Jump to content

niman

Super Administrators
  • Posts

    74,774
  • Joined

  • Last visited

  • Days Won

    31

Everything posted by niman

  1. Infection Type Infection Count Travel-Related Infections of Zika 771 Non-Travel Related Infections of Zika 183 Infections Involving Pregnant Women 124 Out of State Cases (not Florida Residents) 19 Undetermined 6 Total 1,103 http://www.floridahealth.gov/newsroom/2016/10/103116-zika-update.html
  2. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  3. Allegheny County Residents Approved for Zika Testing: 221 CDC Confirmed Cases: 11 Probable Cases: 1 (as of October 31, 2016)
  4. Pennsylvania Blood Tests Submitted for Zika TestingInformation updated Mondays at 2 p.m. Confirmed Infections: 127* Probable Cases: 38* *DOH adopted a new definition for Zika virus infections on 9/26/2016. The case counts have increased because the Centers for Disease Control and Prevention’s new definition includesprobable Zika infections. The new infection definition has been applied to all previous Zika tests in Pennsylvania. For greater detail on this new definition, click here. Last update: 10/31/2016 http://www.health.pa.gov/My Health/Diseases and Conditions/U-Z/Zikavirus/Pages/ZikaVirusHomePage.aspx#.WBemL-ArKqZ
  5. Pennsylvania Blood Tests Submitted for Zika TestingInformation updated Mondays at 2 p.m. Confirmed Infections: 127* Probable Cases: 38* *DOH adopted a new definition for Zika virus infections on 9/26/2016. The case counts have increased because the Centers for Disease Control and Prevention’s new definition includesprobable Zika infections. The new infection definition has been applied to all previous Zika tests in Pennsylvania. For greater detail on this new definition, click here. Last update: 10/31/2016
  6. Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq dbj|LC191864.1| Zika virus genomic RNA, complete genome, strain: ZIKV/Hu/Chiba/S36/2016 18969 18969 100% 0.0 100% LC191864.1 Select seq gb|KX806557.2| Zika virus isolate TS17-2016, complete genome 18759 18759 100% 0.0 99% KX806557.2 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 18737 18737 100% 0.0 99% KX447516.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 18737 18737 100% 0.0 99% KX447515.1 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 18737 18737 100% 0.0 99% KX447509.1 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 18731 18731 100% 0.0 99% KJ776791.2 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 18731 18731 100% 0.0 99% KX447512.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 18731 18731 100% 0.0 99% KX369547.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 18720 18720 100% 0.0 99% KX447514.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 18720 18720 100% 0.0 99% KX447513.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 18715 18715 100% 0.0 99% KX447511.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 18709 18709 100% 0.0 99% KX447510.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 18692 18692 100% 0.0 99% KX185891.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 18692 18692 100% 0.0 99% KX117076.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 18692 18692 100% 0.0 99% KU963796.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 18687 18687 100% 0.0 99% KX447517.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 18687 18687 100% 0.0 99% KX253996.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 18687 18687 100% 0.0 99% KU955589.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 18687 18687 100% 0.0 99% KU820899.2 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 18683 18683 100% 0.0 99% KX266255.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 18681 18681 100% 0.0 99% KU866423.2 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 18676 18676 100% 0.0 99% KU509998.3 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 18654 18654 100% 0.0 99% KX280026.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 18654 18654 100% 0.0 99% KX051563.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 18648 18648 100% 0.0 99% KX197205.1 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 18648 18648 100% 0.0 99% KU991811.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 18648 18648 100% 0.0 99% KU321639.1 Select seq gb|KX811222.1| Zika virus isolate Brazil_2015_MG, complete genome 18643 18643 100% 0.0 99% KX811222.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 18637 18637 100% 0.0 99% KU729218.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 18637 18637 100% 0.0 99% KU707826.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 18637 18637 100% 0.0 99% KU365779.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 18631 18631 100% 0.0 99% KX262887.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 18631 18631 100% 0.0 99% KX197192.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 18626 18626 100% 0.0 99% KU940228.1 Select seq gb|KX879604.1| Zika virus isolate SN089, complete genome 18620 18620 100% 0.0 99% KX879604.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 18620 18620 100% 0.0 99% KX694534.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 18620 18620 100% 0.0 99% KX198135.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 18620 18620 100% 0.0 99% KU926309.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 18620 18620 100% 0.0 99% KU501217.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 18620 18620 100% 0.0 99% KU365780.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 18617 18617 99% 0.0 99% KU497555.1 Select seq gb|KY014303.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0127-SER polyprotein gene, complete cds 18615 18615 100% 0.0 99% KY014303.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 18615 18615 100% 0.0 99% KX156774.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 18615 18615 100% 0.0 99% KU647676.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 18615 18615 100% 0.0 99% KU501216.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 18615 18615 100% 0.0 99% KU365777.1 Select seq gb|KX879603.1| Zika virus isolate SN062, complete genome 18609 18609 100% 0.0 99% KX879603.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 18609 18609 100% 0.0 99% KU758877.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 18609 18609 100% 0.0 99% KX247646.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 18609 18609 100% 0.0 99% KX156776.1 Select seq gb|KY014297.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-6864-URI polyprotein gene, complete cds 18607 18607 100% 0.0 99% KY014297.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 18604 18604 100% 0.0 99% KX520666.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 18604 18604 100% 0.0 99% KU729217.2 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 18604 18604 100% 0.0 99% KU527068.1 Select seq gb|KY014327.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME167-PLA polyprotein gene, complete cds 18600 18600 100% 0.0 99% KY014327.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 18598 18598 100% 0.0 99% KU820897.5 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 18598 18598 100% 0.0 99% KX247632.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 18598 18598 100% 0.0 99% KU937936.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 18598 18598 100% 0.0 99% KX156775.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 18598 18598 100% 0.0 99% KX087102.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 18598 18598 100% 0.0 99% KU365778.1 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 18598 18598 100% 0.0 99% KU312312.1 Select seq gb|KY014315.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME152-SER polyprotein gene, complete cds 18593 18593 100% 0.0 99% KY014315.1 Select seq gb|KY014304.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0180-SER polyprotein gene, complete cds 18593 18593 100% 0.0 99% KY014304.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 18593 18593 100% 0.0 99% KU922960.1 Select seq gb|KY014296.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI polyprotein gene, complete cds 18587 18587 100% 0.0 99% KY014296.1 Select seq gb|KX856011.1| Zika virus strain ZIKV/Aedes sp./MEX_I-44/2016, complete genome 18587 18587 100% 0.0 99% KX856011.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 18587 18587 100% 0.0 99% KX548902.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 18587 18587 100% 0.0 99% KX446951.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 18587 18587 100% 0.0 99% KU926310.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 18587 18587 100% 0.0 99% KU922923.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 18587 18587 100% 0.0 99% KU501215.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 18582 18582 100% 0.0 99% KX601168.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 18582 18582 100% 0.0 99% KX446950.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 18582 18582 100% 0.0 99% KX087101.2 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 18582 18582 100% 0.0 99% KU870645.1 Select seq gb|KX893855.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-2/2016, complete genome 18580 18580 100% 0.0 99% KX893855.1 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 18576 18576 100% 0.0 99% KX702400.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 18576 18576 100% 0.0 99% KX377337.1 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 18576 18576 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 18574 18574 100% 0.0 99% KU853012.1 Select seq gb|KY014300.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0208-SER polyprotein gene, complete cds 18571 18571 100% 0.0 99% KY014300.1 Select seq dbj|LC190723.1| Zika virus genomic RNA, complete genome, strain: ZIKV/Hu/Yokohama/1/2016 18571 18571 100% 0.0 99% LC190723.1 Select seq gb|KY014321.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0115-SER polyprotein gene, complete cds 18565 18565 100% 0.0 99% KY014321.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 18565 18565 100% 0.0 99% KU820898.1 Select seq gb|KY014295.1| Zika virus isolate Zika virus/H.sapiens-wt/USA/2016/FL-010-URI polyprotein gene, complete cds 18559 18559 100% 0.0 99% KY014295.1 Select seq gb|KX842449.2| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL010U polyprotein gene, complete cds 18559 18559 100% 0.0 99% KX842449.2 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 18559 18559 100% 0.0 99% KX056898.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 18559 18559 100% 0.0 99% KU955590.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 18556 18556 100% 0.0 99% KX766028.1 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 18554 18554 100% 0.0 99% KX766029.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 18554 18554 100% 0.0 99% KU740184.2 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 18554 18554 100% 0.0 99% KU761564.1 Select seq gb|KY014320.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ42D1-URI polyprotein gene, complete cds 18552 18552 100% 0.0 99% KY014320.1 Select seq gb|KX922707.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL039U polyprotein gene, complete cds 18548 18548 100% 0.0 99% KX922707.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 18548 18548 100% 0.0 99% KX673530.1 Select seq gb|KY014323.1| Zika virus isolate Zika virus/A.aegypti-wt/USA/2016/FL-02-MOS polyprotein gene, complete cds 18543 18543 100% 0.0 99% KY014323.1 Select seq gb|KY014314.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0436-SER polyprotein gene, complete cds 18543 18543 100% 0.0 99% KY014314.1 Select seq gb|KX922706.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL038U polyprotein gene, complete cds 18539 18539 100% 0.0 99% KX922706.1 Select seq gb|KY014317.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ28D1-URI polyprotein gene, complete cds 2233 2233 12% 0.0 99% KY014317.1
  7. Sun Oct 30, 2016 | 1:30am EDT Vietnam reports first microcephaly case likely linked to Zika - government agency By My Pham | HANOI Vietnam's health ministry on Sunday reported a microcephaly case that it says is likely to be the country's first linked to the mosquito-borne Zika virus. The case, a four-month old baby whose mother was diagnosed with Zika when she was pregnant, was found in the central province of Dak Lak. "This is a microcephaly case with a high probability of being related to the Zika virus and also the first such case in Vietnam," the General Department of Preventive Medicine, a department of the nation's health ministry, said in a statement posted on its official website. ADVERTISING inRead invented by Teads Vietnam so far has reported a total nine cases of Zika infection, with more cases expected to be confirmed in the next few days, the department's director Tran Dac Phu told Reuters on Sunday. If the microcephaly case is confirmed to be linked to Zika, Vietnam would become the second Southeast Asian country after Thailand to report such a case. Vietnam earlier this month raised the threat level for Zika and stepped up monitoring of pregnant women in the country after detecting more cases and amid growing outbreaks in the region. Zika infections in pregnant women have been shown to cause microcephaly - a severe birth defect in which the head and brain are undersized - as well as other brain abnormalities. The connection between Zika and microcephaly first came to light in Brazil, which has confirmed more than 1,800 cases of microcephaly. (Reporting by My Pham; Editing by Sam Holmes) http://www.reuters.com/article/us-health-zika-vietnam-idUSKCN12U032
  8. NOTICE: In case of small children with suspected early evidence relating to the first Zika virus in Vietnam30/10/2016 As information, immediately after receiving the report of the test results were positive for Zika virus's 1st case of children with small scratch marks in Krong Buk district, Dak Lak province, dated 10.17.2016, the Ministry of Health has organized an urgent meeting Office emergency response to epidemics (EOC) to consider and assess the disease situation by Zika virus. Then the Ministry of Health has raised the alert notification to the Zika virus diseases in response to the epidemic in the new situation. 10.18.2016 Next day, the delegation of the Ministry of Health has investigated field epidemiological factors, sample tests of young 2nd and people living or living close to the patient to carry take measures to determine the cause. 2nd test results dated 10/21/2016 continue to detect IgM antibodies Zika virus specific neutralizing antibodies and Zika virus in serum samples of the child and the child's mother as well as in serum samples of the housemates (father, grandmother, and sister he's adopted children), in other cases not at home living with negative test results. Through epidemiological investigation showed that the disease manifested only the mother has clinical disease at 3 months pregnant. Not detect the risk factors that can cause defects such as small head from the mother infection, toxic chemical exposure, cigarette smoking, alcohol addiction. After the test results 2nd, 26th / 10/2016 Ministry of Health in collaboration with the Office of the world Health organization (WHO) in Vietnam and relevant agencies organize online meetings with the WHO regional Office in Manila, Philippines and Office WHO Thailand to determine the cause of cases of children suffering minor head. Through the review process for clinical, epidemiological factors, test results and brain scans based on the experience of the WHO, as well as the identification of 02 cases of children suffering minor head by virus Zika in Thailand, the meeting came to the conclusion: this is the case of children with congenital malformations symptoms suffer minor head is more likely related facilities and Zika virus is also the first case in Vietnam. Currently, Zika virus was circulating in Vietnam, before the status symbol of the event started with a small child in connection with the Zika virus, the Ministry of Health recommends: - Women who are pregnant or plan to become pregnant should not go to the service when not really necessary. In the case to go to the affected areas, should learn carefully the information about the disease and the health care conditions, simultaneous application of preventive measures to avoid mosquito bites Zika virus infection such as use use mosquito repelling cream, wear long clothing and sleep, including daytime screen. - Pregnant women, especially in the first 3 months of pregnancy rash and at least one of the symptoms of fever, muscle pain / arthritis, conjunctivitis eye health facilities need to be examined, investment timely advice. - Pregnant women should not be too worried, perform regular antenatal care, while only periodically conduct tests to detect the virus Zika when suspected symptoms and counseling, the body designated medical offices. - All people actively involved in the campaign to kill mosquitoes, kill mosquito larva / larvae to prevent diseases caused by Zika virus, dengue 2nd under the Directive of the Minister of Health. Actively check the water container, remove the waste materials do not let mosquitoes to lay their eggs, breeding and development; initiative, actively carry out disease prevention measures under the guidance of the Ministry of Health. Detailed information, refer to the Website of the Department of Preventive Medicine: vncdc.gov.vn and MOH: moh.gov.vn . Department of Preventive Medicine, Ministry of Health
  9. NOTICE: In case of small children with suspected early evidence relating to the first Zika virus in Vietnam30/10/2016 As information, immediately after receiving the report of the test results were positive for Zika virus's 1st case of children with small scratch marks in Krong Buk district, Dak Lak province, dated 10.17.2016, the Ministry of Health has organized an urgent meeting Office emergency response to epidemics (EOC) to consider and assess the disease situation by Zika virus. Then the Ministry of Health has raised the alert notification to the Zika virus diseases in response to the epidemic in the new situation. http://vncdc.gov.vn/vi/tin-tuc-trong-nuoc/1028/thong-bao-truong-hop-tre-mac-chung-dau-nho-nghi-lien-quan-voi-vi-rut-zika-dau-tien-tai-viet-nam
  10. Zika Virus – October 28, 2016 Texas has had 237 reported cases of illness due to Zika virus. All the cases were associated with travel to an area where Zika is being spread. This count includes 14 pregnant women, two infants infected before birth, and two people who had sexual contact with travelers. Texas Zika Cases by County: County Cases Angelina 2 Bell 6 Bexar 17 Brazoria 1 Brazos 3 Burnet 1 Cameron 3 Collin 5 Dallas 40 Denton 9 El Paso 3 Ellis 1 Fort Bend 9 Frio 1 Galveston 8 Gray 1 Grayson 1 Gregg 1 Hamilton 1 Harris 65 Jackson 1 Jefferson 2 Jones 1 Lee 1 Lubbock 1 Matagorda 1 Medina 1 Midland 1 Montgomery 1 Palo Pinto 1 Parker 1 Randall 1 Rusk 1 Tarrant 23 Travis 10 Upshur 1 Val Verde 1 Walker 1 Williamson 5 Webb 3 Wise 1 Total 237 Note: Zika case data for Texas will be updated each weekday no later than 11 a.m.
  11. Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX806557.2| Zika virus isolate TS17-2016, complete genome 18354 18354 100% 0.0 99% KX806557.2 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 18336 18336 100% 0.0 99% KX447516.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 18336 18336 100% 0.0 99% KX447515.1 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 18336 18336 100% 0.0 99% KX447509.1 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 18330 18330 100% 0.0 99% KJ776791.2 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 18330 18330 100% 0.0 99% KX447512.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 18330 18330 100% 0.0 99% KX369547.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 18321 18321 100% 0.0 99% KX447514.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 18321 18321 100% 0.0 99% KX447513.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 18318 18318 100% 0.0 99% KX447511.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 18312 18312 100% 0.0 99% KX447510.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 18300 18300 100% 0.0 99% KX185891.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 18300 18300 100% 0.0 99% KX117076.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 18300 18300 100% 0.0 99% KU963796.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 18294 18294 100% 0.0 99% KX447517.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 18294 18294 100% 0.0 99% KX253996.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 18294 18294 100% 0.0 99% KU955589.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 18294 18294 100% 0.0 99% KU820899.2 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 18291 18291 100% 0.0 99% KX266255.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 18291 18291 100% 0.0 99% KU866423.2 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 18285 18285 100% 0.0 99% KU509998.3 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 18267 18267 100% 0.0 99% KX280026.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 18267 18267 100% 0.0 99% KX051563.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 18264 18264 100% 0.0 99% KX197205.1 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 18264 18264 100% 0.0 99% KU991811.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 18264 18264 100% 0.0 99% KU321639.1 Select seq gb|KX811222.1| Zika virus isolate Brazil_2015_MG, complete genome 18258 18258 100% 0.0 99% KX811222.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 18254 18254 100% 0.0 99% KU729218.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 18254 18254 100% 0.0 99% KU707826.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 18254 18254 100% 0.0 99% KU365779.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 18249 18249 100% 0.0 99% KX262887.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 18249 18249 100% 0.0 99% KX197192.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 18245 18245 100% 0.0 99% KU940228.1 Select seq gb|KX879604.1| Zika virus isolate SN089, complete genome 18240 18240 100% 0.0 99% KX879604.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 18240 18240 100% 0.0 99% KX694534.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 18240 18240 100% 0.0 99% KX198135.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 18240 18240 100% 0.0 99% KU926309.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 18240 18240 100% 0.0 99% KU501217.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 18240 18240 100% 0.0 99% KU365780.1 Select seq gb|KY014303.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0127-SER polyprotein gene, complete cds 18236 18236 100% 0.0 99% KY014303.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 18236 18236 100% 0.0 99% KX156774.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 18236 18236 99% 0.0 99% KU497555.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 18236 18236 100% 0.0 99% KU647676.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 18236 18236 100% 0.0 99% KU501216.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 18236 18236 100% 0.0 99% KU365777.1 Select seq gb|KY014297.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-6864-URI polyprotein gene, complete cds 18231 18231 100% 0.0 99% KY014297.1 Select seq gb|KX879603.1| Zika virus isolate SN062, complete genome 18231 18231 100% 0.0 99% KX879603.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 18231 18231 100% 0.0 99% KU758877.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 18231 18231 100% 0.0 99% KX247646.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 18231 18231 100% 0.0 99% KX156776.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 18227 18227 100% 0.0 99% KX520666.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 18227 18227 100% 0.0 99% KU729217.2 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 18227 18227 100% 0.0 99% KU527068.1 Select seq gb|KY014327.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME167-PLA polyprotein gene, complete cds 18224 18224 100% 0.0 99% KY014327.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 18222 18222 100% 0.0 99% KU820897.5 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 18222 18222 100% 0.0 99% KX247632.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 18222 18222 100% 0.0 99% KU937936.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 18222 18222 100% 0.0 99% KX156775.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 18222 18222 100% 0.0 99% KX087102.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 18222 18222 100% 0.0 99% KU365778.1 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 18222 18222 100% 0.0 99% KU312312.1 Select seq gb|KY014315.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME152-SER polyprotein gene, complete cds 18218 18218 100% 0.0 99% KY014315.1 Select seq gb|KY014304.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0180-SER polyprotein gene, complete cds 18218 18218 100% 0.0 99% KY014304.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 18218 18218 100% 0.0 99% KU922960.1 Select seq gb|KY014296.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI polyprotein gene, complete cds 18213 18213 100% 0.0 99% KY014296.1 Select seq gb|KX856011.1| Zika virus strain ZIKV/Aedes sp./MEX_I-44/2016, complete genome 18213 18213 100% 0.0 99% KX856011.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 18213 18213 100% 0.0 99% KX548902.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 18213 18213 100% 0.0 99% KX446951.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 18213 18213 100% 0.0 99% KU926310.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 18213 18213 100% 0.0 99% KU922923.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 18213 18213 100% 0.0 99% KU501215.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 18209 18209 100% 0.0 99% KX601168.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 18209 18209 100% 0.0 99% KX446950.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 18209 18209 100% 0.0 99% KX087101.2 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 18209 18209 100% 0.0 99% KU870645.1 Select seq gb|KX893855.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-2/2016, complete genome 18208 18208 100% 0.0 99% KX893855.1 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 18204 18204 100% 0.0 99% KX702400.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 18204 18204 100% 0.0 99% KX377337.1 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 18204 18204 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 18204 18204 100% 0.0 99% KU853012.1 Select seq gb|KY014300.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0208-SER polyprotein gene, complete cds 18200 18200 100% 0.0 99% KY014300.1 Select seq dbj|LC190723.1| Zika virus genomic RNA, complete genome, strain: ZIKV/Hu/Yokohama/1/2016 18200 18200 100% 0.0 99% LC190723.1 Select seq gb|KY014321.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0115-SER polyprotein gene, complete cds 18195 18195 100% 0.0 99% KY014321.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 18195 18195 100% 0.0 99% KU820898.1 Select seq gb|KY014295.1| Zika virus isolate Zika virus/H.sapiens-wt/USA/2016/FL-010-URI polyprotein gene, complete cds 18191 18191 100% 0.0 99% KY014295.1 Select seq gb|KX842449.2| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL010U polyprotein gene, complete cds 18191 18191 100% 0.0 99% KX842449.2 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 18191 18191 100% 0.0 99% KX056898.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 18191 18191 100% 0.0 99% KU955590.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 18188 18188 100% 0.0 99% KX766028.1 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 18186 18186 100% 0.0 99% KX766029.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 18186 18186 100% 0.0 99% KU740184.2 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 18186 18186 100% 0.0 99% KU761564.1 Select seq gb|KX922707.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL039U polyprotein gene, complete cds 18182 18182 100% 0.0 99% KX922707.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 18182 18182 100% 0.0 99% KX673530.1 Select seq gb|KY014320.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ42D1-URI polyprotein gene, complete cds 18179 18179 100% 0.0 99% KY014320.1 Select seq gb|KY014323.1| Zika virus isolate Zika virus/A.aegypti-wt/USA/2016/FL-02-MOS polyprotein gene, complete cds 18177 18177 100% 0.0 99% KY014323.1 Select seq gb|KY014314.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0436-SER polyprotein gene, complete cds 18177 18177 100% 0.0 99% KY014314.1 Select seq gb|KX922703.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL021U polyprotein gene, complete cds 18177 18177 100% 0.0 99% KX922703.1 Select seq gb|KX838905.2| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL02M polyprotein gene, complete cds 18177 18177 100% 0.0 99% KX838905.2 Select seq gb|KX832731.1| Zika virus isolate ZIKV/Homo_sapiens/USA//2016/Hu0015SA polyprotein gene, complete cds 18177 18177 100% 0.0 99% KX832731.1 Select seq gb|KX922706.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL038U polyprotein gene, complete cds 18175 18175 100% 0.0 99% KX922706.1 Select seq gb|KY014316.1| Zika virus isolate Zika virus/H.sapiens-wt/USA/2016/FL-039-URI polyprotein gene, complete cds 18173 18173 100% 0.0 99% KY014316.1 Select seq gb|KX922704.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL030U polyprotein gene, complete cds 18173 18173 100% 0.0 99% KX922704.1 Select seq gb|KY014322.1| Zika virus isolate Zika virus/A.aegypti-wt/USA/2016/FL-03-MOS polyprotein gene, complete cds 18168 18168 100% 0.0 99% KY014322.1 Select seq gb|KX838906.2| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL03M polyprotein gene, complete cds 18168 18168 100% 0.0 99% KX838906.2 Select seq gb|KX838904.2| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL01M polyprotein gene, complete cds 18168 18168 100% 0.0 99% KX838904.2 Select seq gb|KY014324.1| Zika virus isolate Zika virus/A.aegypti-wt/USA/2016/FL-01-MOS polyprotein gene, complete cds 18164 18164 100% 0.0 99% KY014324.1 Select seq gb|KX922705.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL032U polyprotein gene, complete cds 18157 18157 100% 0.0 99% KX922705.1 Select seq gb|KX922708.1| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL04M polyprotein gene, complete cds 18150 18150 100% 0.0 99% KX922708.1 Select seq gb|KU940224.1| Zika virus isolate Bahia09, partial genome 18150 18150 99% 0.0 99% KU940224.1 Select seq gb|KY014299.1| Zika virus isolate Zika virus/A.aegypti-wt/USA/2016/FL-04-MOS polyprotein gene, complete cds 18146 18146 100% 0.0 99% KY014299.1 Select seq gb|KY014317.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ28D1-URI polyprotein gene, complete cds 18143 18143 100% 0.0 99% KY014317.1 Select seq gb|KX827309.1| Zika virus isolate ZKA-16-291 polyprotein gene, complete cds 18069 18069 100% 0.0 99% KX827309.1 Select seq gb|KX813683.1| Zika virus isolate ZKA-16-097 polyprotein gene, complete cds 18056 18056 100% 0.0 99% KX813683.1 Select seq gb|KU744693.1| Zika virus isolate VE_Ganxian, complete genome 18038 18038 100% 0.0 99% KU744693.1 Select seq gb|KU681081.3| Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome 18002 18002 100% 0.0 99% KU681081.3 Select seq gb|KY014319.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME38-PLA polyprotein gene, complete cds 17901 17901 100% 0.0 98% KY014319.1 Select seq gb|KX694532.1| Zika virus strain ZIKV/Homo sapiens/THA/PLCal_ZV/2013, complete genome 17870 17870 100% 0.0 99% KX694532.1 Select seq gb|KU955593.1| Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome 17695 17695 100% 0.0 98% KU955593.1 Select seq gb|JN860885.1| Zika virus isolate FSS13025 polyprotein gene, partial cds 17694 17694 99% 0.0 98% JN860885.1 Select seq gb|KF993678.1| Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds 17643 17643 98% 0.0 99% KF993678.1 Select seq gb|EU545988.1| Zika virus polyprotein gene, complete cds 17540 17540 100% 0.0 98% EU545988.1 Select seq gb|KU681082.3| Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome 17383 17383 100% 0.0 98% KU681082.3 Select seq gb|KX601167.1| Zika virus strain ZIKV/Aedes sp./MYS/P6-740/1966, complete genome 16406 16406 100% 0.0 95% KX601167.1 Select seq gb|KX694533.1| Zika virus strain ZIKV/Aedes aegypti/MYS/P6-740/1966, complete genome 16397 16397 100% 0.0 95% KX694533.1 Select seq gb|HQ234499.1| Zika virus isolate P6-740 polyprotein gene, partial cds 16397 16397 99% 0.0 95% HQ234499.1 Select seq gb|KX377336.1| Zika virus strain P6-740, complete genome 16392 16392 100% 0.0 95% KX377336.1 Select seq gb|KX447518.1| Zika virus isolate 1_0117_PF polyprotein gene, partial cds 16157 16157 88% 0.0 99% KX447518.1 Select seq gb|KY014325.1| Zika virus isolate Zika virus/H.sapiens-wt/USA/2016/FL-030-URI polyprotein gene, complete cds 15573 17843 98% 0.0 99% KY014325.1 Select seq gb|KU955595.1| Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome 13268 13268 100% 0.0 89% KU955595.1 Select seq gb|KU955592.1| Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome 13259 13259 100% 0.0 89% KU955592.1 Select seq gb|KF383115.1| Zika virus strain ArB1362 polyprotein gene, complete cds 13257 13257 100% 0.0 89% KF383115.1 Select seq gb|DQ859059.1| Zika virus strain MR 766 polyprotein gene, complete cds 13252 13252 100% 0.0 89% DQ859059.1 Select seq gb|KX198134.1| Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome 13245 13733 100% 0.0 89% KX198134.1 Select seq gb|KF268949.1| Zika virus isolate ARB15076 polyprotein gene, complete cds 13243 13243 100% 0.0 89% KF268949.1 Select seq gb|KF268948.1| Zika virus isolate ARB13565 polyprotein gene, complete cds 13243 13243 100% 0.0 89% KF268948.1 Select seq gb|KX830960.1| Zika virus culture ATCC:VR-84 isolate MR776, complete genome 13241 13241 100% 0.0 89% KX830960.1 Select seq gb|KU955591.1| Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome 13241 13241 100% 0.0 89% KU955591.1 Select seq gb|KU720415.1| Zika virus strain MR 766 polyprotein gene, complete cds 13241 13241 100% 0.0 89% KU720415.1 Select seq gb|KF268950.1| Zika virus isolate ARB7701 polyprotein gene, complete cds 13236 13236 100% 0.0 89% KF268950.1 Select seq gb|HQ234498.1| Zika virus isolate MR_766 polyprotein gene, partial cds 13236 13236 99% 0.0 89% HQ234498.1 Select seq gb|KX377335.1| Zika virus strain MR-766, complete genome 13227 13227 100% 0.0 89% KX377335.1 Select seq gb|KF383119.1| Zika virus strain ArD158084 polyprotein gene, complete cds 13223 13223 100% 0.0 89% KF383119.1 Select seq dbj|LC002520.1| Zika virus genomic RNA, complete genome, strain: MR766-NIID 13218 13218 100% 0.0 89% LC002520.1 Select seq gb|KF383116.1| Zika virus strain ArD7117 polyprotein gene, complete cds 13216 13216 100% 0.0 89% KF383116.1 Select seq gb|HQ234501.1| Zika virus isolate ArD_41519 polyprotein gene, partial cds 13209 13209 99% 0.0 89% HQ234501.1 Select seq gb|KX601169.1| Zika virus strain ZIKV/Macaca mulatta/UGA/MR-766/1947, complete genome 13201 13201 100% 0.0 88% KX601169.1 Select seq gb|KU963573.1| Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds 13201 13201 100% 0.0 88% KU963573.1 Select seq gb|KU955594.1| Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome 13201 13201 100% 0.0 88% KU955594.1 Select seq gb|KX601166.1| Zika virus strain ZIKV/Aedes africanus/SEN/DakAr41524/1984, complete genome 13185 13185 100% 0.0 88% KX601166.1 Select seq gb|AY632535.2| Zika virus strain MR 766, complete genome 13160 13160 100% 0.0 88% AY632535.2 Select seq gb|KU963574.1| Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds 13140 13242 100% 0.0 88% KU963574.1 Select seq gb|HQ234500.1| Zika virus isolate IbH_30656 polyprotein gene, partial cds 13138 13138 99% 0.0 88% HQ234500.1 Select seq gb|KF383117.1| Zika virus strain ArD128000 polyprotein gene, complete cds 13133 13133 100% 0.0 88% KF383117.1 Select seq gb|KF383118.1| Zika virus strain ArD157995 polyprotein gene, complete cds 12895 12963 100% 0.0 88% KF383118.1 Select seq gb|KF383121.1| Zika virus strain ArD158095 polyprotein gene, partial cds 12825 12825 97% 0.0 88% KF383121.1 Select seq gb|KX447520.1| Zika virus isolate 1_0016_PF polyprotein gene, partial cds 11472 15783 86% 0.0 99% KX447520.1 Select seq gb|KY014310.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME42-SER polyprotein gene, complete cds 11254 17772 97% 0.0 99% KY014310.1 Select seq gb|KX576684.1| Zika virus vector pZIKV-ICD, complete sequence 10881 18268 100% 0.0 99% KX576684.1 Select seq gb|KF383120.1| Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence 10826 10826 97% 0.0 84% KF383120.1 Select seq gb|KX447519.1| Zika virus isolate 1_0199_PF polyprotein gene, partial cds 10002 16052 87% 0.0 99% KX447519.1 Select seq gb|KX447521.1| Zika virus isolate 1_0080_PF polyprotein gene, partial cds 9822 14957 81% 0.0 99% KX447521.1 Select seq gb|KX830961.1| Synthetic construct, complete sequence 9357 13248 100% 0.0 89% KX830961.1 Select seq gb|KY014307.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ49D1-PLA polyprotein gene, complete cds 9261 17902 98% 0.0 99% KY014307.1 Select seq gb|KY014301.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI polyprotein gene, complete cds 9256 17611 96% 0.0 99% KY014301.1 Select seq gb|KY014306.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME178-PLA polyprotein gene, complete cds 9227 17870 98% 0.0 99% KY014306.1 Select seq gb|KY014309.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ47D1-PLA polyprotein gene, partial cds 8745 17396 95% 0.0 99% KY014309.1 Select seq gb|KY014298.1| Zika virus isolate Zika virus/H.sapiens-wt/USA/2016/FL-032-URI polyprotein gene, complete cds 8662 17289 95% 0.0 99% KY014298.1 Select seq gb|KY014326.1| Zika virus isolate Zika virus/H.sapiens-wt/USA/2016/FL-038-URI polyprotein gene, complete cds 7631 15383 84% 0.0 99% KY014326.1 Select seq gb|KY014312.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME58-PLA polyprotein gene, complete cds 6408 17221 96% 0.0 98% KY014312.1 Select seq gb|KY014302.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0216-SER polyprotein gene, complete cds 5332 16443 93% 0.0 98% KY014302.1 Select seq gb|KU940227.1| Zika virus isolate Bahia08, partial genome 4998 14337 87% 0.0 95% KU940227.1 Select seq gb|KX212103.1| Zika virus isolate BRZIKV_AB_ES polyprotein gene, partial cds 4971 4971 27% 0.0 99% KX212103.1 Select seq gb|KU758875.1| Zika virus isolate 15042 polyprotein gene, partial cds 4946 4946 27% 0.0 99% KU758875.1 Select seq gb|KU758871.1| Zika virus isolate 17170 polyprotein gene, partial cds 4944 4944 27% 0.0 99% KU758871.1 Select seq gb|KU758870.1| Zika virus isolate 17160 polyprotein gene, partial cds 4937 4937 27% 0.0 99% KU758870.1 Select seq gb|KU758873.1| Zika virus isolate 18246 polyprotein gene, partial cds 4935 4935 27% 0.0 99% KU758873.1 Select seq gb|KU312314.1| Zika virus isolate Z1106031 polyprotein gene, partial cds 4935 4935 27% 0.0 99% KU312314.1 Select seq gb|KU758872.1| Zika virus isolate 01170 polyprotein gene, partial cds 4922 4922 27% 0.0 99% KU758872.1 Select seq gb|KU758876.1| Zika virus isolate 21068 polyprotein gene, partial cds 4911 4911 27% 0.0 99% KU758876.1 Select seq gb|KU312313.1| Zika virus isolate Z1106032 polyprotein gene, partial cds 4908 4908 27% 0.0 99% KU312313.1 Select seq gb|KU758869.1| Zika virus isolate 05211 polyprotein gene, partial cds 4901 4901 26% 0.0 99% KU758869.1 Select seq gb|KU758868.1| Zika virus isolate 27229 polyprotein gene, partial cds 4875 4875 26% 0.0 99% KU758868.1 Select seq gb|KU758874.1| Zika virus isolate 20114 polyprotein gene, partial cds 4870 4870 26% 0.0 99% KU758874.1 Select seq gb|KY014318.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0269-SER polyprotein gene, partial cds 4765 15573 90% 0.0 96% KY014318.1 Select seq gb|KU646828.1| Zika virus isolate Si322 polyprotein gene, partial cds 4596 4596 25% 0.0 99% KU646828.1 Select seq gb|KU646827.1| Zika virus isolate Si323 polyprotein gene, partial cds 4587 4587 25% 0.0 99% KU646827.1 Select seq gb|KY014311.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME50-PLA polyprotein gene, partial cds 4525 13806 76% 0.0 99% KY014311.1 Select seq gb|KY014305.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0076-SER polyprotein gene, complete cds 4471 14475 79% 0.0 99% KY014305.1 Select seq gb|KX101060.1| Zika virus isolate Bahia02, partial genome 4190 13234 75% 0.0 95% KX101060.1 Select seq gb|KY014308.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-5905-SER polyprotein gene, complete cds 3920 13137 71% 0.0 99% KY014308.1 Select seq gb|KY007221.1| Zika virus isolate BKK01 polyprotein gene, partial cds 3608 3608 20% 0.0 98% KY007221.1 Select seq gb|KU312315.1| Zika virus isolate Z1106027 polyprotein gene, partial cds 3398 3398 18% 0.0 99% KU312315.1 Select seq gb|KU740199.1| Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds 3202 3202 17% 0.0 99% KU740199.1 Select seq gb|KY003152.1| Zika virus isolate ZIKV/Homo sapiens/PHL/2016/ZK16-0128 envelope protein E gene, partial cds 3178 3178 18% 0.0 98% KY003152.1 Select seq gb|KX101066.1| Zika virus isolate Bahia01, partial genome 3074 13011 74% 0.0 99% KX101066.1 Select seq gb|DQ859064.1| Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds 2863 4186 95% 0.0 71% DQ859064.1 Select seq dbj|LC171327.1| Zika virus gene for polyprotein, partial cds, strain: ZIKV/Hu/Chiba/S36/2016 2727 2727 14% 0.0 100% LC171327.1 Select seq gb|KX380263.1| Zika virus isolate FS92-2016 envelope protein gene, partial cds 2709 2709 14% 0.0 99% KX380263.1 Select seq gb|KX216635.1| Zika virus isolate TS17-2016 envelope protein gene, partial cds 2700 2700 14% 0.0 99% KX216635.1 Select seq gb|KX216634.1| Zika virus isolate TS14-2016 envelope protein gene, partial cds 2700 2700 14% 0.0 99% KX216634.1 Select seq gb|KX216638.1| Zika virus isolate ESS23-2015 envelope protein gene, partial cds 2695 2695 14% 0.0 99% KX216638.1 Select seq gb|KX216637.1| Zika virus isolate GS29-2016 envelope protein gene, partial cds 2695 2695 14% 0.0 99% KX216637.1 Select seq gb|KX216633.1| Zika virus isolate VS51-2016 envelope protein gene, partial cds 2695 2695 14% 0.0 99% KX216633.1 Select seq gb|KX216632.1| Zika virus isolate SIS58-2015 envelope protein gene, partial cds 2695 2695 14% 0.0 99% KX216632.1 Select seq gb|KX216640.1| Zika virus isolate CKS63-2014 envelope protein gene, partial cds 2691 2691 14% 0.0 99% KX216640.1 Select seq gb|KX216636.1| Zika virus isolate SS27-2016 envelope protein gene, partial cds 2691 2691 14% 0.0 99% KX216636.1 Select seq gb|KX380262.1| Zika virus isolate MS10-2016 envelope protein gene, partial cds 2686 2686 14% 0.0 99% KX380262.1 Select seq gb|KJ634273.1| Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds 2686 2686 14% 0.0 99% KJ634273.1 Select seq gb|KX928077.1| Zika virus isolate HN16 polyprotein gene, partial cds 2673 2673 14% 0.0 99% KX928077.1 Select seq gb|KX216639.1| Zika virus isolate SS57-2016 envelope protein gene, partial cds 2673 2673 14% 0.0 99% KX216639.1 Select seq gb|KX101064.1| Zika virus isolate Bahia11, partial genome 2268 10718 65% 0.0 92% KX101064.1 Select seq gb|KX867786.1| Zika virus isolate D304 polyprotein gene, partial cds 2197 2197 12% 0.0 97% KX867786.1 Select seq gb|KU686218.1| Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds 2048 2048 11% 0.0 99% KU686218.1 Select seq gb|KU179098.1| Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds 2012 2012 11% 0.0 99% KU179098.1 Select seq gb|KU886298.1| Zika virus isolate MN NS5 gene, partial cds 1849 1849 10% 0.0 99% KU886298.1 Select seq gb|KX954122.1| Zika virus strain Zika virus/Homo sapiens/Yucatan/9190916/2016 nonstructural polyprotein gene, partial cds 1837 1837 10% 0.0 99% KX954122.1 Select seq gb|KX059014.1| Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds 1829 1829 9% 0.0 99% KX059014.1 Select seq gb|KX059013.1| Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds 1829 1829 9% 0.0 99% KX059013.1 Select seq gb|KX101061.1| Zika virus isolate Bahia03, partial genome 1828 13808 78% 0.0 99% KX101061.1 Select seq gb|KY014313.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-6696-SER polyprotein gene, partial cds 1777 13210 72% 0.0 99% KY014313.1 Select seq gb|KM078936.1| Zika virus strain CHI1410214 NS5 protein gene, partial cds 1743 1743 9% 0.0 99% KM078936.1 Select seq gb|KM078961.1| Zika virus strain CHI2612114 NS5 protein gene, partial cds 1739 1739 9% 0.0 99% KM078961.1 Select seq gb|KM078930.1| Zika virus strain CHI2283714 NS5 protein gene, partial cds 1737 1737 9% 0.0 99% KM078930.1 Select seq gb|KM078971.1| Zika virus strain CHI2613014 NS5 protein gene, partial cds 1736 1736 9% 0.0 99% KM078971.1 Select seq gb|KM078970.1| Zika virus strain CHI2490414 NS5 protein gene, partial cds 1736 1736 9% 0.0 99% KM078970.1 Select seq gb|KM078933.1| Zika virus strain CHI1058514 NS5 protein gene, partial cds 1736 1736 9% 0.0 99% KM078933.1 Select seq gb|KM078929.1| Zika virus strain CHI1805214 NS5 protein gene, partial cds 1734 1734 9% 0.0 99% KM078929.1 Select seq gb|KX377120.1| Zika virus isolate SP54-2016 nonstructural protein 5 gene, partial cds 1680 1680 9% 0.0 99% KX377120.1 Select seq gb|KX173841.1| Zika virus isolate 16Z11 envelope protein gene, partial cds 1649 1649 9% 0.0 99% KX173841.1 Select seq gb|KX173840.1| Zika virus isolate 16Z10 envelope protein gene, partial cds 1649 1649 9% 0.0 99% KX173840.1 Select seq gb|KJ873160.1| Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds 1593 1593 8% 0.0 99% KJ873160.1 Select seq gb|KX173843.1| Zika virus isolate 16Z62 envelope protein gene, partial cds 1517 1517 8% 0.0 99% KX173843.1 Select seq gb|KX173844.1| Zika virus isolate 16Z62 envelope protein gene, partial cds 1507 1507 8% 0.0 99% KX173844.1 Select seq gb|KJ873161.1| Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds 1411 1411 7% 0.0 99% KJ873161.1 Select seq gb|KM851039.1| Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds 1373 1373 7% 0.0 99% KM851039.1 Select seq gb|KM851038.1| Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds 1337 1337 7% 0.0 98% KM851038.1 Select seq gb|KU985087.1| Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds 1335 1335 7% 0.0 99% KU985087.1 Select seq gb|KU556802.1| Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds 1328 1328 7% 0.0 99% KU556802.1 Select seq gb|AF013415.1| Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds 1306 1306 10% 0.0 88% AF013415.1 Select seq gb|KU724096.1| Zika virus isolate 259249_2015_Panama NS5B gene, partial cds 1283 1283 7% 0.0 99% KU724096.1 Select seq gb|KT200609.1| Zika virus isolate BR/949/15 NS5 gene, partial cds 1227 1227 6% 0.0 99% KT200609.1 Select seq gb|KU232300.1| Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds 1222 1222 6% 0.0 99% KU232300.1 Select seq gb|KU232290.1| Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds 1213 1213 6% 0.0 99% KU232290.1 Select seq gb|KU232297.1| Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds 1211 1211 6% 0.0 99% KU232297.1 Select seq gb|KU232294.1| Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds 1202 1202 6% 0.0 99% KU232294.1 Select seq gb|KU232292.1| Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds 1200 1200 6% 0.0 99% KU232292.1 Select seq gb|KU232298.1| Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds 1196 1196 6% 0.0 99% KU232298.1 Select seq gb|KU232296.1| Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds 1193 1193 6% 0.0 99% KU232296.1 Select seq gb|KU232293.1| Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds 1193 1193 6% 0.0 99% KU232293.1
  12. LOCUS LC191864 10807 bp RNA linear VRL 27-OCT-2016 DEFINITION Zika virus genomic RNA, complete genome, strain: ZIKV/Hu/Chiba/S36/2016. ACCESSION LC191864 VERSION LC191864.1 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 AUTHORS Taira,M., Ogawa,T., Yamamoto,K., Nishijima,H., Hotta,C., Akita,M. and Tajima,S. TITLE The first complete genome sequence of Zika virus isolated from clinical case in Japan JOURNAL Unpublished REFERENCE 2 (bases 1 to 10807) AUTHORS Taira,M. and Ogawa,T. TITLE Direct Submission JOURNAL Submitted (19-OCT-2016) Contact:Masakatsu Taira Chiba Prefectural Institute of Public Health, Division of Virology; 666-2 Nitona-cho Chuo-ku, Chiba, Chiba 260-8715, Japan FEATURES Location/Qualifiers source 1..10807 /organism="Zika virus" /mol_type="genomic RNA" /strain="ZIKV/Hu/Chiba/S36/2016" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Japan:Chiba" /collection_date="2016-04-21" CDS 108..10379 /codon_start=1 /product="polyprotein" /protein_id="BAV89190.1" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTNVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNMTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDSAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPMLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSSAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYHNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRSMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 agttgttgat ctgtgtgagt cagactgcga cagttcgagt ttgaagcgaa agctagcaac 61 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa 121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga 181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca 241 ggatggtctt ggcgattcta gcctttttga gattcacggc aatcaagcca tcactgggtc 301 tcatcaatag atggggttca gtggggaaaa aagaggctat ggaaataata aagaagttca 361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag 421 gcgcagatac taatgtcgga attgttggcc tcctgctgac cacagctatg gcagcggagg 481 tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct ggggaggcca 541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac 601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag 661 atgacgtcga ttgttggtgc aacatgacgt caacttgggt tgtgtacgga acctgccatc 721 acaaaaaagg tgaagcacgg agatctagaa gagctgtgac gctcccctcc cattccacta 781 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcacttga 841 ttagagtcga aaattggata ttcaggaacc ctggcttcgc gttagcagca gctgccatcg 901 cttggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga 961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta 1021 tgtcaggtgg gacttgggtt gatgttgtct tggaacatgg aggttgtgtc accgtaatgg 1081 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg 1141 aggtaagatc ctactgctat gaggcatcaa tatcggacat ggcttcggac agccgctgcc 1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtc tgcaaaagaa 1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga 1321 cctgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc 1381 tggagtaccg gataatgctg tcagttcatg gctcccagca cagtgggatg atcgttaatg 1441 acacaggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa 1501 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag 1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggttcaca 1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac 1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg 1741 tcgtggttct agggagtcaa gaaggagcag tccacacggc ccttgctgga gctctggagg 1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa 1861 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca 1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga 1981 cagatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact ctgaccccag 2041 ttgggaggtt gataaccgct aaccctgtaa tcactgaaag cactgagaac tctaagatga 2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga 2161 agatcaccca ccactggcac aggagtggta gcaccattgg aaaagcattt gaagccactg 2221 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg 2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat 2341 cattgtttgg aggaatgtcc tggttctcac aaattctcat tggaacgttg ctgatgtggt 2401 tgggtctgaa cacaaagaac ggatctattt cccttatgtg cttggcctta gggggagtgt 2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga 2521 aggagacgag atgcggtaca ggggtgttcg tctacaacga cgttgaagcc tggagggaca 2581 ggtacaagta ccatcctgac tctccccgca gactggcagc agcagtcaag caagcctggg 2641 aagatggtat ctgtgggatc tcctctgttt caagaatgga aaacatcatg tggagatcag 2701 tggaagggga gctcaacgca atcctggaag agaatggagt tcaactgacg gtcgttgtgg 2761 gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct gtgaacgagc 2821 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt cagagcagca aagacaaata 2881 acagctttgt cgtggatggt gacacactga aggaatgccc actcaaacac agagcatgga 2941 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg 3001 tcagagaaga ttattcatta gagtgtgatt cagccgttat tggaacagct gttaagggaa 3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga 3121 ggctgaagag ggcccatctg atcgagatga aaacatgtga atggccaaag tcccacacat 3181 tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttta gctgggccac 3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg 3301 aagagcttga aattcggttt gaggaatgcc caggcaccaa ggtccacgtg gaggaaacat 3361 gtggaacaag aggaccatct ctgagatcaa ccactgcaag cggaagggtg atcgaggaat 3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttccg ggctaaagat ggctgttggt 3481 atggaatgga gataaggccc aggaaagaac cagaaagtaa cttagtaagg tcaatggtga 3541 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca 3601 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcaatgg 3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa 3721 ttttgatggg tgccaccttc gcggaaatga acactggagg agatgtagct catcttgcgc 3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc tttcatcttc agagctaatt 3841 ggacaccccg cgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct 3901 ccgccttgga aggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa 3961 tacgagcgat ggttgttcca cgcactgata acatcacctt ggcaatcctg gctgctctga 4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg 4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca 4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt 4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc 4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg 4321 ccgcggtcgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca 4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc 4441 ggctcgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc 4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag 4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggtg 4621 ctctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt 4681 acagagtgat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag 4741 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag 4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat 4861 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg 4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca 4981 ttggagcggt tgcgctggat tatccagcag gaacttcagg atctccaatc ctagacaagt 5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg agttatgtta 5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga 5161 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga 5221 gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact gtgatcttag 5281 ctccaaccag ggttgtcgct gctgaaatgg aggaagccct tagagggctt ccagtgcgtt 5341 atatgacaac agcagtcaat gttacccact ctggaacaga aatcgtcgac ttaatgtgcc 5401 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtata 5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcga 5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc 5581 gtgacgcatt tccggactcc aactcaccaa tcatggacac cgaagtggaa gtcccagaga 5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg 5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg 5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt 5821 gggactttgt cgtgacaact gacatttcag agatgggcgc caactttaaa gctgaccgtg 5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattctgg 5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga 6001 atcccaacaa acctggagat gagtatctgt atggaggcgg gtgcgcagag actgacgaag 6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc 6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca 6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg 6241 tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga agatggtgct 6301 ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag gtgtggacca 6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc 6421 acgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag 6481 tgatggaagc cttgggaaca ctgccaggac acatgacaga gagattccag gaagccattg 6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg 6601 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgc 6661 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg 6721 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg 6781 catgtgtcct cattgttgtg ttcctattgc tggtggtgct catacctgag ccagaaaagc 6841 aaagatctcc ccaggacaat caaatggcaa tcatcatcat ggtagcagta ggtcttctgg 6901 gcttgattac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc 6961 taatgggaag gagagaggag ggggcaacca taggattctc aatggatatt gacctgcggc 7021 cagcctcagc ttgggccatc tacgctgcct tgacaacttt cattacccca gccgtccaac 7081 atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg caagctggag 7141 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc 7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc 7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc 7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg 7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca 7441 tagcagtagc cgtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg 7501 gggccctgat cacagctgca acttccactt tgtgggaagg ctctcctaac aagtactgga 7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt 7621 ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag 7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct 7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca 7801 aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt 7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag 7921 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa 7981 aaggaggccc tggtcatgaa gaacccatgt tggtgcaaag ctatgggtgg aacatagtcc 8041 gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt 8101 gtgacatagg tgagtcatca tccagtcctg aagtggaaga agcacggacg ctcagagtcc 8161 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt 8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag 8281 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag 8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg 8401 acgggcccag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg 8461 ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga 8521 tccgcagcga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg 8581 cttaccatgg aagctatgag gcccccacac aagggtcagc gtcctctcta ataaacgggg 8641 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga 8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc 8761 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag 8821 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc aacaaggttc 8881 gtagcagtgc agcactaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg 8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga 9001 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg 9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc 9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag 9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc 9241 gcataccagg aggaaggatg tatgcagatg acactgctgg ctgggacacc cgcatcagca 9301 ggtttgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg cacagggctt 9361 tggcattggc cataatcaag tacacatacc ataacaaagt ggtgaaggtc cttagaccag 9421 ctgaaaaagg gaagacagtt atggacatta tttcgagaca agaccaaagg gggagcggac 9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggagta 9541 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag 9601 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag 9661 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg 9721 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact 9781 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt 9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag 9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc 9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg 10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat 10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc 10141 acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg ggaaaaaggg 10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca 10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag tacatggact 10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctggg gtgctgtaag 10381 caccaatctt agtgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc 10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg 10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca 10561 cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg 10621 ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt agaggagacc 10681 ccccggaaaa cgcaaaacag catattgacg ctgggaaaga ccagagactc catgagtttc 10741 caccacgctg gccgccaggc acagatcgcc gaatagcggc ggccggtgtg gggaaatcca 10801 tggtttc
  13. Chiba Prefectural Institute of Public Health has release full Zika sequence from Chiba ex-Oceana, Chiba/S36/2016.
  14. LOCUS LC191864 10807 bp RNA linear VRL 27-OCT-2016 DEFINITION Zika virus genomic RNA, complete genome, strain: ZIKV/Hu/Chiba/S36/2016. ACCESSION LC191864 VERSION LC191864.1 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 AUTHORS Taira,M., Ogawa,T., Yamamoto,K., Nishijima,H., Hotta,C., Akita,M. and Tajima,S. TITLE The first complete genome sequence of Zika virus isolated from clinical case in Japan JOURNAL Unpublished REFERENCE 2 (bases 1 to 10807) AUTHORS Taira,M. and Ogawa,T. TITLE Direct Submission JOURNAL Submitted (19-OCT-2016) Contact:Masakatsu Taira Chiba Prefectural Institute of Public Health, Division of Virology; 666-2 Nitona-cho Chuo-ku, Chiba, Chiba 260-8715, Japan FEATURES Location/Qualifiers source 1..10807 /organism="Zika virus" /mol_type="genomic RNA" /strain="ZIKV/Hu/Chiba/S36/2016" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Japan:Chiba" /collection_date="2016-04-21" CDS 108..10379 /codon_start=1 /product="polyprotein" /protein_id="BAV89190.1" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTNVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNMTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDSAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPMLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSSAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYHNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRSMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 agttgttgat ctgtgtgagt cagactgcga cagttcgagt ttgaagcgaa agctagcaac 61 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa 121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga 181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca 241 ggatggtctt ggcgattcta gcctttttga gattcacggc aatcaagcca tcactgggtc 301 tcatcaatag atggggttca gtggggaaaa aagaggctat ggaaataata aagaagttca 361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag 421 gcgcagatac taatgtcgga attgttggcc tcctgctgac cacagctatg gcagcggagg 481 tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct ggggaggcca 541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac 601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag 661 atgacgtcga ttgttggtgc aacatgacgt caacttgggt tgtgtacgga acctgccatc 721 acaaaaaagg tgaagcacgg agatctagaa gagctgtgac gctcccctcc cattccacta 781 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcacttga 841 ttagagtcga aaattggata ttcaggaacc ctggcttcgc gttagcagca gctgccatcg 901 cttggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga 961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta 1021 tgtcaggtgg gacttgggtt gatgttgtct tggaacatgg aggttgtgtc accgtaatgg 1081 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg 1141 aggtaagatc ctactgctat gaggcatcaa tatcggacat ggcttcggac agccgctgcc 1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtc tgcaaaagaa 1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga 1321 cctgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc 1381 tggagtaccg gataatgctg tcagttcatg gctcccagca cagtgggatg atcgttaatg 1441 acacaggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa 1501 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag 1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggttcaca 1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac 1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg 1741 tcgtggttct agggagtcaa gaaggagcag tccacacggc ccttgctgga gctctggagg 1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa 1861 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca 1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga 1981 cagatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact ctgaccccag 2041 ttgggaggtt gataaccgct aaccctgtaa tcactgaaag cactgagaac tctaagatga 2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga 2161 agatcaccca ccactggcac aggagtggta gcaccattgg aaaagcattt gaagccactg 2221 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg 2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat 2341 cattgtttgg aggaatgtcc tggttctcac aaattctcat tggaacgttg ctgatgtggt 2401 tgggtctgaa cacaaagaac ggatctattt cccttatgtg cttggcctta gggggagtgt 2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga 2521 aggagacgag atgcggtaca ggggtgttcg tctacaacga cgttgaagcc tggagggaca 2581 ggtacaagta ccatcctgac tctccccgca gactggcagc agcagtcaag caagcctggg 2641 aagatggtat ctgtgggatc tcctctgttt caagaatgga aaacatcatg tggagatcag 2701 tggaagggga gctcaacgca atcctggaag agaatggagt tcaactgacg gtcgttgtgg 2761 gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct gtgaacgagc 2821 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt cagagcagca aagacaaata 2881 acagctttgt cgtggatggt gacacactga aggaatgccc actcaaacac agagcatgga 2941 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg 3001 tcagagaaga ttattcatta gagtgtgatt cagccgttat tggaacagct gttaagggaa 3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga 3121 ggctgaagag ggcccatctg atcgagatga aaacatgtga atggccaaag tcccacacat 3181 tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttta gctgggccac 3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg 3301 aagagcttga aattcggttt gaggaatgcc caggcaccaa ggtccacgtg gaggaaacat 3361 gtggaacaag aggaccatct ctgagatcaa ccactgcaag cggaagggtg atcgaggaat 3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttccg ggctaaagat ggctgttggt 3481 atggaatgga gataaggccc aggaaagaac cagaaagtaa cttagtaagg tcaatggtga 3541 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca 3601 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcaatgg 3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa 3721 ttttgatggg tgccaccttc gcggaaatga acactggagg agatgtagct catcttgcgc 3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc tttcatcttc agagctaatt 3841 ggacaccccg cgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct 3901 ccgccttgga aggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa 3961 tacgagcgat ggttgttcca cgcactgata acatcacctt ggcaatcctg gctgctctga 4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg 4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca 4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt 4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc 4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg 4321 ccgcggtcgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca 4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc 4441 ggctcgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc 4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag 4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggtg 4621 ctctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt 4681 acagagtgat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag 4741 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag 4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat 4861 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg 4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca 4981 ttggagcggt tgcgctggat tatccagcag gaacttcagg atctccaatc ctagacaagt 5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg agttatgtta 5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga 5161 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga 5221 gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact gtgatcttag 5281 ctccaaccag ggttgtcgct gctgaaatgg aggaagccct tagagggctt ccagtgcgtt 5341 atatgacaac agcagtcaat gttacccact ctggaacaga aatcgtcgac ttaatgtgcc 5401 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtata 5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcga 5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc 5581 gtgacgcatt tccggactcc aactcaccaa tcatggacac cgaagtggaa gtcccagaga 5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg 5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg 5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt 5821 gggactttgt cgtgacaact gacatttcag agatgggcgc caactttaaa gctgaccgtg 5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattctgg 5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga 6001 atcccaacaa acctggagat gagtatctgt atggaggcgg gtgcgcagag actgacgaag 6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc 6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca 6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg 6241 tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga agatggtgct 6301 ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag gtgtggacca 6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc 6421 acgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag 6481 tgatggaagc cttgggaaca ctgccaggac acatgacaga gagattccag gaagccattg 6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg 6601 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgc 6661 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg 6721 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg 6781 catgtgtcct cattgttgtg ttcctattgc tggtggtgct catacctgag ccagaaaagc 6841 aaagatctcc ccaggacaat caaatggcaa tcatcatcat ggtagcagta ggtcttctgg 6901 gcttgattac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc 6961 taatgggaag gagagaggag ggggcaacca taggattctc aatggatatt gacctgcggc 7021 cagcctcagc ttgggccatc tacgctgcct tgacaacttt cattacccca gccgtccaac 7081 atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg caagctggag 7141 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc 7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc 7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc 7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg 7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca 7441 tagcagtagc cgtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg 7501 gggccctgat cacagctgca acttccactt tgtgggaagg ctctcctaac aagtactgga 7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt 7621 ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag 7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct 7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca 7801 aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt 7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag 7921 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa 7981 aaggaggccc tggtcatgaa gaacccatgt tggtgcaaag ctatgggtgg aacatagtcc 8041 gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt 8101 gtgacatagg tgagtcatca tccagtcctg aagtggaaga agcacggacg ctcagagtcc 8161 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt 8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag 8281 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag 8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg 8401 acgggcccag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg 8461 ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga 8521 tccgcagcga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg 8581 cttaccatgg aagctatgag gcccccacac aagggtcagc gtcctctcta ataaacgggg 8641 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga 8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc 8761 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag 8821 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc aacaaggttc 8881 gtagcagtgc agcactaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg 8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga 9001 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg 9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc 9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag 9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc 9241 gcataccagg aggaaggatg tatgcagatg acactgctgg ctgggacacc cgcatcagca 9301 ggtttgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg cacagggctt 9361 tggcattggc cataatcaag tacacatacc ataacaaagt ggtgaaggtc cttagaccag 9421 ctgaaaaagg gaagacagtt atggacatta tttcgagaca agaccaaagg gggagcggac 9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggagta 9541 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag 9601 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag 9661 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg 9721 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact 9781 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt 9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag 9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc 9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg 10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat 10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc 10141 acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg ggaaaaaggg 10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca 10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag tacatggact 10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctggg gtgctgtaag 10381 caccaatctt agtgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc 10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg 10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca 10561 cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg 10621 ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt agaggagacc 10681 ccccggaaaa cgcaaaacag catattgacg ctgggaaaga ccagagactc catgagtttc 10741 caccacgctg gccgccaggc acagatcgcc gaatagcggc ggccggtgtg gggaaatcca 10801 tggtttc
  15. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  16. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  17. October 28, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are four new travel associated cases with one in Broward, one in Charlotte, one in Clay and one involving a pregnant woman. Please visit our website to see the full list of travel-related cases. There is one new non-travel associated case today in Miami-Dade County. The department is investigating to determine where exposure occurred. DOH continues door-to-door outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the identified areas in Miami-Dade County. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 768 Non-Travel Related Infections of Zika 182 Infections Involving Pregnant Women 123 Out of State Cases (not Florida Residents) 19 Undetermined 6 Total 1,098 The timelines below are as of Oct. 28 and will be updated every Friday. Note: Asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 12 active investigations. The department has closed 33 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 9,670 people statewide. Florida currently has the capacity to test 8,133 people for active Zika virus and 6,368 for Zika antibodies. At Governor Scott’s direction, all county health departments offer free Zika risk assessment and testing to pregnant women. Florida’s small case clusters is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted areas in Miami-Dade County (see maps below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should test all pregnant women who lived in, traveled to or whose partner traveled to Miami-Dade County after Aug. 1, 2016. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 123. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted more than 6,929 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. click image above to enlarge click image above to enlarge About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  18. October 28, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are four new travel associated cases with one in Broward, one in Charlotte, one in Clay and one involving a pregnant woman. Please visit our website to see the full list of travel-related cases. There is one new non-travel associated case today in Miami-Dade County. The department is investigating to determine where exposure occurred. DOH continues door-to-door outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the identified areas in Miami-Dade County. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 768 Non-Travel Related Infections of Zika 182 Infections Involving Pregnant Women 123 Out of State Cases (not Florida Residents) 19 Undetermined 6 Total 1,098 The timelines below are as of Oct. 28 and will be updated every Friday. Note: Asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 12 active investigations. The department has closed 33 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 9,670 people statewide. Florida currently has the capacity to test 8,133 people for active Zika virus and 6,368 for Zika antibodies. At Governor Scott’s direction, all county health departments offer free Zika risk assessment and testing to pregnant women. Florida’s small case clusters is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted areas in Miami-Dade County (see maps below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should test all pregnant women who lived in, traveled to or whose partner traveled to Miami-Dade County after Aug. 1, 2016. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 123. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted more than 6,929 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. click image above to enlarge click image above to enlarge About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  19. There are four new travel associated cases with one in Broward, one in Charlotte, one in Clay and one involving a pregnant woman. Please visit our website to see the full list of travel-related cases. There is one new non-travel associated case today in Miami-Dade County. The department is investigating to determine where exposure occurred.
  20. There is one new non-travel associated case today in Miami-Dade County. The department is investigating to determine where exposure occurred.
  21. Infection Type Infection Count Travel-Related Infections of Zika 768 Non-Travel Related Infections of Zika 182 Infections Involving Pregnant Women 123 Out of State Cases (not Florida Residents) 19 Undetermined 6 Total 1,098 http://www.floridahealth.gov/newsroom/2016/10/102816-zika-update.html
  22. Infection Type Infection Count Travel-Related Infections of Zika 768 Non-Travel Related Infections of Zika 182 Infections Involving Pregnant Women 123 Out of State Cases (not Florida Residents) 19 Undetermined 6 Total 1,098 http://www.floridahealth.gov/newsroom/2016/10/102816-zika-update.html
  23. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  24. CDPH Weekly Update on Number of Zika Virus Infections in California October 28, 2016 The following table provides the number of travel-associated infections with Zika virus in California residents in 2015 and 2016. CDPH is following CDC testing guidelines. This table is updated every Friday. As of October 28, 2016, there have been 353 travel-associated Zika virus infections in California. • Total infections: 353 • New infections reported this week: 6 • Cumulative number of infections due to sexual transmission: 3 • Cumulative number of infections in pregnant women: 43a o Liveborn infants with birth defects: 2b o Pregnancy losses with birth defects: 0c Zika virus infections in California, 2015-2016d (as of October 28, 2016) County Travel-associated e Locally acquired f Alameda (City of Berkeley) 22g (2) 0 Contra Costa 16 0 Fresno 2 0 Humboldt 2 0 Kern 3 0 Kings 1 0 Lake 1 0 Los Angeles (City of Long Beach) 80h (6) 0 Marin 6 0 Merced 3 0 Monterey 4 0 Napa 3 0 Nevada 1 0 Orange 23 0 Riverside 10 0 Sacramento 6 0 San Bernardino 13 0 San Diego 62i 0 San Francisco 25 0 San Joaquin 6 0 San Luis Obispo 1 0 San Mateo 9 0 Santa Barbara 6 0 Santa Clara 22 0 Santa Cruz 2 0 Solano 2 0 Sonoma 6 0 Stanislaus 2 0 Tulare 3 0 Ventura 5 0 Yolo 4 0 Yuba 2 0 Total 353 0 a Local Health Departments and CDPH are monitoring all pregnant women and their infants b Includes microcephaly, calcium deposits in the brain indicating possible brain damage, excess fluid in the brain cavities and surrounding the brain, absent or poorly formed brain structures, abnormal eye development, or other problems resulting from damage to the brain that affects nerves, muscles and bones, such as clubfoot or inflexible joints. c Includes miscarriage, stillbirths, and terminations with evidence of the birth defects mentioned above d Total number includes laboratory-confirmed and probable infections as defined by the CSTE Position Statement e Persons exposed through travel to an affected area or contact with a traveler f Presumed local mosquito-borne transmission g Includes two residents of the City of Berkeley h Includes six residents of the City of Long Beach i Includes one non-resident https://www.cdph.ca.gov/HealthInfo/discond/Documents/TravelAssociatedCasesofZikaVirusinCA.pdf
×
×
  • Create New...