Jump to content

niman

Super Administrators
  • Posts

    74,774
  • Joined

  • Last visited

  • Days Won

    31

Everything posted by niman

  1. October 27, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are 14 new travel associated cases with four in Miami-Dade, one in Collier, one in Monroe, one in Palm Beach and seven involving pregnant women. Please visit our website to see the full list of travel-related cases. There is one non-travel associated case today. The individual had exposure in Wynwood with symptom onset in July. The department just received confirmatory testing from CDC. This case does not impact the lifting of the Zika zone in Wynwood. DOH continues door-to-door outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the identified areas in Miami-Dade County. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 765 Non-Travel Related Infections of Zika 181 Infections Involving Pregnant Women 122 Out of State Cases (not Florida Residents) 19 Undetermined 6 Total 1,093 click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 12 active investigations. The department has closed 33 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 9,657 people statewide. Florida currently has the capacity to test 8,236 people for active Zika virus and 6,455for Zika antibodies. At Governor Scott’s direction, all county health departments offer free Zika risk assessment and testing to pregnant women. Florida’s small case clusters is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted areas in Miami-Dade County (see maps below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should test all pregnant women who lived in, traveled to or whose partner traveled to Miami-Dade County after Aug. 1, 2016. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 122. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted more than 6,913 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. click image above to enlarge click image above to enlarge About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  2. October 27, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are 14 new travel associated cases with four in Miami-Dade, one in Collier, one in Monroe, one in Palm Beach and seven involving pregnant women. Please visit our website to see the full list of travel-related cases. There is one non-travel associated case today. The individual had exposure in Wynwood with symptom onset in July. The department just received confirmatory testing from CDC. This case does not impact the lifting of the Zika zone in Wynwood. DOH continues door-to-door outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the identified areas in Miami-Dade County. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 765 Non-Travel Related Infections of Zika 181 Infections Involving Pregnant Women 122 Out of State Cases (not Florida Residents) 19 Undetermined 6 Total 1,093 click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 12 active investigations. The department has closed 33 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 9,657 people statewide. Florida currently has the capacity to test 8,236 people for active Zika virus and 6,455for Zika antibodies. At Governor Scott’s direction, all county health departments offer free Zika risk assessment and testing to pregnant women. Florida’s small case clusters is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted areas in Miami-Dade County (see maps below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should test all pregnant women who lived in, traveled to or whose partner traveled to Miami-Dade County after Aug. 1, 2016. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 122. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted more than 6,913 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. click image above to enlarge click image above to enlarge About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  3. There is one non-travel associated case today. The individual had exposure in Wynwood with symptom onset in July. The department just received confirmatory testing from CDC. This case does not impact the lifting of the Zika zone in Wynwood.
  4. There are 14 new travel associated cases with four in Miami-Dade, one in Collier, one in Monroe, one in Palm Beach and seven involving pregnant women. Please visit our website to see the full list of travel-related cases. There is one non-travel associated case today. The individual had exposure in Wynwood with symptom onset in July.
  5. Infection Type Infection Count Travel-Related Infections of Zika 765 Non-Travel Related Infections of Zika 181 Infections Involving Pregnant Women 122 Out of State Cases (not Florida Residents) 19 Undetermined 6 Total 1,093 http://www.floridahealth.gov/newsroom/2016/10/102716-zika-update.html
  6. Infection Type Infection Count Travel-Related Infections of Zika 765 Non-Travel Related Infections of Zika 181 Infections Involving Pregnant Women 122 Out of State Cases (not Florida Residents) 19 Undetermined 6 Total 1,093 http://www.floridahealth.gov/newsroom/2016/10/102716-zika-update.html
  7. Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX694532.1| Zika virus strain ZIKV/Homo sapiens/THA/PLCal_ZV/2013, complete genome 3698 3698 100% 0.0 99% KX694532.1 Select seq gb|KF993678.1| Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds 3698 3698 100% 0.0 99% KF993678.1 Select seq gb|KX447521.1| Zika virus isolate 1_0080_PF polyprotein gene, partial cds 3631 3631 100% 0.0 99% KX447521.1 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 3631 3631 100% 0.0 99% KX447509.1 Select seq gb|KX879604.1| Zika virus isolate SN089, complete genome 3626 3626 100% 0.0 99% KX879604.1 Select seq gb|KX447519.1| Zika virus isolate 1_0199_PF polyprotein gene, partial cds 3626 3626 100% 0.0 99% KX447519.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 3626 3626 100% 0.0 99% KX447513.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 3626 3626 100% 0.0 99% KX447510.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 3626 3626 100% 0.0 99% KX262887.1 Select seq gb|KY014315.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME152-SER polyprotein gene, complete cds 3624 3624 100% 0.0 98% KY014315.1 Select seq gb|KX879603.1| Zika virus isolate SN062, complete genome 3622 3622 100% 0.0 98% KX879603.1 Select seq gb|KX856011.1| Zika virus strain ZIKV/Aedes sp./MEX_I-44/2016, complete genome 3622 3622 100% 0.0 98% KX856011.1 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 3622 3622 100% 0.0 98% KJ776791.2 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 3622 3622 100% 0.0 98% KX694534.1 Select seq gb|KX447520.1| Zika virus isolate 1_0016_PF polyprotein gene, partial cds 3622 3622 100% 0.0 98% KX447520.1 Select seq gb|KX447518.1| Zika virus isolate 1_0117_PF polyprotein gene, partial cds 3622 3622 100% 0.0 98% KX447518.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 3622 3622 100% 0.0 98% KX447515.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 3622 3622 100% 0.0 98% KX447514.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 3622 3622 100% 0.0 98% KX447511.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 3622 3622 100% 0.0 98% KX247632.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 3622 3622 100% 0.0 98% KX051563.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 3622 3622 100% 0.0 98% KU509998.3 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 3622 3622 100% 0.0 98% KU991811.1 Select seq gb|KU681081.3| Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome 3622 3622 100% 0.0 98% KU681081.3 Select seq gb|KY014307.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ49D1-PLA polyprotein gene, complete cds 3617 3617 100% 0.0 98% KY014307.1 Select seq gb|KY014306.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME178-PLA polyprotein gene, complete cds 3617 3617 100% 0.0 98% KY014306.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 3617 3617 100% 0.0 98% KX197205.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 3617 3617 100% 0.0 98% KX447516.1 Select seq gb|KX576684.1| Zika virus vector pZIKV-ICD, complete sequence 3617 3617 100% 0.0 98% KX576684.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 3617 3617 100% 0.0 98% KX369547.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 3617 3617 100% 0.0 98% KX446951.1 Select seq gb|KU758871.1| Zika virus isolate 17170 polyprotein gene, partial cds 3617 3617 100% 0.0 98% KU758871.1 Select seq gb|KU758870.1| Zika virus isolate 17160 polyprotein gene, partial cds 3617 3617 100% 0.0 98% KU758870.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 3617 3617 100% 0.0 98% KX280026.1 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 3617 3617 100% 0.0 98% KU527068.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 3615 3615 100% 0.0 98% KX766028.1 Select seq gb|KY014327.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME167-PLA polyprotein gene, complete cds 3613 3613 100% 0.0 98% KY014327.1 Select seq gb|KX806557.2| Zika virus isolate TS17-2016, complete genome 3613 3613 100% 0.0 98% KX806557.2 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 3613 3613 100% 0.0 98% KX766029.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 3613 3613 100% 0.0 98% KX447517.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 3613 3613 100% 0.0 98% KX447512.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 3613 3613 100% 0.0 98% KU758877.1 Select seq gb|KU758873.1| Zika virus isolate 18246 polyprotein gene, partial cds 3613 3613 100% 0.0 98% KU758873.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 3613 3613 100% 0.0 98% KX247646.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 3613 3613 100% 0.0 98% KX197192.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 3613 3613 100% 0.0 98% KU937936.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 3613 3613 100% 0.0 98% KX156776.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 3613 3613 100% 0.0 98% KX156774.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 3613 3613 100% 0.0 98% KU940228.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 3613 3613 100% 0.0 98% KU501217.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 3613 3613 100% 0.0 98% KU501216.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 3613 3613 100% 0.0 98% KU365778.1 Select seq gb|KU312314.1| Zika virus isolate Z1106031 polyprotein gene, partial cds 3613 3613 100% 0.0 98% KU312314.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 3613 3613 100% 0.0 98% KU321639.1 Select seq gb|KY014309.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ47D1-PLA polyprotein gene, partial cds 3611 3611 100% 0.0 98% KY014309.1 Select seq gb|KY014301.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI polyprotein gene, complete cds 3611 3611 100% 0.0 98% KY014301.1 Select seq gb|KY014310.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME42-SER polyprotein gene, complete cds 3609 3609 100% 0.0 98% KY014310.1 Select seq gb|KY014319.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME38-PLA polyprotein gene, complete cds 3608 3608 100% 0.0 98% KY014319.1 Select seq gb|KY014317.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ28D1-URI polyprotein gene, complete cds 3608 3608 100% 0.0 98% KY014317.1 Select seq gb|KY014304.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0180-SER polyprotein gene, complete cds 3608 3608 100% 0.0 98% KY014304.1 Select seq dbj|LC190723.1| Zika virus genomic RNA, complete genome, strain: ZIKV/Hu/Yokohama/1/2016 3608 3608 100% 0.0 98% LC190723.1 Select seq gb|KX922707.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL039U polyprotein gene, complete cds 3608 3608 100% 0.0 98% KX922707.1 Select seq gb|KX811222.1| Zika virus isolate Brazil_2015_MG, complete genome 3608 3608 100% 0.0 98% KX811222.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 3608 3608 100% 0.0 98% KU820897.5 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 3608 3608 100% 0.0 98% KX266255.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 3608 3608 100% 0.0 98% KX520666.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 3608 3608 100% 0.0 98% KX446950.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 3608 3608 100% 0.0 98% KU866423.2 Select seq gb|KU758869.1| Zika virus isolate 05211 polyprotein gene, partial cds 3608 3608 100% 0.0 98% KU758869.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 3608 3608 100% 0.0 98% KX253996.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 3608 3608 100% 0.0 98% KX185891.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 3608 3608 100% 0.0 98% KX156775.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 3608 3608 100% 0.0 98% KX117076.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 3608 3608 100% 0.0 98% KX087102.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 3608 3608 100% 0.0 98% KU963796.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 3608 3608 100% 0.0 98% KU955589.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 3608 3608 100% 0.0 98% KU820899.2 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 3608 3608 100% 0.0 98% KU729218.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 3608 3608 100% 0.0 98% KU497555.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 3608 3608 100% 0.0 98% KU707826.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 3608 3608 100% 0.0 98% KU365779.1 Select seq gb|KY014297.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-6864-URI polyprotein gene, complete cds 3606 3606 100% 0.0 98% KY014297.1 Select seq gb|KU940224.1| Zika virus isolate Bahia09, partial genome 3606 3606 100% 0.0 98% KU940224.1 Select seq gb|KY014321.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0115-SER polyprotein gene, complete cds 3604 3604 100% 0.0 98% KY014321.1 Select seq gb|KY014303.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0127-SER polyprotein gene, complete cds 3604 3604 100% 0.0 98% KY014303.1 Select seq gb|KY014300.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0208-SER polyprotein gene, complete cds 3604 3604 100% 0.0 98% KY014300.1 Select seq gb|KX827309.1| Zika virus isolate ZKA-16-291 polyprotein gene, complete cds 3604 3604 100% 0.0 98% KX827309.1 Select seq gb|KX813683.1| Zika virus isolate ZKA-16-097 polyprotein gene, complete cds 3604 3604 100% 0.0 98% KX813683.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 3604 3604 100% 0.0 98% KX377337.1 Select seq gb|KU758872.1| Zika virus isolate 01170 polyprotein gene, partial cds 3604 3604 100% 0.0 98% KU758872.1 Select seq gb|KU758868.1| Zika virus isolate 27229 polyprotein gene, partial cds 3604 3604 100% 0.0 98% KU758868.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 3604 3604 100% 0.0 98% KU870645.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 3604 3604 100% 0.0 98% KU926309.1 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 3604 3604 100% 0.0 98% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 3604 3604 100% 0.0 98% KU853012.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 3604 3604 100% 0.0 98% KU729217.2 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 3604 3604 100% 0.0 98% KU501215.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 3604 3604 100% 0.0 98% KU365780.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 3604 3604 100% 0.0 98% KU365777.1 Select seq gb|KY014322.1| Zika virus isolate Zika virus/A.aegypti-wt/USA/2016/FL-03-MOS polyprotein gene, complete cds 3599 3599 100% 0.0 98% KY014322.1
  8. LOCUS KY007221 2088 bp RNA linear VRL 25-OCT-2016 DEFINITION Zika virus isolate BKK01 polyprotein gene, partial cds. ACCESSION KY007221 VERSION KY007221.1 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 2088) AUTHORS Leelahakorn,N., Horthongkham,N., Sornprasert,S., Athipanyasilp,N., Kantakamalakul,W. and Sutthent,R. TITLE Characterization of zika virus in Thailand JOURNAL Unpublished REFERENCE 2 (bases 1 to 2088) AUTHORS Leelahakorn,N., Horthongkham,N., Sornprasert,S., Athipanyasilp,N., Kantakamalakul,W. and Sutthent,R. TITLE Direct Submission JOURNAL Submitted (18-OCT-2016) Microbiology, Faculty of Medicine Siriraj Hospital, Mahidol University, 2 Wanglang, Bangkok, Bangkok 10700, Thailand COMMENT ##Assembly-Data-START## Assembly Method :: DNAbaser v. 4.2 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..2088 /organism="Zika virus" /mol_type="genomic RNA" /isolate="BKK01" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="Thailand" /collection_date="30-Aug-2016" CDS <1..>2088 /codon_start=1 /product="polyprotein" /protein_id="AOX24135.1" /translation="KEKKRRGTDTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRSDAG EAISFPTTLGMNKCYIQIMDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVY GTCHHKKGEARRSRRAVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFA LAAAAIAWLLGSSTSQKVIYLVMILLIAPAYSIRCIGVNNRDFVEGMSGGTWVDVVLE HGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDK QSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLS VHGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSD LYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVL GSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTK IPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKM MLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFG SVGGALNSLGKGIHQIFGAAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLVCLA LGGVLIFLSTAVSA" ORIGIN 1 aaggagaaga agagacgagg cacagacact agtgtcggaa ttgttggcct cctgctgacc 61 acagccatgg cagcggaggt cactagacgt gggagtgcat actatatgta cttggacaga 121 agcgatgctg gggaggccat atcttttcca accacactgg ggatgaataa gtgttatata 181 cagatcatgg atcttggaca catgtgtgat gccaccatga gctatgaatg ccctatgctg 241 gatgaggggg tagaaccaga tgacgtcgat tgttggtgca acacgacgtc aacttgggtt 301 gtgtacggaa cctgccacca caaaaaaggt gaagcgcgga gatctagaag agctgtgacg 361 ctcccctccc actccactag gaagctgcaa acgcggtcgc agacctggtt ggaatcaaga 421 gaatacacaa agcacttgat tagagtcgaa aattggatat tcaggaaccc tggcttcgcg 481 ttggcagcag ctgccatcgc ttggcttttg ggaagctcaa cgagccaaaa agtcatatac 541 ttggtcatga tactgctgat tgccccggca tatagcatca ggtgcatagg agtcaacaat 601 agggactttg tggaaggtat gtcaggtggg acttgggttg atgtcgtctt ggaacatgga 661 ggttgtgtca ccgtaatggc acaggacaaa ccgactgtcg acatagagct ggttacaaca 721 acagtcagca acatggcaga ggtaagatcc tactgctatg aggcatcaat atcggacatg 781 gcttcggaca gccgctgccc aacacaaggt gaagcctacc ttgacaagca atcagacact 841 caatatgtct gcaaaagaac gttagtggac agaggctggg gaaatggatg tggacttttt 901 ggcaaaggga gcctggtgac atgcgccaag tttgcatgct ccaagaaaat gaccgggaag 961 agcatccagc cagagaatct ggagtaccga ataatgctgt cagttcatgg ctcccagcac 1021 agtgggatga tcgttaatga cacaggacat gaaactgatg agaatagagc gaaggttgag 1081 ataacgccca attcaccaag agccgaagcc accctgggag gttttggaag cctaggactt 1141 gattgtgaac cgaggacagg ccttgacttt tcagatttgt attacttgac tatgaataac 1201 aagcactggt tggttcacaa ggagtggttc cacgacattc cattaccttg gcacgctggg 1261 gcagacaccg gaactccaca ctggaacaac aaagaagcac tggtagagtt caaggatgca 1321 catgccaaaa ggcaaactgt cgtggtccta gggagtcaag agggagcagt tcacacggct 1381 cttgctggag ctctggaggc tgagatggat ggtgcaaagg gaaggctgtc ctctggccac 1441 ttgaaatgtc gcctgaaaat ggataaactt agactgaagg gcgtgtcata ctccctgtgt 1501 accgcagcgt tcacattcac taagatcccg gctgaaacac tgcacgggac agtcacagtg 1561 gaggtacagt acgcagggac agatggacct tgcaaggttc cagctcagat ggcggtggac 1621 atgcaaactc tgaccccagt tgggaggttg ataaccgcta accctgtaat cactgaaagc 1681 actgagaact ctaagatgat gctggaactt gatccaccat ttggggactc ttacattgtc 1741 ataggagtcg gggagaagaa gatcacccac cactggcaca ggagtggcag caccattgga 1801 aaagcatttg aagccactgt gagaggtgcc aagagaatgg cagtcttggg agacacagcc 1861 tgggactttg gatcagttgg aggcgctctc aactcattgg gcaagggtat ccatcaaatt 1921 tttggagcag ctttcaaatc attgtttgga ggaatgtcct ggttctcaca aattctcatt 1981 ggaacgttgc tgatgtggtt gggtctgaat acaaagaatg gatctatttc ccttgtgtgc 2041 ttggccttag ggggagtgtt gatcttcttg tccacagccg tctctgct
  9. Faculty of Medicine Siriraj Hospital in Bangkok Thailand has released a partial 2016 Zika sequence which is most closely related to 2013 sequence from Thailand.
  10. Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KU681082.3| Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome 3241 3241 100% 0.0 99% KU681082.3 Select seq gb|EU545988.1| Zika virus polyprotein gene, complete cds 3200 3200 100% 0.0 98% EU545988.1 Select seq gb|KX447521.1| Zika virus isolate 1_0080_PF polyprotein gene, partial cds 3196 3196 100% 0.0 98% KX447521.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 3196 3196 100% 0.0 98% KX447517.1 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 3196 3196 100% 0.0 98% KX447509.1 Select seq gb|KU955593.1| Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome 3196 3196 100% 0.0 98% KU955593.1 Select seq gb|JN860885.1| Zika virus isolate FSS13025 polyprotein gene, partial cds 3196 3196 100% 0.0 98% JN860885.1 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 3191 3191 100% 0.0 98% KJ776791.2 Select seq gb|KX447520.1| Zika virus isolate 1_0016_PF polyprotein gene, partial cds 3191 3191 100% 0.0 98% KX447520.1 Select seq gb|KX447519.1| Zika virus isolate 1_0199_PF polyprotein gene, partial cds 3191 3191 100% 0.0 98% KX447519.1 Select seq gb|KX447518.1| Zika virus isolate 1_0117_PF polyprotein gene, partial cds 3191 3191 100% 0.0 98% KX447518.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 3191 3191 100% 0.0 98% KX447516.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 3191 3191 100% 0.0 98% KX447513.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 3191 3191 100% 0.0 98% KX447510.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 3191 3191 100% 0.0 98% KU758877.1 Select seq gb|KU758871.1| Zika virus isolate 17170 polyprotein gene, partial cds 3191 3191 100% 0.0 98% KU758871.1 Select seq gb|KU758870.1| Zika virus isolate 17160 polyprotein gene, partial cds 3191 3191 100% 0.0 98% KU758870.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 3191 3191 100% 0.0 98% KX262887.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 3191 3191 100% 0.0 98% KU870645.1 Select seq gb|KY014315.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME152-SER polyprotein gene, complete cds 3189 3189 100% 0.0 98% KY014315.1 Select seq gb|KX856011.1| Zika virus strain ZIKV/Aedes sp./MEX_I-44/2016, complete genome 3187 3187 100% 0.0 98% KX856011.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 3187 3187 100% 0.0 98% KX694534.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 3187 3187 100% 0.0 98% KX447515.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 3187 3187 100% 0.0 98% KX447514.1 Select seq gb|KU758873.1| Zika virus isolate 18246 polyprotein gene, partial cds 3187 3187 100% 0.0 98% KU758873.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 3187 3187 100% 0.0 98% KX247632.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 3187 3187 100% 0.0 98% KU937936.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 3187 3187 100% 0.0 98% KX051563.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 3187 3187 100% 0.0 98% KU509998.3 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 3187 3187 100% 0.0 98% KU365778.1 Select seq gb|KU312314.1| Zika virus isolate Z1106031 polyprotein gene, partial cds 3187 3187 100% 0.0 98% KU312314.1 Select seq gb|KY014317.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ28D1-URI polyprotein gene, complete cds 3182 3182 100% 0.0 98% KY014317.1 Select seq gb|KY014306.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME178-PLA polyprotein gene, complete cds 3182 3182 100% 0.0 98% KY014306.1 Select seq gb|KY014301.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI polyprotein gene, complete cds 3182 3182 100% 0.0 98% KY014301.1 Select seq gb|KX806557.2| Zika virus isolate TS17-2016, complete genome 3182 3182 100% 0.0 98% KX806557.2 Select seq gb|KX879604.1| Zika virus isolate SN089, complete genome 3182 3182 100% 0.0 98% KX879604.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 3182 3182 100% 0.0 98% KX197205.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 3182 3182 100% 0.0 98% KX447511.1 Select seq gb|KX576684.1| Zika virus vector pZIKV-ICD, complete sequence 3182 3182 100% 0.0 98% KX576684.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 3182 3182 100% 0.0 98% KX369547.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 3182 3182 100% 0.0 98% KX446951.1 Select seq gb|KU758868.1| Zika virus isolate 27229 polyprotein gene, partial cds 3182 3182 100% 0.0 98% KU758868.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 3182 3182 100% 0.0 98% KX280026.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 3182 3182 100% 0.0 98% KX197192.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 3182 3182 100% 0.0 98% KU729218.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 3182 3182 100% 0.0 98% KU707826.1 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 3182 3182 100% 0.0 98% KU527068.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 3182 3182 100% 0.0 98% KU365779.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 3182 3182 100% 0.0 98% KU321639.1 Select seq gb|KY014310.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME42-SER polyprotein gene, complete cds 3180 3180 100% 0.0 98% KY014310.1 Select seq gb|KY014307.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ49D1-PLA polyprotein gene, complete cds 3180 3180 99% 0.0 98% KY014307.1 Select seq gb|KY014297.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-6864-URI polyprotein gene, complete cds 3180 3180 100% 0.0 98% KY014297.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 3180 3180 100% 0.0 98% KX766028.1 Select seq gb|KY014327.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME167-PLA polyprotein gene, complete cds 3178 3178 100% 0.0 98% KY014327.1 Select seq gb|KY014319.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME38-PLA polyprotein gene, complete cds 3178 3178 100% 0.0 98% KY014319.1 Select seq gb|KY014304.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0180-SER polyprotein gene, complete cds 3178 3178 100% 0.0 98% KY014304.1 Select seq gb|KX922707.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL039U polyprotein gene, complete cds 3178 3178 100% 0.0 98% KX922707.1 Select seq gb|KX879603.1| Zika virus isolate SN062, complete genome 3178 3178 100% 0.0 98% KX879603.1 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 3178 3178 100% 0.0 98% KX766029.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 3178 3178 100% 0.0 98% KX447512.1 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 3178 3178 100% 0.0 98% KX266255.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 3178 3178 100% 0.0 98% KX446950.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 3178 3178 100% 0.0 98% KX377337.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 3178 3178 100% 0.0 98% KU866423.2 Select seq gb|KU758872.1| Zika virus isolate 01170 polyprotein gene, partial cds 3178 3178 100% 0.0 98% KU758872.1 Select seq gb|KU758869.1| Zika virus isolate 05211 polyprotein gene, partial cds 3178 3178 100% 0.0 98% KU758869.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 3178 3178 100% 0.0 98% KX253996.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 3178 3178 100% 0.0 98% KX185891.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 3178 3178 100% 0.0 98% KX117076.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 3178 3178 100% 0.0 98% KU963796.1 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 3178 3178 100% 0.0 98% KU991811.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 3178 3178 100% 0.0 98% KU940228.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 3178 3178 100% 0.0 98% KU955589.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 3178 3178 100% 0.0 98% KU820899.2 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 3178 3178 100% 0.0 98% KU501217.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 3178 3178 100% 0.0 98% KU501216.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 3178 3178 100% 0.0 98% KU501215.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 3178 3178 100% 0.0 98% KU365780.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 3178 3178 100% 0.0 98% KU365777.1 Select seq gb|KY014309.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ47D1-PLA polyprotein gene, partial cds 3177 3177 100% 0.0 98% KY014309.1 Select seq gb|KY014321.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0115-SER polyprotein gene, complete cds 3173 3173 100% 0.0 98% KY014321.1 Select seq gb|KY014316.1| Zika virus isolate Zika virus/H.sapiens-wt/USA/2016/FL-039-URI polyprotein gene, complete cds 3173 3173 100% 0.0 98% KY014316.1 Select seq gb|KY014300.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0208-SER polyprotein gene, complete cds 3173 3173 100% 0.0 98% KY014300.1 Select seq dbj|LC190723.1| Zika virus genomic RNA, complete genome, strain: ZIKV/Hu/Yokohama/1/2016 3173 3173 100% 0.0 98% LC190723.1 Select seq gb|KX811222.1| Zika virus isolate Brazil_2015_MG, complete genome 3173 3173 100% 0.0 98% KX811222.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 3173 3173 100% 0.0 98% KX601168.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 3173 3173 100% 0.0 98% KX520666.1 Select seq gb|KU758876.1| Zika virus isolate 21068 polyprotein gene, partial cds 3173 3173 100% 0.0 98% KU758876.1 Select seq gb|KU758875.1| Zika virus isolate 15042 polyprotein gene, partial cds 3173 3173 100% 0.0 98% KU758875.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 3173 3173 100% 0.0 98% KX087101.2 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 3173 3173 100% 0.0 98% KU926309.1 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 3173 3173 100% 0.0 98% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 3173 3173 100% 0.0 98% KU853012.1 Select seq gb|KU681081.3| Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome 3173 3173 100% 0.0 98% KU681081.3 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 3173 3173 100% 0.0 98% KU497555.1 Select seq gb|KY014326.1| Zika virus isolate Zika virus/H.sapiens-wt/USA/2016/FL-038-URI polyprotein gene, complete cds 3169 3169 100% 0.0 98% KY014326.1 Select seq gb|KY014324.1| Zika virus isolate Zika virus/A.aegypti-wt/USA/2016/FL-01-MOS polyprotein gene, complete cds 3169 3169 100% 0.0 98% KY014324.1 Select seq gb|KY014323.1| Zika virus isolate Zika virus/A.aegypti-wt/USA/2016/FL-02-MOS polyprotein gene, complete cds 3169 3169 100% 0.0 98% KY014323.1 Select seq gb|KY014322.1| Zika virus isolate Zika virus/A.aegypti-wt/USA/2016/FL-03-MOS polyprotein gene, complete cds 3169 3169 100% 0.0 98% KY014322.1 Select seq gb|KY014298.1| Zika virus isolate Zika virus/H.sapiens-wt/USA/2016/FL-032-URI polyprotein gene, complete cds 3169 3169 100% 0.0 98% KY014298.1
  11. LOCUS KY003152 1862 bp RNA linear VRL 25-OCT-2016 DEFINITION Zika virus isolate ZIKV/Homo sapiens/PHL/2016/ZK16-0128 envelope protein E gene, partial cds. ACCESSION KY003152 VERSION KY003152.1 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 1862) AUTHORS Foronda,J.L.M. and Sy,A.K.D. TITLE Zika outbreak in the Philippines, 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 1862) AUTHORS Foronda,J.L.M. and Sy,A.K.D. TITLE Direct Submission JOURNAL Submitted (17-OCT-2016) Virology, Research Institute for Tropical Medicine, 9002 Research Drive, Filinvest Corporate City, Alabang, Muntinlupa City, Metro Manila 1781, Philippines COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1862 /organism="Zika virus" /mol_type="genomic RNA" /isolate="ZIKV/Homo sapiens/PHL/2016/ZK16-0128" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="Philippines: Iloilo City" /collection_date="01-Sep-2016" CDS <1..>1862 /codon_start=1 /product="envelope protein E" /protein_id="AOX24134.1" /translation="GTCHHKKGEARRSRRAVTLPSHSTRKLQTRSQTWLESREYTKHL IRVENWIFRNPGFALAAAAIAWLLGSSTSQKVIYLVMILLIAPAYSIRCIGVSNRDFV EGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMAS DSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGK SIQPENLEYRIMLSVHGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSL GLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNKEALVE FKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKG VSYSLCAAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLIT ANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEATVRGA KRMAVLGDTAWDFGSVGGALNSLGKGIHQIFGAAFKSLFGGMSWFSQILIGTLLVWLG LNTKNGSISLACLALGGVLIFLSTAVSADVGCSVDFSKKETRCGTGVFVYNDVEA" ORIGIN 1 ggaacctgcc accacaaaaa aggtgaagca cggagatcta gaagagctgt gacgctcccc 61 tcccattcca ctaggaagct gcaaacgcgg tcgcagacct ggttggaatc aagagaatac 121 acaaagcacc tgattagagt cgagaattgg atattcagga accccggctt cgcgttagca 181 gcagctgcca tcgcttggct tttgggaagt tcaacgagcc aaaaagtcat atatttggtc 241 atgatactgc tgattgcccc ggcatacagc atcaggtgca taggagtcag caatagggac 301 tttgtggaag gtatgtcagg tgggacttgg gttgatgttg tcttggaaca tggaggctgt 361 gttaccgtaa tggcacagga caaaccgact gtcgacatag agctggttac aacaacagtt 421 agcaacatgg cggaggtaag atcctactgc tatgaggcat caatatcgga tatggcttcg 481 gacagccgct gcccaacaca aggtgaggcc taccttgaca agcagtcaga cactcaatat 541 gtctgcaaaa gaacgttagt ggatagaggc tggggaaatg gatgtggact ttttggaaaa 601 gggagcctgg tgacatgcgc taagtttgca tgctccaaga aaatgaccgg gaagagcatc 661 cagccagaga acctggagta ccggataatg ctgtcagttc atggctccca gcacagtggg 721 atgatcgtta atgacacagg acatgaaact gatgagaata gagcgaaggt tgagataacg 781 cccaattcac caagagccga agccaccctg gggggttttg gaagcctagg acttgattgt 841 gaaccgagga caggccttga cttttcagat ttgtattacc tgactatgaa taacaagcac 901 tggttggttc acaaggagtg gttccacgac attccattac cttggcatgc tggggcagac 961 actggaactc cacattggaa caacaaagaa gcactggtag agttcaagga cgcacatgcc 1021 aaaaggcaaa ctgtcgtggt tctagggagt caagaaggag cagttcacac ggcccttgct 1081 ggagctctgg aggctgagat ggatggtgca aagggaaggc tgtcctctgg ccacttgaaa 1141 tgtcgcctga aaatggataa actcagattg aagggtgtgt catactcctt gtgtgctgca 1201 gcgttcacat tcaccaagat cccggctgaa acactgcacg ggacagtcac agtggaggta 1261 cagtacgcag ggacagatgg accttgcaag gttccagctc agatggcggt ggatatgcaa 1321 actctgaccc cagttgggag gttgataacc gctaaccctg taatcactga aagcaccgag 1381 aactctaaga tgatgctgga acttgatcca ccatttgggg actcttacat tgtcatagga 1441 gtcggggaga agaagatcac ccaccactgg cacaggagtg gcagcaccat tggaaaagca 1501 tttgaagcca ctgtgagagg tgccaagaga atggcagtct tgggagacac agcctgggac 1561 tttggatcag ttggaggtgc tctcaactca ttgggcaagg gcatccatca aatttttgga 1621 gcagctttca aatcattgtt tggaggaatg tcctggttct cacaaattct catcggaacg 1681 ttgctggtgt ggttgggtct gaatacaaag aatggatcta tttcccttgc atgcttggct 1741 ttagggggag tgttgatctt cttatccaca gccgtctctg ctgatgtggg gtgctcggtg 1801 gacttctcaa agaaggaaac gagatgcggt acaggggtgt tcgtctataa cgacgttgaa 1861 gc
  12. Research Institute for Tropical Medicine in the Philippines released a partial sequence from 2016 Zika isolate which was most closely related to 2012 sequence from the Philippines.
  13. ACTIVE INVESTIGATIONS Information on Active Investigations When a local case of Zika virus is confirmed through laboratory testing, the department conducts a thorough investigation around the case to determine if additional people are infected. The department interviews and tests close contacts and community members around the case. Knowing if additional people are infected helps the department determine if there is a zone where mosquitoes are transmitting the virus. Not every case results in a designation of active transmission in an area. In some instances, a case of Zika is an isolated incident with no additional people infected. For more information on the department’s testing and investigation process, click here. paragraph break Current Number of Active Investigations: 12 Miami-Dade County: 8 open investigations Palm Beach: 1 open investigations Unknown: 3 open investigations *Note: Exposure occurred in Miami Beach and overseas in an area with widespread transmission of Zika. paragraph break Current Number of Closed Investigations: 33 Miami-Dade County: 26 closed investigations Palm Beach County: 5 closed investigation Broward County: 1 closed investigation Pinellas: 1 closed investigation paragraph break Sampling Activities For Active Investigations Miami Beach in Miami-Dade County (Area of Active Transmission) Total # of Samples Collected Positive Negative Pending Results 1,064 72 992 0 paragraph break One-square mile area within NW 79th St. to the North, NW 63rd St. to the South, NW 10th Ave. to the West and N. Miami Ave. to the East in Miami-Dade County (Area of Active Transmission) Total # of Samples Collected Positive Negative Pending Results 112 8 99 5 paragraph break Palm Beach County – 1 Investigation Total # of Samples Collected Positive Negative Pending Results 0 0 0 0 paragraph break Miami-Dade Investigations Outside of Areas of Active Transmission– 6 Investigations Total # of Samples Collected Positive Negative Pending Results 30 0 30 0 paragraph break Wynwood Area in Miami-Dade County – Note: This investigation is closed, but the department is providing the sampling results below for reference. Total # of Samples Collected Positive Negative Pending Results 525 33 491 0 Data as of Oct. 26, 2016 - 3:57 PM ET
  14. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  15. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  16. October 26, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are four new travel associated cases with three in Broward County and one involving a pregnant woman. Please visit our website to see the full list of travel-related cases. There are nine non-travel associated cases all in Miami-Dade County residents: One is a case who had exposure in Wynwood with symptom onset in early August. The department just received confirmatory testing from CDC. This case does not impact the lifting of the Zika zone in Wynwood. One case had exposure in Miami Beach. One case had exposure in Little River. The other six had exposure in Miami-Dade County and the department is investigating where exposure occurred. Additionally, there is one case who had travel to an area outside of Florida with widespread Zika transmission as well as in Miami, which makes it impossible to determine exactly where exposure occurred. This case is being added to the undetermined category. DOH continues door-to-door outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the identified areas in Miami-Dade County. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 758 Non-Travel Related Infections of Zika 180 Infections Involving Pregnant Women 115 Out of State Cases (not Florida Residents) 19 Undetermined 6 Total 1,078 The timelines below are as of Oct. 21 and will be updated every Friday. Note: Asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 12 active investigations. The department has closed 33 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 9,567 people statewide. Florida currently has the capacity to test 8,384 people for active Zika virus and 6,470 for Zika antibodies. At Governor Scott’s direction, all county health departments offer free Zika risk assessment and testing to pregnant women. Florida’s small case clusters is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted areas in Miami-Dade County (see maps below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 115. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted more than 6,884 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. click image above to enlarge click image above to enlarge About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  17. October 26, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are four new travel associated cases with three in Broward County and one involving a pregnant woman. Please visit our website to see the full list of travel-related cases. There are nine non-travel associated cases all in Miami-Dade County residents: One is a case who had exposure in Wynwood with symptom onset in early August. The department just received confirmatory testing from CDC. This case does not impact the lifting of the Zika zone in Wynwood. One case had exposure in Miami Beach. One case had exposure in Little River. The other six had exposure in Miami-Dade County and the department is investigating where exposure occurred. Additionally, there is one case who had travel to an area outside of Florida with widespread Zika transmission as well as in Miami, which makes it impossible to determine exactly where exposure occurred. This case is being added to the undetermined category. DOH continues door-to-door outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the identified areas in Miami-Dade County. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 758 Non-Travel Related Infections of Zika 180 Infections Involving Pregnant Women 115 Out of State Cases (not Florida Residents) 19 Undetermined 6 Total 1,078 The timelines below are as of Oct. 21 and will be updated every Friday. Note: Asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 12 active investigations. The department has closed 33 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 9,567 people statewide. Florida currently has the capacity to test 8,384 people for active Zika virus and 6,470 for Zika antibodies. At Governor Scott’s direction, all county health departments offer free Zika risk assessment and testing to pregnant women. Florida’s small case clusters is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted areas in Miami-Dade County (see maps below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 115. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted more than 6,884 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. click image above to enlarge click image above to enlarge About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  18. There are nine non-travel associated cases all in Miami-Dade County residents: One is a case who had exposure in Wynwood with symptom onset in early August. The department just received confirmatory testing from CDC. This case does not impact the lifting of the Zika zone in Wynwood. One case had exposure in Miami Beach. One case had exposure in Little River. The other six had exposure in Miami-Dade County and the department is investigating where exposure occurred. Additionally, there is one case who had travel to an area outside of Florida with widespread Zika transmission as well as in Miami, which makes it impossible to determine exactly where exposure occurred. This case is being added to the undetermined category.
  19. There are four new travel associated cases with three in Broward County and one involving a pregnant woman. Please visit our website to see the full list of travel-related cases. There are nine non-travel associated cases all in Miami-Dade County residents: One is a case who had exposure in Wynwood with symptom onset in early August. The department just received confirmatory testing from CDC. This case does not impact the lifting of the Zika zone in Wynwood. One case had exposure in Miami Beach. One case had exposure in Little River. The other six had exposure in Miami-Dade County and the department is investigating where exposure occurred. Additionally, there is one case who had travel to an area outside of Florida with widespread Zika transmission as well as in Miami, which makes it impossible to determine exactly where exposure occurred. This case is being added to the undetermined category.
  20. Infection Type Infection Count Travel-Related Infections of Zika 758 Non-Travel Related Infections of Zika 180 Infections Involving Pregnant Women 115 Out of State Cases (not Florida Residents) 19 Undetermined 6 Total 1,078 http://www.floridahealth.gov/newsroom/2016/10/102616-zika-update.html
  21. http://www.floridahealth.gov/newsroom/2016/10/102616-zika-update.html Infection Type Infection Count Travel-Related Infections of Zika 758 Non-Travel Related Infections of Zika 180 Infections Involving Pregnant Women 115 Out of State Cases (not Florida Residents) 19 Undetermined 6 Total 1,078
  22. TABLE I. Provisional cases of selected* infrequently reported notifiable diseases (<1,000 cases reported during the preceding year), United States, week ending October 22, 2016 (WEEK 42)† Disease Total cases reported for previous years Current week Cum 2016 5-year weekly average§ 2015 2014 2013 2012 2011 States reporting cases during current week (No.42) Anthrax - - - - - - - 1 Arboviral diseases ¶,**: Chikungunya virus †† - 113 2 896 NN NN NN NN Eastern equine encephalitis virus - 2 0 6 8 8 15 4 Jamestown Canyon virus §§ - 2 0 11 11 22 2 3 La Crosse virus §§ - 23 0 55 80 85 78 130 Powassan virus - 6 0 7 8 12 7 16 St. Louis encephalitis virus - 6 0 23 10 1 3 6 Western equine encephalitis virus - - - - - - - - Botulism, total 1 135 4 195 161 152 168 153 foodborne - 30 0 37 15 4 27 24 infant 1 87 3 138 127 136 123 97 WA (1 ) other(wound & unspecified) - 18 1 20 19 12 18 32 Brucellosis 1 93 2 126 92 99 114 79 TX (1 ) Chancroid - 11 0 11 - - 15 8 Cholera - 2 0 2 5 14 17 40 Cyclosporiasis ** 1 411 3 645 388 784 123 151 NYC (1 ) Diphtheria - - - - 1 - 1 - Haemophilus influenzae, invasive disease (age <5 yrs) ¶¶: serotype b - 16 1 29 40 31 30 14 nontypeable serotype - 112 3 175 128 141 115 93 other serotype 2 101 2 135 266 233 263 230 OH (1 ), NE (1 ) unknown serotype 2 152 3 167 39 34 37 48 OH (1 ), VA (1 ) Hansen's disease ** - 34 2 89 88 81 82 82 Hantavirus Infections **: Hantavirus infection (non-HPS) †† - 3 0 1 NN NN NN NN Hantavirus pulmonary syndrome (HPS) - 11 0 17 32 21 30 23 Hemolytic uremic syndrome, post-diarrheal ** 6 184 7 274 250 329 274 290 OK (5 ), CA (1 ) Hepatitis B, virus infection perinatal 1 18 1 37 47 48 40 NP PA (1 ) Influenza-associated pediatric mortality **, *** - 79 0 130 141 160 52 118 Leptospirosis ** 1 36 1 40 38 NN NN NN NYC (1 ) Listeriosis 6 512 18 766 769 735 727 870 NY (1 ), OH (1 ), FL (3 ), AR (1 ) Measles ††† - 59 1 188 667 187 55 220 Meningococcal disease, invasive §§§: serogroup ACWY - 73 2 120 123 142 161 257 serogroup B - 53 2 111 89 99 110 159 other serogroup - 13 0 21 25 17 20 20 unknown serogroup 2 142 4 120 196 298 260 323 TN (1 ), OR (1 ) Novel influenza A virus infections ¶¶¶ - 21 0 6 3 21 313 14 Plague - - 0 13 10 4 4 3 Poliomyelitis, paralytic - - - - - 1 - - Polio virus infection, nonparalytic ** - - - - - - - - Psittacosis ** - 5 0 4 8 6 2 2 Q fever total **: 1 102 2 156 168 170 135 134 acute - 87 1 122 132 137 113 110 chronic 1 15 1 34 36 33 22 24 TX (1 ) Rabies, human - - 0 1 1 2 1 6 SARS CoV - - - - - - - - Smallpox - - - - - - - - Streptococcal toxic shock syndrome ** - 187 2 335 259 224 194 168 Syphilis, congenital **** - 344 8 491 458 348 322 360 Toxic shock syndrome (staphylococcal) ** 1 24 1 64 59 71 65 78 MO (1 ) Trichinellosis ** - 11 0 11 14 22 18 15 Tularemia 3 170 4 314 180 203 149 166 MO (2 ), WY (1 ) Typhoid fever 1 243 5 367 349 338 354 390 FL (1 ) Vancomycin-intermediate Staphylococcus aureus** - 82 4 183 212 248 134 82 Vancomycin-resistant Staphylococcus aureus ** - - - 1 - - 2 - Viral hemorrhagic Fevers ††††: Crimean-Congo hemorrhagic fever - - - - NP NP NP NP Ebola hemorrhagic fever - - - - 4 NP NP NP Guanarito hemorrhagic fever - - - - NP NP NP NP Junin hemorrhagic fever - - - - NP NP NP NP Lassa fever - - - - 1 NP NP NP Lujo virus - - - - NP NP NP NP Machupo hemorrhagic fever - - - - NP NP NP NP Marburg fever - - - - NP NP NP NP Sabia-associated hemorrhagic fever - - - - NP NP NP NP Yellow fever - - - - - - - - Zika ††,§§§§ Zika virus congenital infection NA NA NA NN NN NN NN NN Zika virus disease, non-congenital infection - 4,015 - NN NN NN NN NN [ Export This Table ] [ Next Part ] [ NNDSS Interactive Tables ] [ Mortality Interactive Tables ] -: No reported cases N: Not reportable. NA: Not Available NN: Not Nationally Notifiable. NP: Nationally notifiable but not published. Cum: Cumulative year-to-date counts. * Case counts for reporting year 2016 are provisional and subject to change. Data for years 2011 through 2014 are finalized. For further information on interpretation of these data, seehttp://wwwn.cdc.gov/nndss/document/ProvisionalNationaNotifiableDiseasesSurveillanceData20100927.pdf. National Notifiable Diseases Surveillance System (NNDSS) MMWR web application provided by CDC WONDER, http://wonder.cdc.gov
  23. Zika ††,§§§§ Zika virus congenital infection NA NA NA NN NN NN NN NN Zika virus disease, non-congenital infection - 4,015 - NN NN NN NN NN https://wonder.cdc.gov/mmwr/mmwr_2016_38.asp?mmwr_year=2016&mmwr_week=42&mmwr_table=1&request=Submit&mmwr_location=
  24. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  25. County Cases Angelina 1 Bell 6 Bexar 17 Brazoria 1 Brazos 3 Burnet 1 Cameron 3 Collin 5 Dallas 40 Denton 9 El Paso 3 Ellis 1 Fort Bend 9 Frio 1 Galveston 7 Gray 1 Grayson 1 Gregg 1 Hamilton 1 Harris 64 Jackson 1 Jefferson 2 Jones 1 Lee 1 Lubbock 1 Matagorda 1 Medina 1 Midland 1 Montgomery 1 Palo Pinto 1 Parker 1 Randall 1 Rusk 1 Tarrant 23 Travis 10 Upshur 1 Val Verde 1 Walker 1 Williamson 5 Webb 3 Wise 1 Total 234 Dallas Pregnant Registry 18 Texas Preg Reg excl Dallas 46 Total 298
×
×
  • Create New...