CoV on 31 August. The current health status of the patient is unknown. Investigation of history of exposure to the known risk factors in the 14 days prior to the onset of symptoms is ongoing.A 29-year-old female, non-national health care worker from Riyadh city developed symptoms on 31 August and, on the same day, was admitted to hospital. This hospital has been experiencing a MERS-CoV outbreak. The patient, who has comorbidities, tested positive for MERS-CoV on 2 September. Currently, she is in stable condition in a negative pressure isolation room on a ward. Investigation of possible epidemiological links with MERS-CoV cases in the hospital is ongoing. The patient has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 44-year-old female, non-national health care worker from Riyadh city developed symptoms on 28 August and, on 30 August, was admitted to the hospital where she works. This hospital has been experiencing a MERS-CoV outbreak. The patient, who has no comorbidities, tested positive for MERS-CoV on 31 August. Currently, she is in stable condition in a negative pressure isolation room on a ward. Investigation of possible epidemiological links with MERS-CoV cases in the hospital is ongoing. The patient has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 16-year-old male from Riyadh city developed symptoms on 28 August while admitted to hospital due to chronic conditions since 21 August. This hospital has been experiencing a MERS-CoV outbreak. The patient tested positive for MERS-CoV on 30 August. Currently, he is in critical condition in ICU. Investigation of possible epidemiological links with the MERS-CoV cases in the hospital or with shared health care workers is ongoing. The patient has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 30-year-old female from Riyadh city developed symptoms 28 August while admitted to hospital due to chronic conditions since 16 August. This hospital has been experiencing a MERS-CoV outbreak. The patient tested positive for MERS-CoV on 30 August. Currently, he is in critical condition in ICU. Investigation of possible epidemiological links with the MERS-CoV cases in the hospital or with shared health care workers is ongoing. The patient has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms.A 27-year-old, non-national, male health care worker from Riyadh city developed symptoms on 31 August and, on the same day, was admitted to the hospital where he works. This hospital has been experiencing a MERS-CoV outbreak. The patient, who has no comorbidities, tested positive for MERS-CoV on 2 September. Currently, he is in stable condition in a negative pressure isolation room on award. Investigation of possible epidemiological links with MERS-CoV cases in the hospital is ongoing.A 53-year-old, non-national, male health care worker from Riyadh city developed symptoms on 28 August and, on 31 August, was admitted to the hospital where he works. The patient, who has no comorbidities, tested positive for MERS-CoV on 2 September. Currently, he is in stable condition in a negative pressure isolation room on a ward. The patient provided care to a laboratory-confirmed MERS-CoV case (see DON published on 21 August – case no. 18). He has no history of exposure to other known risk factors in the 14 days prior to onset of symptoms.A 40-year-old, non-national, male health care worker from Riyadh city developed symptoms on 1 September and, on the same day, was admitted to the hospital where he works. The patient, who has no comorbidities, tested positive for MERS-CoV on 2 September. Currently, he is in stable condition in home isolation. The patient provided care to a laboratory-confirmed MERS-CoV case (see DON published on 8 September – case no. 1). He has no history of exposure to other known risk factors in the 14 days prior to onset of symptoms.A 32-year-old female from Najran city developed symptoms on 30 August and, on 31 August, was admitted to hospital. The patient, who is pregnant and has no comorbidities, tested positive for MERS-CoV on 1 September. Currently, she is in stable condition admitted to a negative pressure isolation room on a ward. The patient is a contact of a laboratory-confirmed MERS-CoV case (see DON published on 8 September – case no. 11). She has no history of exposure to other known risk factors in the 14 days prior to onset of symptoms.A 50-year-old female from Najran city developed symptoms on 29 August and, on 30 August, was admitted to hospital. The patient, who has comorbidities, tested positive for MERS-CoV on 31 August. Currently, she is in stable condition admitted to a negative pressure isolation room on a ward. The patient is a contact of a laboratory-confirmed MERS-CoV case (see DON published on 8 September – case no. 11). She has no history of exposure to other known risk factors in the 14 days prior to onset of symptoms.A 44-year-old, non-national male from Riyadh city developed symptoms on 29 August and, on 30 August, was admitted to hospital. The patient tested positive for MERS-CoV on 31 August. Currently, he is in stable condition admitted to a negative pressure isolation room on a ward. The patient received regular medical care for his chronic conditions at the hospital that has been experiencing a MERS-CoV outbreak. Investigation of possible epidemiological links with MERS-CoV cases in the hospital or with shared health care workers is ongoing. The patient has no history of exposure to other known risk factors in the 14 days priority to the onset of symptoms.A 31-year-old male from Riyadh city developed symptoms on 26 August and, on 31 August, was admitted to hospital. The patient, who has no comorbidities, tested positive for MERS-CoV on 1 September. Currently, he is in critical condition in ICU. Investigation of history of exposure to the known risk factors in the 14 days prior to the onset of symptoms is ongoing.A 51-year-old female from Riyadh city was admitted to hospital on 10 August due to chronic conditions. This hospital has been experiencing a MERS-CoV outbreak. She was discharged on 14 August. The patient developed symptoms on 27 August and, on 30 August, was readmitted to the hospital. She tested positive for MERS-CoV on 31 August. Currently, she is in stable condition in a negative pressure isolation room on a ward. Investigation of possible epidemiological links with the MERS-CoV cases in the hospital or with shared health care workers is ongoing. The patient has no history of exposure to other known risk factors in the 14 days priority to the onset of symptoms.A 47-year-old male from Riyadh city developed symptoms on 24 August and, on 28 August, was admitted to hospital. The patient, tested positive for MERS-CoV on 30 August. Currently, he is in stable condition in a negative pressure isolation room on a ward. In the 14 days prior to the onset of symptoms, the patient visited the hospital that has been experiencing a MERS-CoV outbreak due to chronic conditions. Investigation of possible epidemiological links with the MERS-CoV cases in the hospital or with shared health care workers is ongoing. The patient has no history of exposure to other known risk factors in the 14 days priority to the onset of symptoms.Contact tracing of household and healthcare contacts is ongoing for these cases. The National IHR Focal Point for the Kingdom of Saudi Arabia also notified WHO of the death of 5 MERS-CoV cases that were reported in previous DONs on 8 September (case no. 12, 14, 18) and on 2 September (case no. 1, 11). Globally, since September 2012, WHO has been notified of 1,542 laboratory-confirmed cases of infection with MERS-CoV, including at least 544 related deaths. WHO adviceBased on the current situation and available information, WHO encourages all Member States to continue their surveillance for acute respiratory infections and to carefully review any unusual patterns. Infection prevention and control measures are critical to prevent the possible spread of MERS-CoV in health care facilities. It is not always possible to identify patients with MERS-CoV early because like other respiratory infections, the early symptoms of MERS-CoV are non-specific. Therefore, health-care workers should always apply standard precautions consistently with all patients, regardless of their diagnosis. Droplet precautions should be added to the standard precautions when providing care to patients with symptoms of acute respiratory infection; contact precautions and eye protection should be added when caring for probable or confirmed cases of MERS-CoV infection; airborne precautions should be applied when performing aerosol generating procedures. Until more is understood about MERS-CoV, people with diabetes, renal failure, chronic lung disease, and immunocompromised persons are considered to be at high risk of severe disease from MERS‐CoV infection. Therefore, these people should avoid close contact with animals, particularly camels, when visiting farms, markets, or barn areas where the virus is known to be potentially circulating. General hygiene measures, such as regular hand washing before and after touching animals and avoiding contact with sick animals, should be adhered to. Food hygiene practices should be observed. People should avoid drinking raw camel milk or camel urine, or eating meat that has not been properly cooked. WHO remains vigilant and is monitoring the situation. Given the lack of evidence of sustained human-to-human transmission in the community, WHO does not recommend travel or trade restrictions with regard to this event. Raising awareness about MERS-CoV among travellers to and from affected countries is good public health practice. Public health authorities in host countries preparing for mass gatherings should ensure that all recommendations and guidance issued by WHO with respect to MERS-CoV have been appropriately taken into consideration and made accessible to all concerned officials. Public health authorities should plan for surge capacity to ensure that visitors during the mass gathering can be accommodated by health systems. http://www.who.int/csr/don/09-september-2015-mers-saudi-arabia/en/
  9. http://www.moh.gov.sa/en/CCC/PressReleases/Pages/Statistics-2015-09-11-001.aspx
  10. http://www.moh.gov.sa/en/CCC/PressReleases/Pages/Statistics-2015-09-10-001.aspx
  11. http://www.moh.gov.sa/en/CCC/PressReleases/Pages/Statistics-2015-09-07-001.aspx
  12. KSA MoH cites 3 more Medina cases raising the recent total to 5.
  13. LOCUS KT346356 3266 bp RNA linear VRL 08-SEP-2015 DEFINITION Norovirus Hu/GII.P17_GII.17/PR668/2015/ITA RNA-dependent RNA polymerase (ORF1) gene, partial cds; and major capsid protein (ORF2) and minor capsid protein (ORF3) genes, complete cds. ACCESSION KT346356 VERSION KT346356.1 GI:925717767 KEYWORDS . SOURCE Norovirus Hu/GII.P17_GII.17/PR668/2015/ITA ORGANISM Norovirus Hu/GII.P17_GII.17/PR668/2015/ITA Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; Norovirus. REFERENCE 1 (bases 1 to 3266) AUTHORS Medici,M.C., Tummolo,F. and Martella,V. TITLE Genomic analysis of the emerging GII.17 human norovirus, Italy, 2015 JOURNAL Unpublished REFERENCE 2 (bases 1 to 3266) AUTHORS Medici,M.C., Tummolo,F. and Martella,V. TITLE Direct Submission JOURNAL Submitted (27-JUL-2015) Unit of Microbiology and Virology, Departement of Clinical and Experimental Medicine, University of Parma, Viale A. Gramsci, 14, Parma, Parma 43126, Italy COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3266 /organism="Norovirus Hu/GII.P17_GII.17/PR668/2015/ITA" /mol_type="genomic RNA" /strain="PR668/2015/ITA" /isolation_source="stools" /host="Homo sapiens" /db_xref="taxon:1711929" /country="Italy" /collection_date="2015" /collected_by="Medici MC" /note="genotype: GII.P17_GII.17" gene <1..822 /gene="ORF1" CDS <1..822 /gene="ORF1" /codon_start=1 /product="RNA-dependent RNA polymerase" /protein_id="ALD09617.1" /db_xref="GI:925717768" /translation="HYDADYSRWDSTQQRAVLEAALEIMVRFSAEPQLAQIVAEDLLS PSVVDVGDFKIAINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTGLGPDIIQANSMYS FYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTR DPAGWFGKLDQNSILRQLYWTRGPNHEDPSETMIPHAQRPVQLMALLGESSLHGPSFY SKVSKLVISELKEGGMDFYVPRQESMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE" gene 803..2425 /gene="ORF2" CDS 803..2425 /gene="ORF2" /codon_start=1 /product="major capsid protein" /protein_id="ALD09618.1" /db_xref="GI:925717769" /translation="MKMASNDAAPSNDGAAGLVPEGNNETLPLEPVAGAAIAAPVTGQ NNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLSRMYNGYAGG VEVQVLLAGNAFTAGKILFAAVPPNFPVEFLSPAQITMLPHLIVDVRTLEPIMIPLPD ARNTFFHYSNQPNSRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFTYLVPP SVESKTKPFSLPILTLSELTNSRFPVPIDSLFTAQNNVLQVQCQNGRCTLDGELQGTT QLLPSGICAFRGRVTAQINQRDRWHMQLQNLNGTTYDPTDDVPAPLGTPDFKGVVFGM VSQRNVGNDAPGSTRAQQAWVSTYSPQFVPKLGSVNLRISDNDDFQFQPTKFTPVGVN DDDDGHPFRQWELPNYSGELTLNMNLAPPVAPNFPGEQLLFFRSFVPCSGGYNQGIID CLIPQEWIQHFYQESAPSQSDVALIRYVNPDTGRTLFEAKLHRSGYITVAHSGDYPLV VPANGHFRFDSWVNQFYSLAPMGTGNGRRRAQ" gene 2425..3204 /gene="ORF3" CDS 2425..3204 /gene="ORF3" /codon_start=1 /product="minor capsid protein" /protein_id="ALD09619.1" /db_xref="GI:925717770" /translation="MAGAFIAGLAGDMLTSSVGSLVNAGANAINQKIDFENNKQLQSA SFQHDKEMLQAQVKATKQLQSEMIALKQGVLAAGGFSPTDAARGAIGAPMTKVLDWSG TRYWAPNSTKTTGYSGQFTSSPVHMSSPNASQSKPVKPRSLAPSSSSSSVYSTYTQST HLISGSSSNASSASTKLTNLSSGSSQNRTAEWVNQQRSLSPFMSGALNISHVTPPSSR ASSSGTVSTVPKEVLDSWTSAFNTHRQPLFAHLRVRGESRV" ORIGIN 1 cactatgatg cagactactc ccgctgggac tccacacagc agcgggcagt gctggaagcg 61 gcacttgaaa tcatggtgag attttctgct gagccacagc tggcacaaat agtggcagag 121 gacctgctgt caccaagtgt ggttgatgtg ggcgatttca aaatcgctat caatgaaggc 181 ctaccatctg gcgtgccttg cacctcacaa tggaattcta ttgcccactg gttacttacc 241 ttgtgtgccc tttctgaagt gacaggatta ggtcctgaca tcatacaagc taactccatg 301 tactctttct atggtgatga tgagattgtg agcacagaca taaaattgga cccagagaaa 361 ttgaccgcaa agctcaaaga atatggcctt aaacccactc ggcccgacaa aactgagggg 421 ccgttggtga ttagtgaaga cctgaatggg ttgactttcc tccgccgaac agtcacccgt 481 gatccagcag gttggtttgg aaagttggac caaaactcca tcctcaggca gttgtactgg 541 acaagaggac ccaaccatga agaccccagt gagaccatga taccacacgc acaaagacct 601 gtgcagctca tggcactact aggagaatcc tccctacatg gaccctcatt ttacagcaag 661 gttagcaaat tagtcatatc tgaacttaaa gagggaggaa tggattttta tgtgcccaga 721 caagagtcaa tgttcagatg gatgaggttc tcagatctaa gcacatggga gggcgatcgc 781 aatctggctc ccagttttgt gaatgaagat ggcgtcgaat gacgccgctc catctaatga 841 tggtgctgct ggtctcgtac cagagggcaa caacgagacc cttcccctag aaccagttgc 901 gggcgcagct atagccgcac ccgtcactgg ccaaaataac ataattgacc cctggattag 961 aacaaatttt gtgcaagcac caaatggaga gttcacagtg tcacccagaa actctcctgg 1021 agaaatttta ttaaacttag agttgggccc tgatttgaac ccttatttgg ctcatttgtc 1081 aaggatgtac aatgggtatg ctggtggagt ggaagttcag gttctcctgg cagggaacgc 1141 gttcactgcc ggaaagatcc tcttcgccgc cgtcccgcca aatttcccag tggaattctt 1201 aagcccagcc cagatcacaa tgctccctca tttaatagta gatgttagga ctcttgaacc 1261 aattatgatc ccactccctg atgctaggaa tacattcttc cattatagta accagcctaa 1321 cagccgcatg agattagtgg ctatgctcta caccccactc agatctaatg gctcaggtga 1381 tgatgtcttt actgtctctt gcagggtttt gactaggcct actcctgatt ttgagttcac 1441 ttatttagtg ccaccttctg ttgaatctaa aactaagcct ttttctttac ctattttaac 1501 cctttctgag ctcacaaatt cgaggttccc agtccccatc gattcgcttt tcaccgccca 1561 gaataatgtg ttgcaggtgc agtgtcaaaa tggcaggtgt acacttgatg gtgagttaca 1621 aggcacaacc cagttgctcc catctggcat ctgtgcattc agaggacggg tgacagcaca 1681 aattaaccaa cgtgacaggt ggcacatgca actgcaaaac ctcaatggta caacatatga 1741 cccaactgat gatgtgccag ccccgctggg tacacctgac ttcaagggcg tcgtgtttgg 1801 gatggtaagc caaagaaatg tgggtaatga tgcgcctggc tcaaccagag cccaacaggc 1861 gtgggtttca acctatagcc cccaatttgt ccccaaatta ggttctgtca atcttagaat 1921 tagtgataat gatgatttcc aattccagcc gacaaaattc acaccagtgg gcgtcaatga 1981 tgacgatgat ggccacccgt tcagacaatg ggaattacca aactattcag gggagcttac 2041 cttgaatatg aatcttgccc ccccagttgc tccaaatttt cctggtgaac aattgttatt 2101 cttcagatct ttcgtgccat gctcaggagg ttacaaccaa ggtattatag attgtcttat 2161 tccccaagaa tggatccaac acttctatca ggaatcagca ccctcccagt cagacgtggc 2221 cctaatcagg tatgtcaacc ctgatacggg acgtacactg tttgaagcaa aattgcacag 2281 atctggttac attactgtgg ctcactctgg agactatcct cttgttgttc cggctaatgg 2341 acactttaga tttgattctt gggtaaatca gttttactca ctcgccccaa tgggaactgg 2401 gaatgggcga aggagggctc agtaatggct ggggctttca ttgcaggatt ggcaggcgac 2461 atgctcacgt catctgtggg ctcccttgtg aacgcagggg caaacgccat caaccaaaag 2521 atagactttg aaaacaacaa acaactccag tctgcttcct ttcagcatga taaagagatg 2581 ctccaagcgc aggtgaaggc aaccaagcag ctgcaatctg aaatgatagc cctaaaacag 2641 ggggttttgg ccgcaggcgg cttttccccc actgatgcag caaggggagc cattggtgca 2701 cccatgacaa aggtgcttga ctggtctggc actcgatact gggcgcccaa ctccacaaag 2761 acaactggtt attcgggaca attcacctct tcacctgtgc acatgtctag cccaaatgct 2821 tcacaatcaa aacctgtaaa gcctaggtct ctagcccctt cctcttcttc tagcagtgtc 2881 tatagtacgt acactcaatc tactcattta atatctggct cttctagtaa tgcttcttct 2941 gcctctacaa aattgacaaa tttaagctct ggctcctctc aaaacagaac agcagagtgg 3001 gtaaatcaac agagaagtct tagccctttc atgagtggcg cacttaacat ctcacatgtc 3061 acgccaccct caagtagggc ttccagttct gggacggtct cgaccgtgcc caaggaagtt 3121 ttggactcct ggacgtctgc gtttaacaca cacagacaac cgctcttcgc acacctcaga 3181 gtgagggggg agtcacgtgt ttagtgaaaa gaaataattg gctataatgt gatttctttc 3241 taaaatttgg ctaatttgag tctttt
  14. AlignSegment-IDNameScoreE-ValueIdentityEPI567299A/chicken/Nigeria/15VIR339-2/2015 (A/H5N1) segment 7 (MP)1797.90.000000e+00979/982 (99%)EPI603548A/Falcon/Dubai/AR3430-2293/2014 (A/H5N1) segment 7 (MP)1786.80.000000e+00977/982 (99%)EPI621179A/chicken/Jiangsu/2477/2014 (A/H5N1) segment 7 (MP)1781.30.000000e+00976/982 (99%)EPI500772A/Alberta/01/2014 (A/H5N1) segment 7 (MP)1781.30.000000e+00976/982 (99%)EPI623558A/Duck/Dubai/2459/2014 (A/H5N1) segment 7 (MP)1775.80.000000e+00975/982 (99%)EPI623550A/Hoabara/Dubai/2455.5/2014 (A/H5N1) segment 7 (MP)1775.80.000000e+00975/982 (99%)EPI623566A/Falcon/Dubai/2506/2014 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI603572A/Quail/Dubai/AR3445-25043/2014 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI603564A/Stone curlew/Dubai/AR3444-25042/2014 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI603556A/Sea Gull/Dubai/AR3443-25041/2014 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI461539A/muscovy duck/Vietnam/LBM344/2013 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI461025A/duck/Vietnam/QB1207/2012 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI425926A/duck/Vietnam/NCVD-1544/2012 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI425918A/duck/Vietnam/NCVD-1547/2012 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI425683A/duck/Vietnam/NCVD-1602/2012 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI425675A/duck/Vietnam/NCVD-1593/2012 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI425635A/duck/Vietnam/NCVD-1931/2012 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI425179A/duck/Vietnam/NCVD-1944/2012 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI425171A/chicken/Vietnam/NCVD-1942/2012 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI425147A/duck/Vietnam/NCVD-1935/2012 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI425139A/duck/Vietnam/NCVD-1933/2012 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI425107A/duck/Vietnam/NCVD-1943/2012 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI424987A/duck/Vietnam/NCVD-1607/2012 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI424979A/duck/Vietnam/NCVD-1584/2012 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI424731A/chicken/Vietnam/NCVD-1927/2012 (A/H5N1) segment 7 (MP)1770.20.000000e+00974/982 (99%)EPI631922A/rook/Dovolnoe/50/2015 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI631914A/rook/Chany/32/2015 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI589596A/muscovy duck/Quang Ninh/7c121/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI559174A/chicken/Vietnam/NCVD-KA432/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI559171A/duck/Vietnam/NCVD-KA311/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI559168A/duck/Vietnam/NCVD-KA262/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI559165A/duck/Vietnam/NCVD-KA250/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI545542A/duck/Khanhhoa/CVVI-23/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI545541A/duck/Khanhhoa/CVVI-22/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI545536A/duck/Khanhhoa/CVVI-17/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI545532A/chicken/Khanhhoa/CVVI-13/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI545527A/duck/Khanhhoa/CVVI-08/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI545525A/duck/Khanhhoa/CVVI-06/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI545524A/duck/Khanhhoa/CVVI-05/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI545523A/duck/Khanhhoa/CVVI-04/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI545522A/duck/Khanhhoa/CVVI-03/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI545521A/chicken/Khanhhoa/CVVI-02/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI545520A/duck/Khanhhoa/CVVI-01/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI471176A/muscovy duck/Vietnam/LBM436/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI471134A/muscovy duck/Vietnam/LBM438/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI459250A/muscovy duck/Quanh Ninh/9/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI459242A/muscovy duck/Quanh Ninh/6/2013 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI438234A/large billed crow/Hong Kong/497/2011 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI425651A/duck/Vietnam/NCVD-1968/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI425643A/duck/Vietnam/NCVD-1936/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI425627A/duck/Vietnam/NCVD-1928/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI425619A/duck/Vietnam/NCVD-1930/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI425307A/duck/Vietnam/NCVD-1904/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI425267A/duck/Vietnam/NCVD-1901/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI425155A/duck/Vietnam/NCVD-1937/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI425011A/duck/Vietnam/NCVD-1878/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI424739A/duck/Vietnam/NCVD-1932/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI424723A/duck/Vietnam/NCVD-1898/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI424699A/duck/Vietnam/NCVD-1869/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI424683A/duck/Vietnam/NCVD-1974/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI424191A/muscovy duck/Vietnam/LBM229/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI424183A/muscovy duck/Vietnam/LBM228/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI424175A/muscovy duck/Vietnam/LBM227/2012 (A/H5N1) segment 7 (MP)1764.70.000000e+00973/982 (99%)EPI631930A/rook/Sartlan/42/2015 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI589812A/duck/Quang Ninh/15c111/2013 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI567014A/duck/Quang Ninh/13c1-2-1/2013 (A/H5N2) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI567006A/duck/Vietnam/LBM360c1-4-1/2013 (A/H5N6) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI559175A/chicken/Vietnam/NCVD-KA435/2013 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI545551A/duck/Khanhhoa/CVVI-32/2014 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI545540A/duck/Khanhhoa/CVVI-21/2013 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI545539A/duck/Khanhhoa/CVVI-20/2013 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI545538A/duck/Khanhhoa/CVVI-19/2013 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI545534A/duck/Khanhhoa/CVVI-15/2013 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI545533A/duck/Khanhhoa/CVVI-14/2013 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI515018A/duck/Hunan/749/2011 (A/H0) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI503719A/Japanese white-eye/Taoyuan/Q454/2012 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI489680A/tiger/Jiangsu/01/2013 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI460951A/muscovy duck/Vietnam/LBM399/2013 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI460943A/muscovy duck/Vietnam/LBM398/2013 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI460733A/muscovy duck/Vietnam/LBM335/2013 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI459867A/muscovy duck/Vietnam/LBM330/2013 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI425667A/duck/Vietnam/NCVD-1905/2012 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI425299A/duck/Vietnam/NCVD-1902/2012 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI425131A/duck/Vietnam/NCVD-1899/2012 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI425123A/duck/Vietnam/NCVD-1872/2012 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI425019A/duck/Vietnam/NCVD-1884/2012 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI424715A/duck/Vietnam/NCVD-1897/2012 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI424707A/duck/Vietnam/NCVD-1896/2012 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI424199A/muscovy duck/Vietnam/LBM230/2012 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI337023A/duck/Zhejiang/2248/2011 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI337021A/duck/Zhejiang/2244/2011 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI337020A/duck/Zhejiang/2243/2011 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI337019A/duck/Zhejiang/2242/2011 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI337018A/duck/Zhejiang/224/2011 (A/H5N1) segment 7 (MP)1759.10.000000e+00972/982 (98%)EPI622554A/duck/Vietnam/NCVD-672/2011 (A/H5N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)EPI545555A/duck/Khanhhoa/CVVI-36/2014 (A/H5N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)EPI545531A/chicken/Khanhhoa/CVVI-12/2013 (A/H5N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)EPI545530A/chicken/Khanhhoa/CVVI-11/2013 (A/H5N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)EPI545529A/duck/Khanhhoa/CVVI-10/2013 (A/H5N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)EPI545528A/chicken/Khanhhoa/CVVI-09/2013 (A/H5N1) segment 7 (MP)1753.60.000000e+00971/982 (98%)
  15. AlignSegment-IDNameScoreE-ValueIdentityEPI567305A/chicken/Nigeria/15VIR339-2/2015 (A/H5N1) segment 6 (NA)2466.40.000000e+001345/1350 (99%)EPI623570A/Falcon/Dubai/2506/2014 (A/H5N1) segment 6 (NA)2422.10.000000e+001337/1350 (99%)EPI623562A/Duck/Dubai/2459/2014 (A/H5N1) segment 6 (NA)2422.10.000000e+001337/1350 (99%)EPI603576A/Quail/Dubai/AR3445-25043/2014 (A/H5N1) segment 6 (NA)2422.10.000000e+001337/1350 (99%)EPI603568A/Stone curlew/Dubai/AR3444-25042/2014 (A/H5N1) segment 6 (NA)2422.10.000000e+001337/1350 (99%)EPI603560A/Sea Gull/Dubai/AR3443-25041/2014 (A/H5N1) segment 6 (NA)2422.10.000000e+001337/1350 (99%)EPI603552A/Falcon/Dubai/AR3430-2293/2014 (A/H5N1) segment 6 (NA)2422.10.000000e+001337/1350 (99%)EPI623554A/Hoabara/Dubai/2455.5/2014 (A/H5N1) segment 6 (NA)2416.50.000000e+001336/1350 (98%)EPI621174A/chicken/Jiangsu/2477/2014 (A/H5N1) segment 6 (NA)2411.00.000000e+001335/1350 (98%)EPI500773A/Alberta/01/2014 (A/H5N1) segment 6 (NA)2396.20.000000e+001332/1350 (98%)EPI631929A/rook/Sartlan/42/2015 (A/H5N1) segment 6 (NA)2388.80.000000e+001331/1350 (98%)EPI631921A/rook/Dovolnoe/50/2015 (A/H5N1) segment 6 (NA)2388.80.000000e+001331/1350 (98%)EPI631913A/rook/Chany/32/2015 (A/H5N1) segment 6 (NA)2383.30.000000e+001330/1350 (98%)EPI559149A/muscovy duck/Vietnam/NCVD-KA395/2012 (A/H5N1) segment 6 (NA)2355.60.000000e+001325/1350 (98%)EPI425930A/duck/Vietnam/NCVD-1544/2012 (A/H5N1) segment 6 (NA)2355.60.000000e+001325/1350 (98%)EPI425687A/duck/Vietnam/NCVD-1602/2012 (A/H5N1) segment 6 (NA)2355.60.000000e+001325/1350 (98%)EPI425655A/duck/Vietnam/NCVD-1968/2012 (A/H5N1) segment 6 (NA)2355.60.000000e+001325/1350 (98%)EPI425631A/duck/Vietnam/NCVD-1928/2012 (A/H5N1) segment 6 (NA)2355.60.000000e+001325/1350 (98%)EPI425623A/duck/Vietnam/NCVD-1930/2012 (A/H5N1) segment 6 (NA)2355.60.000000e+001325/1350 (98%)EPI425159A/duck/Vietnam/NCVD-1937/2012 (A/H5N1) segment 6 (NA)2355.60.000000e+001325/1350 (98%)EPI424983A/duck/Vietnam/NCVD-1584/2012 (A/H5N1) segment 6 (NA)2355.60.000000e+001325/1350 (98%)EPI417809A/duck/Vietnam/OIE-2212/2012 (A/H5N1) segment 6 (NA)2355.60.000000e+001325/1350 (98%)EPI417798A/duck/Vietnam/OIE-2236/2012 (A/H5N1) segment 6 (NA)2355.60.000000e+001325/1350 (98%)EPI417780A/duck/Vietnam/OIE-2211/2012 (A/H5N1) segment 6 (NA)2355.60.000000e+001325/1350 (98%)EPI408417A/duck/Vietnam/OIE-2202/2012 (A/H5N1) segment 6 (NA)2355.60.000000e+001325/1350 (98%)EPI531374A/hill myna/Heilongjiang/0704/2012 (A/H5N1) segment 6 (NA)2350.10.000000e+001324/1350 (98%)EPI503722A/Japanese white-eye/Taoyuan/Q454/2012 (A/H5N1) segment 6 (NA)2350.10.000000e+001324/1350 (98%)EPI461024A/duck/Vietnam/QB1207/2012 (A/H5N1) segment 6 (NA)2350.10.000000e+001324/1350 (98%)EPI460950A/muscovy duck/Vietnam/LBM399/2013 (A/H5N1) segment 6 (NA)2350.10.000000e+001324/1350 (98%)EPI460942A/muscovy duck/Vietnam/LBM398/2013 (A/H5N1) segment 6 (NA)2350.10.000000e+001324/1350 (98%)EPI425922A/duck/Vietnam/NCVD-1547/2012 (A/H5N1) segment 6 (NA)2350.10.000000e+001324/1350 (98%)EPI425311A/duck/Vietnam/NCVD-1904/2012 (A/H5N1) segment 6 (NA)2350.10.000000e+001324/1350 (98%)EPI424991A/duck/Vietnam/NCVD-1607/2012 (A/H5N1) segment 6 (NA)2350.10.000000e+001324/1350 (98%)EPI424743A/duck/Vietnam/NCVD-1932/2012 (A/H5N1) segment 6 (NA)2350.10.000000e+001324/1350 (98%)EPI424735A/chicken/Vietnam/NCVD-1927/2012 (A/H5N1) segment 6 (NA)2346.40.000000e+001323/1350 (98%)EPI425679A/duck/Vietnam/NCVD-1593/2012 (A/H5N1) segment 6 (NA)2344.50.000000e+001323/1350 (98%)EPI425639A/duck/Vietnam/NCVD-1931/2012 (A/H5N1) segment 6 (NA)2344.50.000000e+001323/1350 (98%)EPI425143A/duck/Vietnam/NCVD-1933/2012 (A/H5N1) segment 6 (NA)2344.50.000000e+001323/1350 (98%)EPI424687A/duck/Vietnam/NCVD-1974/2012 (A/H5N1) segment 6 (NA)2344.50.000000e+001323/1350 (98%)EPI424198A/muscovy duck/Vietnam/LBM230/2012 (A/H5N1) segment 6 (NA)2344.50.000000e+001323/1350 (98%)EPI424190A/muscovy duck/Vietnam/LBM229/2012 (A/H5N1) segment 6 (NA)2344.50.000000e+001323/1350 (98%)EPI424182A/muscovy duck/Vietnam/LBM228/2012 (A/H5N1) segment 6 (NA)2344.50.000000e+001323/1350 (98%)EPI424174A/muscovy duck/Vietnam/LBM227/2012 (A/H5N1) segment 6 (NA)2344.50.000000e+001323/1350 (98%)EPI545514A/chicken/Khanhhoa/CVVI-42/2014 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI545512A/chicken/Khanhhoa/CVVI-40/2014 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI545511A/chicken/Khanhhoa/CVVI-39/2014 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI462794A/mynah/Austria-quarantine/13064792-010/13 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI461538A/muscovy duck/Vietnam/LBM344/2013 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI425938A/duck/Vietnam/NCVD-1875/2012 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI425671A/duck/Vietnam/NCVD-1905/2012 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI425647A/duck/Vietnam/NCVD-1936/2012 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI425303A/duck/Vietnam/NCVD-1902/2012 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI425271A/duck/Vietnam/NCVD-1901/2012 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI425135A/duck/Vietnam/NCVD-1899/2012 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI425111A/duck/Vietnam/NCVD-1943/2012 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI425023A/duck/Vietnam/NCVD-1884/2012 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI425015A/duck/Vietnam/NCVD-1878/2012 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI424719A/duck/Vietnam/NCVD-1897/2012 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI424711A/duck/Vietnam/NCVD-1896/2012 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI424703A/duck/Vietnam/NCVD-1869/2012 (A/H5N1) segment 6 (NA)2339.00.000000e+001322/1350 (97%)EPI559153A/chicken/Vietnam/NCVD-KA432/2013 (A/H5N1) segment 6 (NA)2333.40.000000e+001321/1350 (97%)EPI545517A/duck/Khanhhoa/CVVI-45/2014 (A/H5N1) segment 6 (NA)2333.40.000000e+001321/1350 (97%)EPI545516A/chicken/Khanhhoa/CVVI-44/2014 (A/H5N1) segment 6 (NA)2333.40.000000e+001321/1350 (97%)EPI545513A/chicken/Khanhhoa/CVVI-41/2014 (A/H5N1) segment 6 (NA)2333.40.000000e+001321/1350 (97%)EPI545506A/duck/Khanhhoa/CVVI-34/2014 (A/H5N1) segment 6 (NA)2333.40.000000e+001321/1350 (97%)EPI545501A/duck/Khanhhoa/CVVI-29/2014 (A/H5N1) segment 6 (NA)2333.40.000000e+001321/1350 (97%)EPI545498A/duck/Khanhhoa/CVVI-26/2014 (A/H5N1) segment 6 (NA)2333.40.000000e+001321/1350 (97%)EPI489679A/tiger/Jiangsu/01/2013 (A/H5N1) segment 6 (NA)2333.40.000000e+001321/1350 (97%)EPI462790A/mynah/Austria-quarantine/13063485-025/13 (A/H5N1) segment 6 (NA)2333.40.000000e+001321/1350 (97%)EPI425175A/chicken/Vietnam/NCVD-1942/2012 (A/H5N1) segment 6 (NA)2333.40.000000e+001321/1350 (97%)EPI424727A/duck/Vietnam/NCVD-1898/2012 (A/H5N1) segment 6 (NA)2333.40.000000e+001321/1350 (97%)EPI462792A/mynah/Austria-quarantine/13063485-026/13 (A/H5N1) segment 6 (NA)2329.70.000000e+001320/1350 (97%)EPI567039A/muscovy duck/Quang Ninh/48c1-4-1/2013 (A/H5N1) segment 6 (NA)2327.90.000000e+001320/1350 (97%)EPI545515A/chicken/Khanhhoa/CVVI-43/2014 (A/H5N1) segment 6 (NA)2327.90.000000e+001320/1350 (97%)EPI545509A/duck/Khanhhoa/CVVI-37/2014 (A/H5N1) segment 6 (NA)2327.90.000000e+001320/1350 (97%)EPI545507A/duck/Khanhhoa/CVVI-35/2014 (A/H5N1) segment 6 (NA)2327.90.000000e+001320/1350 (97%)EPI461490A/duck/Quanh Ninh/53/2013 (A/H5N1) segment 6 (NA)2327.90.000000e+001320/1350 (97%)EPI460934A/muscovy duck/Quanh Ninh/49/2013 (A/H5N1) segment 6 (NA)2327.90.000000e+001320/1350 (97%)EPI438152A/muscovy duck/Vietnam/LBM295/2012 (A/H5N1) segment 6 (NA)2327.90.000000e+001320/1350 (97%)EPI438144A/muscovy duck/Vietnam/LBM315/2012 (A/H5N1) segment 6 (NA)2327.90.000000e+001320/1350 (97%)EPI425183A/duck/Vietnam/NCVD-1944/2012 (A/H5N1) segment 6 (NA)2327.90.000000e+001320/1350 (97%)EPI589837A/duck/Quang Ninh/15c111/2013 (A/H5N1) segment 6 (NA)2322.40.000000e+001319/1350 (97%)EPI589831A/muscovy duck/Quang Ninh/7c121/2013 (A/H5N1) segment 6 (NA)2322.40.000000e+001319/1350 (97%)EPI545502A/duck/Khanhhoa/CVVI-30/2014 (A/H5N1) segment 6 (NA)2322.40.000000e+001319/1350 (97%)EPI545495A/duck/Khanhhoa/CVVI-23/2013 (A/H5N1) segment 6 (NA)2322.40.000000e+001319/1350 (97%)EPI471175A/muscovy duck/Vietnam/LBM436/2013 (A/H5N1) segment 6 (NA)2322.40.000000e+001319/1350 (97%)EPI471133A/muscovy duck/Vietnam/LBM438/2013 (A/H5N1) segment 6 (NA)2322.40.000000e+001319/1350 (97%)EPI459249A/muscovy duck/Quanh Ninh/9/2013 (A/H5N1) segment 6 (NA)2322.40.000000e+001319/1350 (97%)EPI459241A/muscovy duck/Quanh Ninh/6/2013 (A/H5N1) segment 6 (NA)2322.40.000000e+001319/1350 (97%)EPI425151A/duck/Vietnam/NCVD-1935/2012 (A/H5N1) segment 6 (NA)2322.40.000000e+001319/1350 (97%)EPI425127A/duck/Vietnam/NCVD-1872/2012 (A/H5N1) segment 6 (NA)2322.40.000000e+001319/1350 (97%)EPI559141A/duck/Vietnam/NCVD-KA300/2012 (A/H5N1) segment 6 (NA)2316.80.000000e+001302/1326 (98%)EPI545510A/duck/Khanhhoa/CVVI-38/2014 (A/H5N1) segment 6 (NA)2316.80.000000e+001318/1350 (97%)EPI545503A/chicken/Khanhhoa/CVVI-31/2014 (A/H5N1) segment 6 (NA)2316.80.000000e+001318/1350 (97%)EPI545493A/duck/Khanhhoa/CVVI-21/2013 (A/H5N1) segment 6 (NA)2316.80.000000e+001318/1350 (97%)EPI545492A/duck/Khanhhoa/CVVI-20/2013 (A/H5N1) segment 6 (NA)2316.80.000000e+001318/1350 (97%)EPI545475A/duck/Khanhhoa/CVVI-03/2013 (A/H5N1) segment 6 (NA)2316.80.000000e+001318/1350 (97%)EPI515016A/duck/Hunan/749/2011 (A/H0) segment 6 (NA)2316.80.000000e+001318/1350 (97%)EPI515006A/duck/Hunan/747/2011 (A/H0) segment 6 (NA)2316.80.000000e+001318/1350 (97%)EPI545519A/duck/Phuyen/CVVI-47/2014 (A/H5N1) segment 6 (NA)2311.30.000000e+001317/1350 (97%)
  16. AlignSegment-IDNameScoreE-ValueIdentityEPI632942A/chicken/Ghana/15VIR2588-9/2015 (A/H5N1) segment 4 (HA)3081.30.000000e+001692/1704 (99%)EPI603577A/Quail/Dubai/AR3445-25043/2014 (A/H5N1) segment 4 (HA)3059.20.000000e+001689/1705 (99%)EPI603569A/Stone curlew/Dubai/AR3444-25042/2014 (A/H5N1) segment 4 (HA)3059.20.000000e+001689/1705 (99%)EPI603561A/Sea Gull/Dubai/AR3443-25041/2014 (A/H5N1) segment 4 (HA)3059.20.000000e+001689/1705 (99%)EPI603553A/Falcon/Dubai/AR3430-2293/2014 (A/H5N1) segment 4 (HA)3053.60.000000e+001688/1705 (99%)EPI632943A/duck/Ivory Coast/15VIR-2742-1/2015 (A/H5N1) segment 4 (HA)3051.80.000000e+001678/1691 (99%)EPI621173A/chicken/Jiangsu/2477/2014 (A/H5N1) segment 4 (HA)3048.10.000000e+001686/1704 (98%)EPI584232A/chicken/Burkina Faso/15VIR1774-35/2015 (A/H5N1) segment 4 (HA)3042.60.000000e+001675/1690 (99%)EPI500771A/Alberta/01/2014 (A/H5N1) segment 4 (HA)3042.60.000000e+001685/1704 (98%)EPI594560A/pelican/Romania/12449/2015 (A/H5N1) segment 4 (HA)3037.00.000000e+001686/1706 (98%)EPI592605A/dalmatian pelican/Bulgaria/4/2015 (A/H5N1) segment 4 (HA)3025.90.000000e+001684/1706 (98%)EPI592416A/dalmatian pelican/Bulgaria/3/2015 (A/H5N1) segment 4 (HA)3025.90.000000e+001684/1706 (98%)EPI594492A/chicken/Bulgaria/5409/15 (A/H5N1) segment 4 (HA)3022.20.000000e+001682/1704 (98%)EPI594491A/chicken/Bulgaria/5408/15 (A/H5N1) segment 4 (HA)3022.20.000000e+001682/1704 (98%)EPI594490A/chicken/Bulgaria/5407/15 (A/H5N1) segment 4 (HA)3022.20.000000e+001682/1704 (98%)EPI631928A/rook/Sartlan/42/2015 (A/H5N1) segment 4 (HA)3014.90.000000e+001681/1705 (98%)EPI631920A/rook/Dovolnoe/50/2015 (A/H5N1) segment 4 (HA)3014.90.000000e+001681/1705 (98%)EPI631912A/rook/Chany/32/2015 (A/H5N1) segment 4 (HA)3014.90.000000e+001681/1705 (98%)EPI641671A/chicken/Niger/15VIR2060-6/2015 (A/H5N1) segment 4 (HA)3013.00.000000e+001670/1690 (98%)EPI489677A/tiger/Jiangsu/01/2013 (A/H5N1) segment 4 (HA)3009.30.000000e+001679/1704 (98%)EPI461022A/duck/Vietnam/QB1207/2012 (A/H5N1) segment 4 (HA)3003.80.000000e+001678/1704 (98%)EPI425680A/duck/Vietnam/NCVD-1593/2012 (A/H5N1) segment 4 (HA)3003.80.000000e+001678/1704 (98%)EPI425624A/duck/Vietnam/NCVD-1930/2012 (A/H5N1) segment 4 (HA)3003.80.000000e+001678/1704 (98%)EPI425160A/duck/Vietnam/NCVD-1937/2012 (A/H5N1) segment 4 (HA)3003.80.000000e+001679/1705 (98%)EPI425176A/chicken/Vietnam/NCVD-1942/2012 (A/H5N1) segment 4 (HA)3000.10.000000e+001676/1702 (98%)EPI559089A/duck/Vietnam/NCVD-KA324/2012 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI559087A/duck/Vietnam/NCVD-KA311/2012 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI559084A/duck/Vietnam/NCVD-KA300/2012 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI545446A/duck/Khanhhoa/CVVI-21/2013 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI545429A/duck/Khanhhoa/CVVI-04/2013 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI545426A/duck/Khanhhoa/CVVI-01/2013 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI425923A/duck/Vietnam/NCVD-1547/2012 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI425312A/duck/Vietnam/NCVD-1904/2012 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI425304A/duck/Vietnam/NCVD-1902/2012 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI425272A/duck/Vietnam/NCVD-1901/2012 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI425152A/duck/Vietnam/NCVD-1935/2012 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI425136A/duck/Vietnam/NCVD-1899/2012 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI425128A/duck/Vietnam/NCVD-1872/2012 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI425112A/duck/Vietnam/NCVD-1943/2012 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI424992A/duck/Vietnam/NCVD-1607/2012 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI424720A/duck/Vietnam/NCVD-1897/2012 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI424712A/duck/Vietnam/NCVD-1896/2012 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI424704A/duck/Vietnam/NCVD-1869/2012 (A/H5N1) segment 4 (HA)2998.20.000000e+001677/1704 (98%)EPI425640A/duck/Vietnam/NCVD-1931/2012 (A/H5N1) segment 4 (HA)2994.50.000000e+001676/1704 (98%)EPI621165A/chicken/Jiangsu/927/2013 (A/H5N1) segment 4 (HA)2992.70.000000e+001677/1705 (98%)EPI621163A/chicken/Jiangsu/2540/2014 (A/H0) segment 4 (HA)2992.70.000000e+001677/1705 (98%)EPI559108A/muscovy duck/Vietnam/NCVD-KA395/2012 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI559081A/duck/Vietnam/NCVD-KA262/2012 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI545448A/duck/Khanhhoa/CVVI-23/2013 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI545445A/duck/Khanhhoa/CVVI-20/2013 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI545440A/duck/Khanhhoa/CVVI-15/2013 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI545437A/chicken/Khanhhoa/CVVI-12/2013 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI545435A/duck/Khanhhoa/CVVI-10/2013 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI545430A/duck/Khanhhoa/CVVI-05/2013 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI545427A/chicken/Khanhhoa/CVVI-02/2013 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI425931A/duck/Vietnam/NCVD-1544/2012 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI425688A/duck/Vietnam/NCVD-1602/2012 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI425672A/duck/Vietnam/NCVD-1905/2012 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI425648A/duck/Vietnam/NCVD-1936/2012 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI425632A/duck/Vietnam/NCVD-1928/2012 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI425024A/duck/Vietnam/NCVD-1884/2012 (A/H5N1) segment 4 (HA)2992.70.000000e+001677/1705 (98%)EPI425016A/duck/Vietnam/NCVD-1878/2012 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI424984A/duck/Vietnam/NCVD-1584/2012 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI424728A/duck/Vietnam/NCVD-1898/2012 (A/H5N1) segment 4 (HA)2992.70.000000e+001676/1704 (98%)EPI424736A/chicken/Vietnam/NCVD-1927/2012 (A/H5N1) segment 4 (HA)2989.00.000000e+001675/1704 (98%)EPI567037A/muscovy duck/Quang Ninh/48c1-4-1/2013 (A/H5N1) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI559090A/duck/Vietnam/NCVD-KA345/2012 (A/H5N1) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI559088A/muscovy duck/Vietnam/NCVD-KA286/2012 (A/H5N1) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI559082A/chicken/Vietnam/NCVD-KA275/2012 (A/H5N1) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI545444A/duck/Khanhhoa/CVVI-19/2013 (A/H5N1) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI545439A/duck/Khanhhoa/CVVI-14/2013 (A/H5N1) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI545434A/chicken/Khanhhoa/CVVI-09/2013 (A/H5N1) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI545433A/duck/Khanhhoa/CVVI-08/2013 (A/H5N1) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI545432A/duck/Khanhhoa/CVVI-07/2013 (A/H5N1) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI531373A/hill myna/Heilongjiang/0704/2012 (A/H5N1) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI461488A/duck/Quanh Ninh/53/2013 (A/H5N1) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI425939A/duck/Vietnam/NCVD-1875/2012 (A/H5N1) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI425656A/duck/Vietnam/NCVD-1968/2012 (A/H5N1) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI425144A/duck/Vietnam/NCVD-1933/2012 (A/H5N1) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI424744A/duck/Vietnam/NCVD-1932/2012 (A/H5N1) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI408415A/duck/Vietnam/OIE-2202/2012 (A/H5N1) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI405753A/chicken/Vietnam/OIE-2215/2012 (A/H5N2) segment 4 (HA)2987.20.000000e+001675/1704 (98%)EPI559095A/chicken/Vietnam/NCVD-KA432/2013 (A/H5N1) segment 4 (HA)2981.60.000000e+001674/1704 (98%)EPI545442A/duck/Khanhhoa/CVVI-17/2013 (A/H5N1) segment 4 (HA)2981.60.000000e+001674/1704 (98%)EPI545441A/duck/Khanhhoa/CVVI-16/2013 (A/H5N1) segment 4 (HA)2981.60.000000e+001674/1704 (98%)EPI545428A/duck/Khanhhoa/CVVI-03/2013 (A/H5N1) segment 4 (HA)2981.60.000000e+001674/1704 (98%)EPI503718A/Japanese white-eye/Taoyuan/Q454/2012 (A/H5N1) segment 4 (HA)2981.60.000000e+001675/1705 (98%)EPI460948A/muscovy duck/Vietnam/LBM399/2013 (A/H5N1) segment 4 (HA)2981.60.000000e+001674/1704 (98%)EPI460940A/muscovy duck/Vietnam/LBM398/2013 (A/H5N1) segment 4 (HA)2981.60.000000e+001674/1704 (98%)EPI460932A/muscovy duck/Quanh Ninh/49/2013 (A/H5N1) segment 4 (HA)2981.60.000000e+001674/1704 (98%)EPI417807A/duck/Vietnam/OIE-2212/2012 (A/H5N1) segment 4 (HA)2981.60.000000e+001674/1704 (98%)EPI417778A/duck/Vietnam/OIE-2211/2012 (A/H5N1) segment 4 (HA)2981.60.000000e+001674/1704 (98%)EPI559091A/chicken/Vietnam/NCVD-KA365/2012 (A/H5N1) segment 4 (HA)2976.10.000000e+001673/1704 (98%)EPI545438A/chicken/Khanhhoa/CVVI-13/2013 (A/H5N1) segment 4 (HA)2976.10.000000e+001673/1704 (98%)EPI545431A/duck/Khanhhoa/CVVI-06/2013 (A/H5N1) segment 4 (HA)2976.10.000000e+001673/1704 (98%)EPI471173A/muscovy duck/Vietnam/LBM436/2013 (A/H5N1) segment 4 (HA)2976.10.000000e+001673/1704 (98%)EPI459257A/duck/Quanh Ninh/21/2013 (A/H5N1) segment 4 (HA)2976.10.000000e+001673/1704 (98%)EPI438150A/muscovy duck/Vietnam/LBM295/2012 (A/H5N1) segment 4 (HA)2976.10.000000e+001673/1704 (98%)EPI438142A/muscovy duck/Vietnam/LBM315/2012 (A/H5N1) segment 4 (HA)2976.10.000000e+001673/1704 (98%)EPI425184A/duck/Vietnam/NCVD-1944/2012 (A/H5N1) segment 4 (HA)2976.10.000000e+001673/1704 (98%)
  17. Isolate detailIsolate name: A/chicken/Ghana/FJ152511/2015 Isolate ID: EPI_ISL_195791 Passage details/history: E1 Type: A / H5N1 Lineage: Sample information Collection date: 2015 (Month and day unknown) Host Chicken Additional host information: Domestic status: Is vaccinated: Location: Ghana Additional location information: Health status: Specimen source: Strain or commercial product name used for vaccination: Institute information Originating lab: University of Ghana Sample ID given by the sample provider: Address: University of Ghana Noguchi Memorial Institute for Medical Research Off Noguchi Circle - South Legon Accra Ghana Submitting lab: National Institute for Medical Research Sample ID given by the submitting laboratory: Authors: Address: National Institute for Medical Research The Ridgeway, Mill Hill London, NW7 1AA United Kingdom PublicationPublication In vivo antiviral resistance PhenotypeGenotypeUnspecifiedAntiviral resistance tested by experimental procedures Adamantanes: Unknown Oseltamivir: Unknown Zanamivir: Unknown Peramivir: Unknown Other: Unknown Additional informationAntigenic characterization: Note: Sequence segmentidentifierlengthaccession #INSDCSequence HA A/chicken/Ghana/FJ152511/2015 1704 EPI643194 NA A/chicken/Ghana/FJ152511/2015 1350 EPI643195 MP A/chicken/Ghana/FJ152511/2015 982 EPI643196 Submitter information Submitter: Ermetal, Burcu Submission Date: 2015-09-09 Last modifier: Ermetal, Burcu Last modified: 2015-09-09 Address: National Institute for Medical Research The Ridgeway, Mill Hill London, NW7 1AA United Kingdom
  18. Mill Hill has released 2015 Fujian clade 2.3.2 sequences from a chicken in Ghana.
  19. Norovirus Hu/GII.P17_GII.17/PR668/2015/ITA RNA-dependent RNA polymerase (ORF1) gene, partial cds; and major capsid protein (ORF2) and minor capsid protein (ORF3) genes, complete cds BLAST: Sequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KR083017.1|Norovirus Hu/GII.17/Gaithersburg/2014/US nonstructural polyprotein (ORF1) gene, partial cds; and major capsid protein VP1 (ORF2) and minor capsid protein VP2 (ORF3) genes, complete cds59215921100%0.099%KR083017.1Select seq gb|KP998539.1|Norovirus GII.17 isolate GII/Hu/HKG/2014/GII.17/CUHK-NS-463, complete genome58755875100%0.099%KP998539.1Select seq gb|KR020503.1|Norovirus Hu/GII.17/41621/Guangzhou/2014/CHN polyprotein gene, partial cds; and VP1 and VP2 genes, complete cds58605860100%0.099%KR020503.1Select seq dbj|LC037415.1|Norovirus Hu/GII/JP/2015/GII.P17_GII.17/Kawasaki308 genomic RNA, nearly complete genome58365836100%0.099%LC037415.1Select seq dbj|LC043168.1|Norovirus Hu/GII/JP/2013/GII.P17_GII.17/Saitama5309 genomic RNA, nearly complete genome54895489100%0.097%LC043168.1Select seq dbj|AB983218.1|Norovirus Hu/GII/JP/2014/GII.P17_GII.17/Kawasaki323 genomic RNA, nearly complete genome54895489100%0.097%AB983218.1Select seq dbj|LC043167.1|Norovirus Hu/GII/JP/2013/GII.P17_GII.17/Saitama5203 genomic RNA, nearly complete genome54765476100%0.097%LC043167.1Select seq dbj|LC043139.1|Norovirus Hu/GII/JP/2014/GII.P17_GII.17/Nagano7-1 POL, VP1, VP2 genes for nonstructural polyprotein, capsid protein VP1, capsid protein VP2, complete and partial cds54725472100%0.097%LC043139.1Select seq dbj|LC043305.1|Norovirus Hu/GII/JP/2014/GII.P17_GII.17/Nagano8-1 POL, VP1, VP2 genes for nonstructural polyprotein, capsid protein VP1, capsid protein VP2, complete and partial cds54675467100%0.097%LC043305.1Select seq gb|KJ156329.1|Norovirus 13-BH-1/2013/GII.17 nonstructural protein gene, partial cds; and capsid protein and minor structural protein genes, complete cds5457545799%0.097%KJ156329.1Select seq gb|KP698930.1|Norovirus GII.17 isolate GII/Hu/HKG/2015/GII.17/CUHK-NS-511 viral protein 1 (VP1) gene, complete cds2959295949%0.099%KP698930.1Select seq gb|KP698928.1|Norovirus GII.17 isolate GII/Hu/HKG/2014/GII.17/CUHK-NS-491 viral protein 1 (VP1) gene, complete cds2953295349%0.099%KP698928.1Select seq gb|KP698929.1|Norovirus GII.17 isolate GII/Hu/HKG/2014/GII.17/CUHK-NS-494 viral protein 1 (VP1) gene, complete cds2948294849%0.099%KP698929.1Select seq gb|KP698931.1|Norovirus GII.17 isolate GII/Hu/HKG/2015/GII.17/CUHK-NS-513 viral protein 1 (VP1) gene, complete cds2942294249%0.099%KP698931.1Select seq gb|KR858308.1|Norovirus GII.17 isolate Hu/Norovirus/GII.17/Shunyi-18/Beijing/CHN/2015 caspid protein VP1 gene, partial cds2700270045%0.099%KR858308.1Select seq gb|KP676383.1|Norovirus Hu/GII/CN/2013/GII.P17_GII.17/Nanjing010141 RNA-dependent RNA polymerase and capsid protein genes, partial cds1923192333%0.098%KP676383.1Select seq gb|KC597139.1|Norovirus Hu/GII.17/C142/1978/GUF, partial genome1727172785%0.078%KC597139.1Select seq gb|KJ196286.1|Norovirus GII/Hu/JP/2002/GII.P16_GII.17/Saitama/T87, complete genome1644188392%0.077%KJ196286.1Select seq gb|EU921354.2|Norovirus Hu/Pune/PC25/2006/India strain PC25 RNA-dependent RNA polymerase gene, partial cds; and capsid protein gene, complete cds1548154849%0.084%EU921354.2Select seq gb|EF529741.1|Norovirus Hu/Briancon870/2004/France RNA-dependent RNA polymerase and capsid protein genes, partial cds1548154841%0.087%EF529741.1Select seq gb|DQ438972.1|Norovirus genogroup 2 strain Hu/NoV/Katrina-17/2005/US VP1 and VP2 genes, complete cds1454145473%0.078%DQ438972.1Select seq dbj|AB809975.1|Norovirus Hu/GII.13/09N3120/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds1430143046%0.084%AB809975.1Select seq dbj|AB809976.1|Norovirus Hu/GII.13/09N3145/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial and complete cds1386138645%0.084%AB809976.1Select seq gb|KJ194504.1|Norovirus Hu/GII/Amsterdam/1994 isolate NV_Amsterdam_1994, partial genome1363136347%0.083%KJ194504.1Select seq gb|KJ194500.1|Norovirus Hu/GII/Amsterdam/1/1995 isolate NV_Amsterdam_1_1995, partial genome1363136347%0.083%KJ194500.1Select seq dbj|AB039782.1|Norwalk-like virus genomic RNA, complete genome, isolate:Saitama U2011363136346%0.083%AB039782.1Select seq dbj|AB039781.1|Norwalk-like virus genomic RNA, complete genome, isolate:Saitama U181347134746%0.083%AB039781.1Select seq gb|AF315812.1|AF315812Norwalk virus (Hu/NLV/OC98008/1998/JP) capsid protein and polymerase genes, partial cds1343134337%0.086%AF315812.1Select seq gb|U02030.1|Minireovirus TV24 polymerase gene, partial cds; capsid protein gene, complete cds; and unknown gene1341134147%0.082%U02030.1Select seq gb|L23830.1|NOR89JDNorwalk virus (SRSV-OTH-25/89/J) RNA polymerase mRNA, 3'end and capsid protein mRNA, 5' end1325132549%0.081%L23830.1Select seq dbj|AB809979.1|Norovirus Hu/GII.13/09N3223/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial and complete cds1319131943%0.083%AB809979.1Select seq gb|JQ751044.1|Norovirus Hu/GII.17/Wuhan/Z776/CHN/2007 RNA-dependent RNA polymerase and capsid protein genes, partial cds1303130333%0.088%JQ751044.1Select seq gb|U22498.1|HCU22498Human calicivirus strain MX polymerase gene, partial cds, and capsid protein gene, complete cds1280128047%0.082%U22498.1Select seq gb|EF529742.1|Norovirus Hu/Sommieres1203/2006/France RNA-dependent RNA polymerase and capsid protein genes, partial cds1269126932%0.089%EF529742.1Select seq dbj|AB447409.1|Norovirus Hu/V1668/06/IND RdRp, VP1 genes for RNA dependent RNA polymerase, capsid protein, partial cds1242124231%0.088%AB447409.1Select seq gb|FJ595900.1|Norovirus Hu/GII.4/Seoul/0205/2007/KOR RNA-dependent RNA polymerase and capsid protein genes, partial cds1221122132%0.087%FJ595900.1Select seq gb|JF802507.1|Norovirus Hu/GII.17/C15b/Bonaberi/Cameroon RNA-dependent RNA polymerase and capsid protein genes, partial cds1219121930%0.088%JF802507.1Select seq gb|AY502009.1|Norovirus genogroup 2 strain Hu/NoV/CS-E1/2002/USA nonstructural polyprotein gene, partial cds; capsid protein gene, complete cds; and minor structural protein gene, partial cds1212121260%0.078%AY502009.1Select seq gb|FJ383845.1|Norovirus Hu/GII/2005/8093/Chelyabinsk/RUS RNA-dependent RNA polymerase and capsid genes, partial cds1195119530%0.089%FJ383845.1Select seq gb|FJ383875.1|Norovirus Hu/GII/2005/6336/Moscow/RUS RNA-dependent RNA polymerase and capsid genes, partial cds1146114630%0.088%FJ383875.1Select seq gb|KM036380.1|Norovirus Hu/GII.P16/GII.13/New/Taipei/13-BA-1/2013/TW nonstructural protein gene, partial cds; and major capsid protein and minor structural protein genes, complete cds1138113850%0.079%KM036380.1Select seq gb|KC832473.1|Norovirus Hu/GII/Luckenwalde1378/2012/DE RNA dependend RNA polymerase and capsid protein genes, partial cds1103110349%0.079%KC832473.1Select seq gb|KC832472.1|Norovirus Hu/GII/Berlin1195/2012/DE RNA dependend RNA polymerase and capsid protein genes, partial cds1103110349%0.079%KC832472.1Select seq gb|KC832471.1|Norovirus Hu/GII/Oranienburg1190/2012/DE RNA dependend RNA polymerase and capsid protein genes, partial cds1103110349%0.079%KC832471.1Select seq gb|DQ379713.1|Norovirus Hu/GII/Goulburn Valley G5175 A/1983/AUS nonstructural polyprotein (ORF1) gene, partial cds; and capsid (ORF2) and basic protein (ORF3) genes, complete cds1103110345%0.080%DQ379713.1Select seq gb|KC832470.1|Norovirus Hu/GII/Berlin1162/2012/DE RNA dependend RNA polymerase and capsid protein genes, partial cds1098109849%0.079%KC832470.1Select seq gb|JN176920.1|Norovirus Hu/GII.3/Maastricht021/2006/NL polymerase gene, partial cds1098109825%0.091%JN176920.1Select seq dbj|AB591831.1|Norovirus Hu/GII/IDH883/2008/IND genes for RNA-dependent RNA polymerase, capsid protein, partial cds1092109227%0.089%AB591831.1Select seq gb|EU019230.2|Norovirus Hu/Ahm/PC03/2006/India RNA-dependent RNA polymerase gene, partial cds; and capsid protein gene, complete cds1083108347%0.079%EU019230.2Select seq gb|AF414415.1|AF414415Norwalk-like virus NLV/Brattleboro/321/1995/US RNA polymerase (orf1) gene, partial cds; and capsid protein (orf2) and minor structural protein (orf3) genes, complete cds1070107040%0.081%AF414415.1Select seq gb|AF414411.1|AF414411Norwalk-like virus NLV/Lionville/247/1993/US RNA polymerase (orf1) gene, partial cds; and capsid protein (orf2) and minor structural protein (orf3) genes, complete cds1070107042%0.081%AF414411.1Select seq gb|AF414413.1|AF414413Norwalk-like virus NLV/Montgomery/312/1994/US RNA polymerase (orf1) gene, partial cds; and capsid protein (orf2) and minor structural protein (orf3) genes, complete cds1064106440%0.081%AF414413.1Select seq gb|AF414414.1|AF414414Norwalk-like virus NLV/Towson/313/1994/US RNA polymerase (orf1) gene, partial cds; and capsid protein (orf2) and minor structural protein (orf3) genes, complete cds1059105939%0.081%AF414414.1Select seq dbj|AB809973.1|Norovirus Hu/GII.13/08N2045/2008/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial and complete cds1044104446%0.079%AB809973.1Select seq gb|KJ196284.1|Norovirus GII/Hu/JP/2007/GII.P21_GII.21/Kawasaki/YO284, complete genome1044104447%0.079%KJ196284.1Select seq gb|AF414412.1|AF414412Norwalk-like virus NLV/New Orleans/279/1994/US RNA polymerase (orf1) gene, partial cds; and capsid protein (orf2) and minor structural protein (orf3) genes, complete cds1044104430%0.086%AF414412.1Select seq dbj|AB809998.1|Norovirus Hu/GII.13/09N3816/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds1042104246%0.079%AB809998.1Select seq gb|JN899245.1|Norovirus Hu/GII.21/Salisbury150/2011/USA RNA-dependent RNA polymerase gene, partial cds; and major capsid protein and minor capsid protein genes, complete cds1042104249%0.078%JN899245.1Select seq dbj|AB592958.1|Norovirus Hu/GII/IDH1390/2009/IND genes for RNA-dependent RNA polymerase, capsid protein, partial cds1042104226%0.088%AB592958.1Select seq gb|DQ379714.1|Norovirus Hu/GII/Goulburn Valley G5175 B/1983/AUS nonstructural polyprotein (ORF1) gene, partial cds; and capsid (ORF2) and basic protein (ORF3) genes, complete cds1037103750%0.078%DQ379714.1Select seq dbj|AB809974.1|Norovirus Hu/GII.13/08N2250/2008/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial and complete cds1035103545%0.079%AB809974.1Select seq dbj|AB810005.1|Norovirus Hu/GII.13/10N4439/2010/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds1033103346%0.079%AB810005.1Select seq dbj|AB810004.1|Norovirus Hu/GII.13/10N4358/2010/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds1033103346%0.079%AB810004.1Select seq gb|KJ196276.1|Norovirus GII/Hu/JP/2002/GII.P12_GII.13/Saitama/T80, complete genome1033103350%0.078%KJ196276.1Select seq dbj|AB542916.1|Norovirus Hu/OC06060/2006/JP genes for RNA polymerase, capsid protein VP1, partial and complete cds1027102746%0.079%AB542916.1Select seq dbj|AB809993.1|Norovirus Hu/GII.13/09N3751/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds1026102646%0.079%AB809993.1Select seq gb|JF802506.1|Norovirus Hu/GII.17/C38/Bonaberi/2009/Cameroon RNA-dependent RNA polymerase and capsid protein genes, partial cds1026102625%0.089%JF802506.1Select seq gb|JF802505.1|Norovirus Hu/GII.17/A113/Limbe/2009/Cameroon RNA-dependent RNA polymerase and capsid protein genes, partial cds1026102625%0.089%JF802505.1Select seq gb|GQ266697.1|Norovirus Hu/Zuerich/P7d384/2009 capsid protein gene, partial cds1024102448%0.078%GQ266697.1Select seq dbj|AB809997.1|Norovirus Hu/GII.13/09N3798/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds1020102046%0.079%AB809997.1Select seq dbj|AB809990.1|Norovirus Hu/GII.13/09N3688/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds1020102046%0.079%AB809990.1Select seq dbj|AB810001.1|Norovirus Hu/GII.13/10N3922/2010/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds1014101446%0.079%AB810001.1Select seq dbj|AB810006.1|Norovirus Hu/GII.13/10N4441/2010/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds1005100545%0.079%AB810006.1Select seq gb|KC662537.1|Norovirus Hu/GII/Hy-718/KOR, complete genome1005100550%0.078%KC662537.1Select seq dbj|AB809994.1|Norovirus Hu/GII.13/09N3758/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds1003100345%0.079%AB809994.1Select seq dbj|AB809992.1|Norovirus Hu/GII.13/09N3721/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds1003100345%0.079%AB809992.1Select seq dbj|AB809985.1|Norovirus Hu/GII.13/09N3564/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds1003100344%0.079%AB809985.1Select seq dbj|AB810007.1|Norovirus Hu/GII.13/10N4487/2010/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds1000100045%0.079%AB810007.1Select seq dbj|AB809977.1|Norovirus Hu/GII.13/09N3180/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds99899845%0.079%AB809977.1Select seq dbj|AB809978.1|Norovirus Hu/GII.13/09N3206/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial and complete cds99699644%0.079%AB809978.1Select seq gb|GQ856468.1|Norovirus Hu/GII.4/Beijing/55185/2008/CHN RNA-dependent RNA polymerase gene, partial cds; and capsid and minor structural protein genes, complete cds99699646%0.079%GQ856468.1Select seq dbj|AB810014.1|Norovirus Hu/GII.13/10N4598/2010/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds99299245%0.079%AB810014.1Select seq dbj|AB809987.1|Norovirus Hu/GII.13/09N3617/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds98798744%0.079%AB809987.1Select seq dbj|AB809986.1|Norovirus Hu/GII.13/09N3609/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds98798744%0.079%AB809986.1Select seq gb|KC464499.1|Norovirus Hu/GII.12/CGMH41/2010/TW, complete genome98798745%0.079%KC464499.1Select seq gb|KC464497.1|Norovirus Hu/GII.12/CGMH39/2010/TW, complete genome98798745%0.079%KC464497.1Select seq dbj|AB112326.1|Human norovirus Saitama gene for RNA dependent RNA polymerase, capsid protein, partial cds, strain: NV/Saitama T45aGII/01/JP98598525%0.088%AB112326.1Select seq dbj|AB809989.1|Norovirus Hu/GII.13/09N3683/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds98198144%0.079%AB809989.1Select seq gb|JQ613568.1|Norovirus Hu/GII.g-GII.12/Wahroonga/NSW004P/2009/AU, complete genome98198145%0.079%JQ613568.1Select seq gb|HQ664990.1|Norovirus Hu/GII.12/HS206/2010/USA, complete genome98198145%0.079%HQ664990.1Select seq dbj|AB809996.1|Norovirus Hu/GII.13/09N3796/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds97797744%0.079%AB809996.1Select seq gb|KJ145322.1|Norovirus 13-BA-1/2013/GII.P16/GII.13 nonstructural protein gene, complete cds; and capsid protein gene, partial cds97797739%0.080%KJ145322.1Select seq dbj|AB809995.1|Norovirus Hu/GII.13/09N3779/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds97697643%0.079%AB809995.1Select seq gb|KM198492.1|Norovirus Hu/GII/30448/2010/VNM nonstructural polyprotein and capsid protein VP1 genes, complete cds; and capsid protein VP2 gene, partial cds97697645%0.079%KM198492.1Select seq gb|KC464500.1|Norovirus Hu/GII.12/CGMH42/2010/TW, complete genome97697645%0.079%KC464500.1Select seq gb|KC464498.1|Norovirus Hu/GII.12/CGMH40/2010/TW, complete genome97697645%0.079%KC464498.1Select seq emb|X81879.1|Human calicivirus strain Melksham cDNA for orf1, orf2 and orf397297250%0.077%X81879.1Select seq dbj|AB809988.1|Norovirus Hu/GII.13/09N3645/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds97097044%0.079%AB809988.1Select seq gb|HQ449728.1|Norovirus Hu/GII.12/HS210/2010/USA, complete genome97097045%0.079%HQ449728.1Select seq gb|AY772730.1|Norovirus Hu/NLV/GII/Neustrelitz260/2000/DE from Germany, complete genome97097045%0.079%AY772730.1
  20. References FuJ, AiJ, JinM, JiangC, ZhangJ, ShiC, et al. Emergence of a new GII.17 norovirus variant in patients with acute gastroenteritis in Jiangsu, China, September 2014 to March 2015. Euro Surveill. 2015;20(24):21157. DOI: 10.2807/1560-7917.ES2015.20.24.21157 PMID: 26111236LuJ, SunL, FangL, YangF, MoY, LaoJ, et al. Gastroenteritis Outbreaks Caused by Norovirus GII.17, Guangdong Province, China, 2014-2015. Emerg Infect Dis. 2015;21(7):1240-2. DOI: 10.3201/eid2107.150226 PMID: 26080037MatsushimaY, IshikawaM, ShimizuT, KomaneA, KasuoS, ShinoharaM, et al. Genetic analyses of GII.17 norovirus strains in diarrheal disease outbreaks from December 2014 to March 2015 in Japan reveal a novel polymerase sequence and amino acid substitutions in the capsid region. Euro Surveill. 2015;20(26):21173. DOI: 10.2807/1560-7917.ES2015.20.26.21173 PMID: 26159307de GraafM, van BeekJ, VennemaH, PodkolzinAT, HewittJ, BucardoF, et al. Emergence of a novel GII.17 norovirus - End of the GII.4 era? Euro Surveill. 2015;20(26):21178. DOI: 10.2807/1560-7917.ES2015.20.26.21178 PMID: 26159308ParraGI, GreenKY. Genome of Emerging Norovirus GII.17, United States, 2014. Emerg Infect Dis.2015;21(8):1477-9. DOI: 10.3201/eid2108.150652 PMID: 26196235Green KY. 2013. Caliciviridae: the noroviruses. In: Knipe, D.M., Howley, P.M. (Eds.), Fields virology, 6th ed. Wolters Kluwer Health/Lippincott Williams and Wilkins, Philadelphia, pp. 949-9. KronemanA, VegaE, VennemaH, VinjéJ, WhitePA, HansmanG, et al. Proposal for a unified norovirus nomenclature and genotyping. Arch Virol. 2013;158(10):2059-68. DOI: 10.1007/s00705-013-1708-5 PMID: 23615870Dutch Ministry of Health. Welfare and Sport. National Institute for Public Health and the Environment (RIVM). Norovirus Genotyping Tool Version 1.0. Bilthoven: RIVM. [Accessed 24 Aug 2015]. Available from:http://www.rivm.nl/mpf/norovirus/typingtool WangQH, HanMG, CheethamS, SouzaM, FunkJA, SaifLJ. Porcine noroviruses related to human noroviruses. Emerg Infect Dis. 2005;11(12):1874-81. DOI: 10.3201/eid1112.050485 PMID: 16485473VennemaH, de BruinE, KoopmansM. Rational optimization of generic primers used for Norwalk-like virus detection by reverse transcriptase polymerase chain reaction. J Clin Virol. 2002;25(2):233-5. DOI: 10.1016/S1386-6532(02)00126-9 PMID: 12367660TamuraK, StecherG, PetersonD, FilipskiA, KumarS. MEGA6: Molecular Evolutionary Genetics Analysis version 6.0. Mol Biol Evol. 2013;30(12):2725-9. DOI: 10.1093/molbev/mst197 PMID: 24132122Hoa TranTN, TrainorE, NakagomiT, CunliffeNA, NakagomiO. Molecular epidemiology of noroviruses associated with acute sporadic gastroenteritis in children: global distribution of genogroups, genotypes and GII.4 variants. J Clin Virol. 2013;56(3):269-77. DOI: 10.1016/j.jcv.2012.11.011 PMID: 23218993SiebengaJJ, VennemaH, ZhengDP, VinjéJ, LeeBE, PangXL, et al. Norovirus illness is a global problem: emergence and spread of norovirus GII.4 variants, 2001-2007. J Infect Dis. 2009;200(5):802-12. DOI: 10.1086/605127 PMID: 19627248BernsteinDI, AtmarRL, LyonGM, TreanorJJ, ChenWH, JiangX, et al. Norovirus vaccine against experimental human GII.4 virus illness: a challenge study in healthy adults. J Infect Dis. 2015;211(6):870-8. DOI: 10.1093/infdis/jiu497 PMID: 25210140AyukekbongJA, FobisongC, TahF, LindhM, Nkuo-AkenjiT, BergströmT. Pattern of circulation of norovirus GII strains during natural infection. J Clin Microbiol. 2014;52(12):4253-9. DOI: 10.1128/JCM.01896-14 PMID: 25274996MansJ, MurrayTY, TaylorMB. Novel norovirus recombinants detected in South Africa. Virol J. 2014;11(1):168.DOI: 10.1186/1743-422X-11-168 PMID: 25228444RackoffLA, BokK, GreenKY, KapikianAZ. Epidemiology and evolution of rotaviruses and noroviruses from an archival WHO Global Study in Children (1976-79) with implications for vaccine design. PLoS ONE.2013;8(3):e59394. DOI: 10.1371/journal.pone.0059394 PMID: 23536875WangYH, ZhouDJ, ZhouX, YangT, GhoshS, PangBB, et al. Molecular epidemiology of noroviruses in children and adults with acute gastroenteritis in Wuhan, China, 2007-2010. Arch Virol. 2012;157(12):2417-24. DOI: 10.1007/s00705-012-1437-1 PMID: 22886184VegaE, BarclayL, GregoricusN, ShirleySH, LeeD, VinjéJ. Genotypic and epidemiologic trends of norovirus outbreaks in the United States, 2009 to 2013. J Clin Microbiol. 2014;52(1):147-55. DOI: 10.1128/JCM.02680-13PMID: 24172151
  21. DiscussionNoVs are a major cause of acute gastroenteritis in both children and adults, with sporadic cases and outbreaks in various epidemiological settings [6]. Although more than 30 cap genotypes within genogroups GI, GII, and GIV may infect humans [7], a single genotype, GII.4, has been associated since the mid-1990s with the majority (ca 70–80%) of NoV-associated cases of gastroenteritis worldwide [12]. GII.4 NoV strains undergo a continuous process of genetic/antigenic diversification and periodically generate new strains via accumulation of point mutations or recombination, with one novel GII.4 variant emerging every two to three years [12,13] and becoming predominant globally. NoV vaccines based on GII.4 NoV strains are currently under development [14]. In the winter season 2014/15, the GII.P17-GII.17 NoV strain Kawasaki 2014 emerged in Asia, replacing the previously dominant GII.4 genotype Sydney 2012 variant [1-4]. A signature of the Kawasaki 2014 variant is a novel pol type GII.P17, combined with a GII.17 ORF2 gene. Previously, NoVs with a GII.17 cap genotype possessed a GII.P4, GII.P3, GII.P13 or GII.P16 pol genotype [15-18]. Although being predominant in several Asian countries, this novel GII.P17-GII.17 strain has been detected in a limited number of cases on other continents [1-5]. The epidemiological trends exhibited by the Kawasaki 2014 NoV variant are considered unique, as, so far, this is the only non-GII.4 NoV strain to have shown such epidemic pattern. The emergence of the novel GII.P17-GII.17 NoV strain in the Asian countries has been associated with increased NoV activity, i.e. with increased incidence of NoV-induced acute gastroenteritis, in the 2014/15 winter season, compared to the previous (2013/14) winter season [1-3]. This pattern has been observed, but not consistently, during the worldwide spread of NoV GII.4 variants [19]. Based on current literature on GII.17 NoVs, there is no indication on the clinical severity of the novel GII.17 virus [1-5]. Likewise, our study did not assess whether Kawasaki 2014 NoVs are associated with increased severity of the clinical symptoms. Hospital-based surveillance for NoV identified the emergence of GII.P17-GII.17 strains in Italy at the end of the 2014/15 winter season, in February 2015. The viruses were genetically closely related to GII.17 NoVs identified in the US and Asia in 2014 and 2015 [3,5], forming a distinct subclade of the Kawasaki 2014 GII.17 NoV variant. Co-circulation of two subclades of Kawasaki 2014 GII.17 NoV with several amino acid changes in the putative capsid epitopes could suggest that this novel strain is undergoing fast diversification, mirroring what was seen globally for the epidemic GII.4 variants [12]. In addition, the emergence and spread of the novel GII.17 variant Kawasaki 2014 could represent a challenge for the efficacy of the candidate NoV vaccines [14], that target the globally predominant GII.4 NoV, as it is not known whether vaccine immunity elicited to GII.4 NoV is cross-reactive with GII.17 viruses. Continuous monitoring of the epidemiology of human NoV is important to understand the evolution of NoV and to implement the future strategies on NoV vaccines. AcknowledgementsThis study was partly supported by the projects ‘Epidemiologia molecolare e studio dei meccanismi evolutivi di norovirus e rotavirus umani’, granted by the University of Parma, Italy (Fondi di Ateneo 2014) and ‘Norovirus: caratterizzazione molecolare ed epidemiologia’, granted by the University of Palermo, Italy (Fondi di Ateneo 2012).
  22. Sequence analysisUpon direct sequencing of the RT-PCR amplicons, the two strains, PR668/2015/ITA and BA603–6/2015/ITA, were found to be identical in the short diagnostic regions A and C. We determined the sequence of a large portion (3.2 kb) of the genome at the 3’ end for strain PR668/2015/ITA. Viral RNA was extracted from 140 µl of stool suspension using the QIAmp viral RNA kit (Qiagen, GmbH, Hilden, Germany). A 3’-rapid amplification of cDNA ends (RACE)-PCR) protocol was used to generate the 3.2-kb amplicon encompassing the 3’ end of ORF1, the full-length ORF2 and ORF3, and the 3’ untranslated region (UTR) until the poly(A) tail, using the reverse primer VN3T20 [9] and the forward primer JV12Y [10]. The RACE product was cloned and the sequence was determined. Phylogenetic analysis was performed using MEGA v. 6.0 [11]. The 3.2-kb sequence of the Italian NoV GII.P17-GII.17 strain has been deposited in GenBank under accession number KT346356. The partial sequence of ORF1 (807 nt), and the full-length sequences of ORF2 (1,621 nt) and ORF3 (849 nt) of strain PR668/2015/ITA were analysed with NoV GII.P17-GII.17 sequences available in the GenBank database (Figure 1). Figure 1Phylogenetic analysis based on partial ORF1, full ORF2 and full ORF3 sequences of GII.17 norovirus, Italy, February 2015 The Italian GII.P17-GII.17 strain is indicated in bold. Trees were built with the maximum-likelihood method, and bootstrapped with 1,000 repetitions. Bootstrap values > 80% are indicated. The scale bar indicates the number of nucleotide substitutions per site. The topology of the trees in the multi-target phylogenetic analysis was conserved, with the GII.P17-GII.17 Kawasaki 2014 NoV forming a monophyletic branch and further segregating into two genetic subclades. The first subclade containing the Italian PR668/2015/ITA strain clustered with GII.P17-GII.17 NoVs detected in China and Hong Kong during 2014 and 2015, and was genetically related (99.9%) to a GII.P17-GII.17 strain detected in the United States (US) in November 2014. The second subclade included GII.P17-GII.17 NoV detected in Japan and Taiwan during 2013 and 2014. The viruses of the two subclades showed a moderate degree of nucleotide and amino acid divergence in the ORF2 and ORF3 sequences (1–1.9% nucleotide and 0–0.4% amino acid differences in ORF1, 0.4–4.1% nucleotides and 0.9–6.2% amino acids in ORF2, and 0.5–3.3% nucleotides and 1–4.9% amino acids in ORF3). Interestingly, the GII.17 capsid sequences of the two genetic subclades differed markedly from the oldest GII.17 capsid sequence available in GenBank database, dating back to 1978 (23.3–24.8% nucleotide and 14.2–16.6% amino acid differences in ORF2, and 19.4–27% nucleotide and 22.1–22.9% amino acid differences in ORF3). Several changes in the VP1 sequence were observed between the two Kawasaki 2014 subclades, mostly, but not exclusively, affecting the antibody blockade sites, i.e. the putative epitopes (A-E) located in the capsid protruding hypervariable P2 domain (Figure 2). In the 543 amino acid VP1 protein, 17 amino acid changes (3.1% divergence) and four insertions separate the two Kawasaki 2014 subclades, while 38 amino acid changes (7% divergence) and several insertions/deletions separate the Kawasaki 2014 GII.17 NoV and the former GII.17 recombinant forms. Figure 2Amino acid substitutions in the VP1 sequence of norovirus GII.17 strains, 1978 to 2015 The putative blockade epitopes A–E are indicated. The Italian GII.P17-GII.17 strain is indicated in bold. Dots indicate sequence conservation. Dashes indicate deletions/insertions of the amino acid residues. Amino acid numbering is based on the sequence of the C142 strain (JN699043).

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.