niman

Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KY075938.1| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL06M polyprotein gene, complete cds 18525 18525 100% 0.0 100% KY075938.1 Select seq gb|KY014295.1| Zika virus isolate Zika virus/H.sapiens-wt/USA/2016/FL-010-URI polyprotein gene, complete cds 18516 18516 100% 0.0 99% KY014295.1 Select seq gb|KX842449.2| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL010U polyprotein gene, complete cds 18516 18516 100% 0.0 99% KX842449.2 Select seq gb|KY014323.1| Zika virus isolate Zika virus/A.aegypti-wt/USA/2016/FL-02-MOS polyprotein gene, complete cds 18502 18502 100% 0.0 99% KY014323.1 Select seq gb|KX922703.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL021U polyprotein gene, complete cds 18502 18502 100% 0.0 99% KX922703.1 Select seq gb|KX838905.2| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL02M polyprotein gene, complete cds 18502 18502 100% 0.0 99% KX838905.2 Select seq gb|KX838904.2| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL01M polyprotein gene, complete cds 18502 18502 100% 0.0 99% KX838904.2 Select seq gb|KX832731.1| Zika virus isolate ZIKV/Homo_sapiens/USA//2016/Hu0015SA polyprotein gene, complete cds 18502 18502 100% 0.0 99% KX832731.1 Select seq gb|KX922706.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL038U polyprotein gene, complete cds 18500 18500 100% 0.0 99% KX922706.1 Select seq gb|KY014324.1| Zika virus isolate Zika virus/A.aegypti-wt/USA/2016/FL-01-MOS polyprotein gene, complete cds 18498 18498 100% 0.0 99% KY014324.1 Select seq gb|KX922704.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL030U polyprotein gene, complete cds 18498 18498 100% 0.0 99% KX922704.1 Select seq gb|KY075935.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL022U polyprotein gene, complete cds 18489 18489 100% 0.0 99% KY075935.1 Select seq gb|KY075936.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL036Se polyprotein gene, complete cds 18484 18484 100% 0.0 99% KY075936.1 Select seq gb|KY014304.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0180-SER polyprotein gene, complete cds 18453 18453 100% 0.0 99% KY014304.1 Select seq gb|KY014300.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0208-SER polyprotein gene, complete cds 18453 18453 100% 0.0 99% KY014300.1 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 18447 18447 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 18447 18447 100% 0.0 99% KU853012.1 Select seq dbj|LC190723.1| Zika virus genomic RNA, complete genome, strain: ZIKV/Hu/Yokohama/1/2016 18444 18444 100% 0.0 99% LC190723.1 Select seq gb|KY014321.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0115-SER polyprotein gene, complete cds 18438 18438 100% 0.0 99% KY014321.1 Select seq gb|KX922707.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL039U polyprotein gene, complete cds 18426 18426 100% 0.0 99% KX922707.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 18426 18426 100% 0.0 99% KX673530.1 Select seq gb|KY014322.1| Zika virus isolate Zika virus/A.aegypti-wt/USA/2016/FL-03-MOS polyprotein gene, complete cds 18420 18420 100% 0.0 99% KY014322.1 Select seq gb|KY014314.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0436-SER polyprotein gene, complete cds 18420 18420 100% 0.0 99% KY014314.1 Select seq gb|KX838906.2| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL03M polyprotein gene, complete cds 18420 18420 100% 0.0 99% KX838906.2 Select seq gb|KY075937.1| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL05M polyprotein gene, complete cds 18417 18417 100% 0.0 99% KY075937.1 Select seq gb|KY014316.1| Zika virus isolate Zika virus/H.sapiens-wt/USA/2016/FL-039-URI polyprotein gene, complete cds 18417 18417 100% 0.0 99% KY014316.1 Select seq gb|KX922705.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL032U polyprotein gene, complete cds 18410 18410 100% 0.0 99% KX922705.1 Select seq gb|KX922708.1| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL04M polyprotein gene, complete cds 18402 18402 100% 0.0 99% KX922708.1 Select seq gb|KY014299.1| Zika virus isolate Zika virus/A.aegypti-wt/USA/2016/FL-04-MOS polyprotein gene, complete cds 18399 18399 100% 0.0 99% KY014299.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 18357 18357 100% 0.0 99% KX447510.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 18354 18354 100% 0.0 99% KX280026.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 18348 18348 100% 0.0 99% KX447512.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 18348 18348 100% 0.0 99% KX369547.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 18348 18348 100% 0.0 99% KU509998.3 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 18345 18345 100% 0.0 99% KJ776791.2 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 18345 18345 100% 0.0 99% KX447509.1 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 18345 18345 100% 0.0 99% KU991811.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 18345 18345 100% 0.0 99% KU729217.2 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 18339 18339 100% 0.0 99% KX447513.1 Select seq gb|KR872956.1| Zika virus strain 17829 polyprotein gene, complete cds 18336 18336 100% 0.0 99% KR872956.1 Select seq gb|KX811222.1| Zika virus isolate Brazil_2015_MG, complete genome 18336 18336 100% 0.0 99% KX811222.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 18336 18336 100% 0.0 99% KX197205.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 18336 18336 100% 0.0 99% KX447515.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 18336 18336 100% 0.0 99% KX447511.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 18336 18336 100% 0.0 99% KU321639.1 Select seq gb|KX879604.1| Zika virus isolate SN089, complete genome 18330 18330 100% 0.0 99% KX879604.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 18330 18330 100% 0.0 99% KX447514.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 18330 18330 100% 0.0 99% KX051563.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 18327 18327 100% 0.0 99% KX447516.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 18327 18327 100% 0.0 99% KU729218.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 18327 18327 100% 0.0 99% KU707826.1 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 18327 18327 100% 0.0 99% KU527068.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 18327 18327 100% 0.0 99% KU365779.1 Select seq gb|KX879603.1| Zika virus isolate SN062, complete genome 18321 18321 100% 0.0 99% KX879603.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 18321 18321 100% 0.0 99% KX262887.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 18321 18321 100% 0.0 99% KX197192.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 18321 18321 100% 0.0 99% KU926310.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 18321 18321 100% 0.0 99% KU926309.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 18318 18318 100% 0.0 99% KU940228.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 18312 18312 100% 0.0 99% KX694534.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 18312 18312 100% 0.0 99% KX198135.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 18312 18312 100% 0.0 99% KU501217.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 18312 18312 100% 0.0 99% KU365780.1 Select seq gb|KY014303.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0127-SER polyprotein gene, complete cds 18309 18309 100% 0.0 99% KY014303.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 18309 18309 100% 0.0 99% KU647676.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 18309 18309 100% 0.0 99% KU501216.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 18309 18309 100% 0.0 99% KU365777.1 Select seq gb|KY014297.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-6864-URI polyprotein gene, complete cds 18303 18303 100% 0.0 99% KY014297.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 18303 18303 100% 0.0 99% KX447517.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 18303 18303 100% 0.0 99% KU758877.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 18303 18303 100% 0.0 99% KX247646.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 18303 18303 100% 0.0 99% KX156776.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 18300 18300 100% 0.0 99% KX520666.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 18300 18300 100% 0.0 99% KX156774.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 18300 18300 99% 0.0 99% KU497555.1 Select seq gb|KY014327.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME167-PLA polyprotein gene, complete cds 18296 18296 100% 0.0 99% KY014327.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 18294 18294 100% 0.0 99% KU820897.5 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 18294 18294 100% 0.0 99% KX247632.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 18294 18294 100% 0.0 99% KX156775.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 18294 18294 100% 0.0 99% KX087102.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 18294 18294 100% 0.0 99% KU365778.1 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 18294 18294 100% 0.0 99% KU312312.1 Select seq gb|KY014315.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME152-SER polyprotein gene, complete cds 18291 18291 100% 0.0 99% KY014315.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 18291 18291 100% 0.0 99% KU922960.1 Select seq gb|KY075932.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL001Sa polyprotein gene, complete cds 18285 18285 100% 0.0 99% KY075932.1 Select seq gb|KY003153.1| Zika virus strain ZIKV/34997/Pavia/2016 polyprotein gene, complete cds 18285 18285 100% 0.0 99% KY003153.1 Select seq gb|KY014296.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI polyprotein gene, complete cds 18285 18285 100% 0.0 99% KY014296.1 Select seq gb|KX806557.2| Zika virus isolate TS17-2016, complete genome 18285 18285 100% 0.0 99% KX806557.2 Select seq gb|KX856011.1| Zika virus strain ZIKV/Aedes sp./MEX_I-44/2016, complete genome 18285 18285 100% 0.0 99% KX856011.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 18285 18285 100% 0.0 99% KX548902.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 18285 18285 100% 0.0 99% KX446951.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 18285 18285 100% 0.0 99% KU937936.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 18285 18285 100% 0.0 99% KU922923.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 18285 18285 100% 0.0 99% KU501215.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 18282 18282 100% 0.0 99% KX601168.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 18282 18282 100% 0.0 99% KX446950.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 18282 18282 100% 0.0 99% KX087101.2 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 18282 18282 100% 0.0 99% KU870645.1 Select seq gb|KX893855.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-2/2016, complete genome 18280 18280 100% 0.0 99% KX893855.1 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 18276 18276 100% 0.0 99% KX702400.1

LOCUS KY075938 10605 bp RNA linear VRL 04-NOV-2016 DEFINITION Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL06M polyprotein gene, complete cds. ACCESSION KY075938 VERSION KY075938.1 DBLINK BioProject: PRJNA342539 BioSample: SAMN05965486 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10605) AUTHORS Grubaugh,N., Paul,L., Porcelli,M., Vasquez,C., Gangavarupu,K., Oliveira,G., Robles-Sikisaka,R., Michael,S., Isern,S. and Andersen,K. TITLE Zika virus sequences from Florida, USA, 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10605) AUTHORS Grubaugh,N., Paul,L., Porcelli,M., Vasquez,C., Gangavarupu,K., Oliveira,G., Robles-Sikisaka,R., Michael,S., Isern,S. and Andersen,K. TITLE Direct Submission JOURNAL Submitted (02-NOV-2016) Department of Immunology and Microbial Science, The Scripps Research Institute, 10550 North Torrey Pines Road, IMM-210, La Jolla, CA 92037, USA COMMENT ##Assembly-Data-START## Assembly Method :: NovoAlign v. V3.04 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10605 /organism="Zika virus" /mol_type="genomic RNA" /isolate="ZIKV/Aedes_aegypti/USA/2016/FL06M" /isolation_source="pool of 23 adult mosquitoes" /host="Aedes aegypti" /db_xref="taxon:64320" /country="USA: Florida, Miami Beach" /collection_date="2016-09-20" /collected_by="Florida Gulf Coast University" CDS 80..10351 /codon_start=1 /product="polyprotein" /protein_id="APB03023.1" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSVVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLVNGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTIEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGEEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 gacagttcga gtttgaagcg aaagctagca acagtatcaa caggttttat tttggatttg 61 gaaacgagag tttctggtca tgaaaaaccc aaaaaagaaa tccggaggat tccggattgt 121 caatatgcta aaacgcggag tagcccgtgt gagccccttt gggggcttga agaggctgcc 181 agccggactt ctgctgggtc atgggcccat caggatggtc ttggcgattc tagccttttt 241 gagattcacg gcaatcaagc catcactggg tctcatcaat agatggggtt cagtggggaa 301 aaaagaggct atggaaataa taaagaagtt caagaaagat ctggctgcca tgctgagaat 361 aatcaatgct aggaaggaga agaagagacg aggcgcagat actagtgtcg gaattgttgg 421 cctcctgctg accacagcta tggcagcgga ggtcactaga cgtgggagtg catactacat 481 gtacttggac agaaacgatg ctggggaggc catatctttc ccaaccacat tggggatgaa 541 taagtgttat atacagatca tggatcttgg acacatgtgt gatgccacca tgagctatga 601 atgccctatg ctggatgagg gggtggaacc agatgacgtc gattgttggt gcaacacgac 661 gtcaacttgg gttgtgtacg gaacctgcca tcacaaaaaa ggtgaagcac ggagatctag 721 aagagctgtg acgctcccct cccattccac taggaagctg caaacgcggt cgcaaacctg 781 gttggaatca agagaataca caaagcactt gattagagtc gaaaattgga tattcaggaa 841 ccctggcttc gcgttagcag cagctgccat cgcttggctt ttgggaagct caacgagcca 901 aaaagttata tacttggtca tgatactgct gattgccccg gcatacagca tcaggtgcat 961 aggagtcagc aatagggact ttgtggaagg tatgtcaggt gggacttggg ttgatgttgt 1021 cttggaacat ggaggctgtg tcaccgtaat ggcacaggac aaaccgactg tcgacataga 1081 gctggttaca acaacagtca gcaacatggc ggaggtaaga tcctactgct atgaggcatc 1141 aatatcagac atggcttcgg acagccgctg cccaacacaa ggtgaagcct accttgacaa 1201 gcaatcagac actcaatatg tctgcaaaag aacgttagtg gacagaggct ggggaaatgg 1261 atgtggactt tttggcaaag ggagcctggt gacatgcgct aagtttgcat gctccaagaa 1321 aatgaccggg aagagcatcc agccagagaa tctggagtac cggataatgc tgtcagttca 1381 tggctcccag cacagtggga tgatcgttaa tgacacagga catgaaactg atgagaatag 1441 agcgaaggtt gagataacgc ccaattcacc aagagccgaa gccaccctgg ggggttttgg 1501 aagcctagga ctggattgtg aaccgaggac aggccttgac ttttcagatt tgtattactt 1561 gactatgaat aacaagcact ggttggttca caaggagtgg ttccacgaca ttccattacc 1621 ttggcacgct ggggcagaca ccggaactcc acactggaac aacaaagaag cactggtaga 1681 gttcaaggac gcacatgcca aaaggcaaac tgtcgtggtt ctagggagtc aagaaggagc 1741 agttcacacg gcccttgctg gagctctgga ggctgagatg gatggtgcaa agggaaggct 1801 gtcctctggc cacttgaaat gtcgcctgaa aatggataaa cttagattga agggcgtgtc 1861 atactccttg tgtaccgcag cgttcacatt caccaagatc ccggctgaaa cactgcacgg 1921 gacagtcaca gtggaggtac agtacgcagg gacagatgga ccttgcaagg ttccagctca 1981 gatggcggtg gacatgcaaa ctctgacccc agttgggagg ttgataaccg ccaaccccgt 2041 aatcactgaa agcactgaga actctaagat gatgctggaa cttgatccac catttgggga 2101 ctcttacatt gtcataggag tcggggagaa gaagatcacc caccactggc acaggagtgg 2161 cagcaccatt ggaaaagcat ttgaagccac tgtgagaggt gccaagagaa tggcagtctt 2221 gggagataca gcctgggact ttggatcagt tggaggcgct ctcaactcat tgggcaaggg 2281 catccatcaa atttttggag cagctttcaa atcattgttt ggaggaatgt cctggttctc 2341 acaaatcctc attggaacgt tgctgatgtg gttgggtctg aacacaaaga atggatctat 2401 ttccctcatg tgcttggcct tagggggagt gttgatcttc ttatccacag ccgtctctgc 2461 tgatgtgggg tgctcggtgg acttctcaaa gaaggagacg agatgcggta caggggtgtt 2521 cgtctataac gacgttgaag cctggaggga caggtacaag taccatcctg actccccccg 2581 tagattggca gcagcagtca agcaagcctg ggaagatggt atctgcggga tctcctctgt 2641 ttcaagaatg gaaaacatca tgtggagatc agtagaaggg gagctcaatg caatcctgga 2701 agagaatgga gttcaactga cggtcgttgt gggatctgta aaaaacccca tgtggagagg 2761 tccacagaga ttgcccgtgc ctgtgaacga gctgccccac ggctggaagg cttgggggaa 2821 atcgtacttc gttagagcag caaagacaaa taacagcttt gtcgtggatg gtgacacact 2881 gaaggaatgc ccactcaaac atagagcatg gaacagcttt cttgtggagg atcatgggtt 2941 cggggtattt cacactagtg tctggctcaa ggttagagaa gattattcat tagagtgtga 3001 tccagccgtt attggaacag ctgttaaggg aaaggaggct gtacacagtg atctaggcta 3061 ctggattgag agtgagaaga atgacacatg gaggctgaag agggcccatc tgatcgagat 3121 gaaaacatgt gaatggccaa agtcccacac attgtggaca gatggaatag aagagagtga 3181 tctgatcata cccaagtctt tagctgggcc actcagccat cacaatacca gagagggcta 3241 caggacccaa atgaaagggc catggcacag tgaagagctt gaaattcggt ttgaggaatg 3301 cccaggcact aaggtccacg tggaggaaac atgtggaaca agaggaccat ctctgagatc 3361 aaccactgca agcggaaggg tgatcgagga atggtgctgc agggagtgca caatgccccc 3421 actgtcgttc cgggctaaag atggctgttg gtatggaatg gagataaggc ccaggaaaga 3481 accagaaagc aacttagtaa ggtcagtggt gactgcagga tcaactgatc acatggatca 3541 cttctccctt ggagtgcttg tgattctgct catggtgcag gaagggctga agaagagaat 3601 gaccacaaag atcatcataa gcacatcaat ggcagtgctg gtagctatga tcctgggagg 3661 attttcaatg agtgacctgg ctaagcttgc aattttgatg ggtgccacct tcgcggaaat 3721 gaacactgga ggagatgtag ctcatctggc gctgatagcg gcattcaaag tcagaccagc 3781 gttgctggta tctttcatct tcagagctaa ttggacaccc cgtgaaagca tgctgctggc 3841 cttggcctcg tgtcttttgc aaactgcgat ctccgccttg gaaggcgacc tgatggttct 3901 catcaatggt tttgctttgg cctggttggc aatacgagcg atggttgttc cacgcactga 3961 taacatcacc ttggcaatcc tggctgctct gacaccactg gcccggggca cactgcttgt 4021 ggcgtggaga gcaggccttg ctacttgcgg ggggtttatg ctcctctctc tgaagggaaa 4081 aggcagtgtg aagaagaact taccatttgt catggccctg ggactaaccg ctgtgaggct 4141 ggtcgacccc atcaacgtgg tgggactgct gttgctcaca aggagtggga agcggagctg 4201 gccccctagc gaagtactca cagctgttgg cctgatatgc gcattggctg gagggttcgc 4261 caaggcagat atagagatgg ctgggcccat ggccgcggtc ggcctgctaa ttgtcagtta 4321 cgtggtctca ggaaagagtg tggacatgta cattgaaaga gcaggtgaca tcacatggga 4381 aaaagatgcg gaagtcactg gaaacagtcc ccggctcgat gtggcgctag atgagagtgg 4441 tgatttctcc ctggtggagg atgacggtcc ccccatgaga gagatcatac tcaaggtggt 4501 cctgatgacc atctgtggca tgaacccaat agccataccc tttgcagctg gagcgtggta 4561 cgtatacgtg aagactggaa aaaggagtgg tgctctatgg gatgtgcctg ctcccaagga 4621 agtaaaaaag ggggagacca cagatggagt gtacagagta atgactcgta gactgctagg 4681 ttcaacacaa gttggagtgg gagttatgca agagggggtc tttcacacta tgtggcacgt 4741 cacaaaagga tccgcgctga gaagcggtga agggagactt gatccatact ggggagatgt 4801 caagcaggat ctggtgtcat actgtggtcc atggaagcta gatgccgcct gggacgggca 4861 cagcgaggtg cagctcttgg ccgtgccccc cggagagaga gcgaggaaca tccagactct 4921 gcccggaata tttaagacaa aggatgggga cattggagcg gttgcgctgg attacccagc 4981 aggaacttca ggatctccaa tcctagacaa gtgtgggaga gtgataggac tttatggcaa 5041 tggggtcgtg atcaaaaatg ggagttatgt tagtgccatc acccaaggga ggagggagga 5101 agagactcct gttgagtgct tcgagccttc gatgctgaag aagaagcagc taactgtctt 5161 agacttgcat cctggagctg ggaaaaccag gagagttctt cctgaaatag tccgtgaagc 5221 tataaaaaca agactccgta ctgtgatctt agctccaacc agggttgtcg ctgctgaaat 5281 ggaggaagcc cttagagggc ttccagtgcg ttatatgaca acagcagtca atgtcaccca 5341 ttctggaaca gaaatcgtcg acttaatgtg ccatgccacc ttcacttcac gtctactaca 5401 gccaatcaga gtccccaact ataatctgta tattatggat gaggcccact tcacagatcc 5461 ctcaagtata gcagcaagag gatacatttc aacaagggtt gagatgggcg aggcggctgc 5521 catcttcatg accgccacgc caccaggaac ccgtgacgca tttccggact ccaactcacc 5581 aattatggac accgaagtgg aagtcccaga gagagcctgg agctcaggct ttgattgggt 5641 gacggatcat tctggaaaaa cagtttggtt tgttccaagc gtgaggaacg gcaatgagat 5701 cgcagcttgt ctgacaaagg ctggaaaacg ggtcatacag ctcagcagaa agacttttga 5761 gacagagttc cagaaaacaa aacatcaaga gtgggacttt gtcgtgacaa ccgacatttc 5821 agagatgggc gccaacttta aagctgaccg tgtcatagat tccaggagat gcctaaagcc 5881 ggtcatactt gatggcgaga gagtcattct ggctggaccc atgcctgtca cacatgccag 5941 cgctgcccag aggagggggc gcataggcag gaatcccaac aaacctggag atgagtatct 6001 gtatggaggt gggtgcgcag agactgacga agaccatgca cactggcttg aagcaagaat 6061 gctccttgac aatatttacc tccaagatgg cctcatagcc tcgctctatc gacctgaggc 6121 cgacaaagta gcagccattg agggagagtt caagcttagg acggagcaaa ggaagacctt 6181 tgtggaactc atgaaaagag gagatcttcc tgtttggctg gcctatcagg ttgcatctgc 6241 cggaataact tacacagata gaagatggtg ctttgatggc acgaccaaca acaccataat 6301 ggaagacagt gtgccggcag aggtgtggac cagacacgga gagaaaagag tgctcaaacc 6361 gaggtggatg gacgccagag tttgttcaga tcatgcggcc ctgaagtcat tcaaggagtt 6421 tgccgctggg aaaagaggag cggcttttgg agtgatggaa gccctgggaa cactgccagg 6481 acacatgaca gagagattcc aggaagccat tgacaacctc gctgtgctca tgcgggcaga 6541 gactggaagc aggccttaca aagccgcggc ggcccaattg ccggagaccc tagagaccat 6601 tatgcttttg gggttgctgg gaacagtctc gctgggaatc tttttcgtct tgatgaggaa 6661 caagggcata gggaagatgg gctttggaat ggtgactctt ggggccagcg catggctcat 6721 gtggctctcg gaaattgagc cagccagaat tgcatgtgtc ctcattgttg tgttcctatt 6781 gctggtggtg ctcatacctg agccagaaaa gcaaagatct ccccaggaca accaaatggc 6841 aatcatcatc atggtagcag taggtcttct aggcttgatc accgccaatg aactcggatg 6901 gttggagaga acaaagagtg acctaagcca tctaatggga aggagagagg agggagcaac 6961 cataggattc tcaatggaca ttgacctgcg gccagcctca gcttgggcca tctatgctgc 7021 cttgacaact ttcattaccc cagccgtcca acatgcagtg accacttcat acaacaacta 7081 ctccttaatg gcgatggcca cgcaagctgg agtgttgttt ggtatgggca aagggatgcc 7141 attctacgca tgggactttg gagtcccgct gctaatgata ggttgctact cacaattaac 7201 acccctgacc ctaatagtgg ccatcatttt gctcgtggcg cactacatgt acttgatccc 7261 agggctgcag gcagcagctg cgcgtgctgc ccagaagaga acggcagctg gcatcatgaa 7321 gaaccctgtt gtggatggaa tagtggtgac tgacattgac acaatgacaa ttgaccccca 7381 agtggagaaa aagatgggac aggtgctact catagcagta gccgtctcca gcgccatact 7441 gtcgcggacc gcctgggggt ggggggaggc tggggccctg atcacagccg caacttccac 7501 tttgtgggaa ggctctccga acaagtactg gaactcctct acagccactt cactgtgtaa 7561 catttttagg ggaagttact tggctggagc ttctctaatc tacacagtaa caagaaacgc 7621 tggcttggtc aagagacgtg ggggtggaac aggagagacc ctgggagaga aatggaaggc 7681 ccgcttgaac cagatgtcgg ccctggagtt ctactcctac aaaaagtcag gcatcaccga 7741 ggtgtgcaga gaagaggccc gccgcgccct caaggacggt gtggcaacgg gaggccatgc 7801 tgtgtcccga ggaagtgcaa agctgagatg gttggtggag cggggatacc tgcagcccta 7861 tggaaaggtc attgatcttg gatgtggcag agggggctgg agttactacg ccgccaccat 7921 ccgcaaagtt caagaagtga aaggatacac aaaaggaggc cctggtcatg aagaacccgt 7981 gttggtgcaa agctatgggt ggaacatagt ccgtctcaag agtggggtgg acgtctttca 8041 tatggcggct gagccgtgtg acacgttgct atgtgacata ggtgagtcat catctagtcc 8101 tgaagtggaa gaagcacgga cgctcagagt cctctccatg gtgggggatt ggcttgaaaa 8161 aagaccagga gccttttgta taaaagtgtt gtgcccatac accagcacta tgatggaaac 8221 cctggagcga ctgcagcgta ggtatggggg aggactggtc agagtgccac tctcccgcaa 8281 ctctacacat gagatgtact gggtctctgg agcgaaaagc aacaccataa aaagtgtgtc 8341 caccacgagc cagctcctct tggggcgcat ggacgggcct aggaggccag tgaaatatga 8401 ggaggatgtg aatctcggct ctggcacgcg ggctgtggta agctgcgctg aagctcccaa 8461 catgaagatc attggtaacc gcattgaaag gatccgcagt gagcacgcgg aaacgtggtt 8521 ctttgacgag aaccacccat ataggacatg ggcttaccat ggaagctatg aggcccccac 8581 acaagggtca gcatcctctc tagtaaacgg ggttgtcagg ctcctgtcaa aaccctggga 8641 tgtggtgact ggagtcacag gaatagccat gaccgacacc acaccgtatg gtcagcaaag 8701 agttttcaag gaaaaagtgg acactagggt gccagacccc caagaaggca ctcgtcaggt 8761 tatgagcatg gtctcttcct ggttgtggaa agagctaggt aaacacaaac ggccacgagt 8821 ctgtaccaaa gaagagttca tcaacaaggt tcgtagcaat gcagcattag gggcaatatt 8881 tgaagaggaa aaagagtgga agactgcagt ggaagctgtg aacgatccaa ggttctgggc 8941 tctagtggac aaggaaagag agcaccacct gagaggagag tgccagagtt gtgtgtacaa 9001 catgatggga aaaagagaaa agaaacaagg ggaatttgga aaggccaagg gcagccgcgc 9061 catctggtat atgtggctag gggctagatt tctagagttc gaagcccttg gattcttgaa 9121 cgaggatcac tggatgggga gagagaactc aggaggtggt gttgaagggc tgggattaca 9181 aagactcgga tatgtcctag aagagatgag tcgcatacca ggaggaagga tgtatgcaga 9241 tgacactgct ggctgggata cccgcatcag caggtttgat ctagagaatg aagctctaat 9301 caccaaccaa atggagaaag ggcacagggc cttggcattg gccataatca agtacacata 9361 ccaaaacaaa gtggtaaagg tccttagacc agctgaaaaa gggaaaacag ttatggacat 9421 tatttcgaga caagaccaaa gggggagcgg acaagttgtc acttacgctc ttaacacatt 9481 taccaaccta gtggtgcaac tcattcggaa tatggaggct gaggaagttc tagagatgca 9541 agacttgtgg ctgctgcgga ggtcagagaa agtgaccaac tggttgcaga gcaacggatg 9601 ggataggctc aaacgaatgg cagtcagtgg agatgattgc gttgtgaagc caattgatga 9661 taggtttgca catgccctca ggttcttgaa tgatatggga aaagttagga aggacacaca 9721 agagtggaaa ccctcaactg gatgggacaa ctgggaagaa gttccgtttt gctcccacca 9781 cttcaacaag ctccatctca aggacgggag gtccattgtg gttccctgcc gccaccaaga 9841 tgaactgatt ggccgggccc gcgtctctcc aggggcggga tggagcatcc gggagactgc 9901 ttgcctagca aaatcatatg cgcaaatgtg gcagctcctt tatttccaca gaagggacct 9961 ccgactgatg gccaatgcca tttgttcatc tgtgccagtt gactgggttc caactgggag 10021 aactacctgg tcaatccatg gaaagggaga atggatgacc attgaagaca tgcttgtggt 10081 gtggaacaga gtgtggattg aggagaacga ccacatggaa gacaagaccc cagttacgaa 10141 atggacagac attccctatt tgggaaaaag ggaagacttg tggtgtggat ctctcatagg 10201 gcacagaccg cgcaccacct gggctgagaa cattaaaaac acagtcaaca tggtgcgcag 10261 gatcataggt gaggaagaaa agtacatgga ctacctatcc acccaagtcc gctacttggg 10321 tgaagaaggg tctacacctg gagtgctgta agcaccaatc ttaatgttgt caggcctgct 10381 agtcagccac agcttgggga aagctgtgca gcctgtgacc cccccaggag aagctgggaa 10441 accaagccta tagtcaggcc gagaacgcca tggcacggaa gaagccatgc tgcctgtgag 10501 cccctcagag gacactgagt caaaaaaccc cacgcgcttg gaggcgcagg atgggaaaag 10561 aaggtggcga ccttccccac ccttcaatct ggggcctgaa ctgga

Scripps has release Zika mosquito pool 6, Aedes_aegypti/USA/2016/FL06M, sequence at Genbank.

LOCUS KY075938 10605 bp RNA linear VRL 04-NOV-2016 DEFINITION Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL06M polyprotein gene, complete cds. ACCESSION KY075938 VERSION KY075938.1 DBLINK BioProject: PRJNA342539 BioSample: SAMN05965486 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10605) AUTHORS Grubaugh,N., Paul,L., Porcelli,M., Vasquez,C., Gangavarupu,K., Oliveira,G., Robles-Sikisaka,R., Michael,S., Isern,S. and Andersen,K. TITLE Zika virus sequences from Florida, USA, 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10605) AUTHORS Grubaugh,N., Paul,L., Porcelli,M., Vasquez,C., Gangavarupu,K., Oliveira,G., Robles-Sikisaka,R., Michael,S., Isern,S. and Andersen,K. TITLE Direct Submission JOURNAL Submitted (02-NOV-2016) Department of Immunology and Microbial Science, The Scripps Research Institute, 10550 North Torrey Pines Road, IMM-210, La Jolla, CA 92037, USA COMMENT ##Assembly-Data-START## Assembly Method :: NovoAlign v. V3.04 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10605 /organism="Zika virus" /mol_type="genomic RNA" /isolate="ZIKV/Aedes_aegypti/USA/2016/FL06M" /isolation_source="pool of 23 adult mosquitoes" /host="Aedes aegypti" /db_xref="taxon:64320" /country="USA: Florida, Miami Beach" /collection_date="2016-09-20" /collected_by="Florida Gulf Coast University" CDS 80..10351 /codon_start=1 /product="polyprotein" /protein_id="APB03023.1" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSVVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLVNGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTIEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGEEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 gacagttcga gtttgaagcg aaagctagca acagtatcaa caggttttat tttggatttg 61 gaaacgagag tttctggtca tgaaaaaccc aaaaaagaaa tccggaggat tccggattgt 121 caatatgcta aaacgcggag tagcccgtgt gagccccttt gggggcttga agaggctgcc 181 agccggactt ctgctgggtc atgggcccat caggatggtc ttggcgattc tagccttttt 241 gagattcacg gcaatcaagc catcactggg tctcatcaat agatggggtt cagtggggaa 301 aaaagaggct atggaaataa taaagaagtt caagaaagat ctggctgcca tgctgagaat 361 aatcaatgct aggaaggaga agaagagacg aggcgcagat actagtgtcg gaattgttgg 421 cctcctgctg accacagcta tggcagcgga ggtcactaga cgtgggagtg catactacat 481 gtacttggac agaaacgatg ctggggaggc catatctttc ccaaccacat tggggatgaa 541 taagtgttat atacagatca tggatcttgg acacatgtgt gatgccacca tgagctatga 601 atgccctatg ctggatgagg gggtggaacc agatgacgtc gattgttggt gcaacacgac 661 gtcaacttgg gttgtgtacg gaacctgcca tcacaaaaaa ggtgaagcac ggagatctag 721 aagagctgtg acgctcccct cccattccac taggaagctg caaacgcggt cgcaaacctg 781 gttggaatca agagaataca caaagcactt gattagagtc gaaaattgga tattcaggaa 841 ccctggcttc gcgttagcag cagctgccat cgcttggctt ttgggaagct caacgagcca 901 aaaagttata tacttggtca tgatactgct gattgccccg gcatacagca tcaggtgcat 961 aggagtcagc aatagggact ttgtggaagg tatgtcaggt gggacttggg ttgatgttgt 1021 cttggaacat ggaggctgtg tcaccgtaat ggcacaggac aaaccgactg tcgacataga 1081 gctggttaca acaacagtca gcaacatggc ggaggtaaga tcctactgct atgaggcatc 1141 aatatcagac atggcttcgg acagccgctg cccaacacaa ggtgaagcct accttgacaa 1201 gcaatcagac actcaatatg tctgcaaaag aacgttagtg gacagaggct ggggaaatgg 1261 atgtggactt tttggcaaag ggagcctggt gacatgcgct aagtttgcat gctccaagaa 1321 aatgaccggg aagagcatcc agccagagaa tctggagtac cggataatgc tgtcagttca 1381 tggctcccag cacagtggga tgatcgttaa tgacacagga catgaaactg atgagaatag 1441 agcgaaggtt gagataacgc ccaattcacc aagagccgaa gccaccctgg ggggttttgg 1501 aagcctagga ctggattgtg aaccgaggac aggccttgac ttttcagatt tgtattactt 1561 gactatgaat aacaagcact ggttggttca caaggagtgg ttccacgaca ttccattacc 1621 ttggcacgct ggggcagaca ccggaactcc acactggaac aacaaagaag cactggtaga 1681 gttcaaggac gcacatgcca aaaggcaaac tgtcgtggtt ctagggagtc aagaaggagc 1741 agttcacacg gcccttgctg gagctctgga ggctgagatg gatggtgcaa agggaaggct 1801 gtcctctggc cacttgaaat gtcgcctgaa aatggataaa cttagattga agggcgtgtc 1861 atactccttg tgtaccgcag cgttcacatt caccaagatc ccggctgaaa cactgcacgg 1921 gacagtcaca gtggaggtac agtacgcagg gacagatgga ccttgcaagg ttccagctca 1981 gatggcggtg gacatgcaaa ctctgacccc agttgggagg ttgataaccg ccaaccccgt 2041 aatcactgaa agcactgaga actctaagat gatgctggaa cttgatccac catttgggga 2101 ctcttacatt gtcataggag tcggggagaa gaagatcacc caccactggc acaggagtgg 2161 cagcaccatt ggaaaagcat ttgaagccac tgtgagaggt gccaagagaa tggcagtctt 2221 gggagataca gcctgggact ttggatcagt tggaggcgct ctcaactcat tgggcaaggg 2281 catccatcaa atttttggag cagctttcaa atcattgttt ggaggaatgt cctggttctc 2341 acaaatcctc attggaacgt tgctgatgtg gttgggtctg aacacaaaga atggatctat 2401 ttccctcatg tgcttggcct tagggggagt gttgatcttc ttatccacag ccgtctctgc 2461 tgatgtgggg tgctcggtgg acttctcaaa gaaggagacg agatgcggta caggggtgtt 2521 cgtctataac gacgttgaag cctggaggga caggtacaag taccatcctg actccccccg 2581 tagattggca gcagcagtca agcaagcctg ggaagatggt atctgcggga tctcctctgt 2641 ttcaagaatg gaaaacatca tgtggagatc agtagaaggg gagctcaatg caatcctgga 2701 agagaatgga gttcaactga cggtcgttgt gggatctgta aaaaacccca tgtggagagg 2761 tccacagaga ttgcccgtgc ctgtgaacga gctgccccac ggctggaagg cttgggggaa 2821 atcgtacttc gttagagcag caaagacaaa taacagcttt gtcgtggatg gtgacacact 2881 gaaggaatgc ccactcaaac atagagcatg gaacagcttt cttgtggagg atcatgggtt 2941 cggggtattt cacactagtg tctggctcaa ggttagagaa gattattcat tagagtgtga 3001 tccagccgtt attggaacag ctgttaaggg aaaggaggct gtacacagtg atctaggcta 3061 ctggattgag agtgagaaga atgacacatg gaggctgaag agggcccatc tgatcgagat 3121 gaaaacatgt gaatggccaa agtcccacac attgtggaca gatggaatag aagagagtga 3181 tctgatcata cccaagtctt tagctgggcc actcagccat cacaatacca gagagggcta 3241 caggacccaa atgaaagggc catggcacag tgaagagctt gaaattcggt ttgaggaatg 3301 cccaggcact aaggtccacg tggaggaaac atgtggaaca agaggaccat ctctgagatc 3361 aaccactgca agcggaaggg tgatcgagga atggtgctgc agggagtgca caatgccccc 3421 actgtcgttc cgggctaaag atggctgttg gtatggaatg gagataaggc ccaggaaaga 3481 accagaaagc aacttagtaa ggtcagtggt gactgcagga tcaactgatc acatggatca 3541 cttctccctt ggagtgcttg tgattctgct catggtgcag gaagggctga agaagagaat 3601 gaccacaaag atcatcataa gcacatcaat ggcagtgctg gtagctatga tcctgggagg 3661 attttcaatg agtgacctgg ctaagcttgc aattttgatg ggtgccacct tcgcggaaat 3721 gaacactgga ggagatgtag ctcatctggc gctgatagcg gcattcaaag tcagaccagc 3781 gttgctggta tctttcatct tcagagctaa ttggacaccc cgtgaaagca tgctgctggc 3841 cttggcctcg tgtcttttgc aaactgcgat ctccgccttg gaaggcgacc tgatggttct 3901 catcaatggt tttgctttgg cctggttggc aatacgagcg atggttgttc cacgcactga 3961 taacatcacc ttggcaatcc tggctgctct gacaccactg gcccggggca cactgcttgt 4021 ggcgtggaga gcaggccttg ctacttgcgg ggggtttatg ctcctctctc tgaagggaaa 4081 aggcagtgtg aagaagaact taccatttgt catggccctg ggactaaccg ctgtgaggct 4141 ggtcgacccc atcaacgtgg tgggactgct gttgctcaca aggagtggga agcggagctg 4201 gccccctagc gaagtactca cagctgttgg cctgatatgc gcattggctg gagggttcgc 4261 caaggcagat atagagatgg ctgggcccat ggccgcggtc ggcctgctaa ttgtcagtta 4321 cgtggtctca ggaaagagtg tggacatgta cattgaaaga gcaggtgaca tcacatggga 4381 aaaagatgcg gaagtcactg gaaacagtcc ccggctcgat gtggcgctag atgagagtgg 4441 tgatttctcc ctggtggagg atgacggtcc ccccatgaga gagatcatac tcaaggtggt 4501 cctgatgacc atctgtggca tgaacccaat agccataccc tttgcagctg gagcgtggta 4561 cgtatacgtg aagactggaa aaaggagtgg tgctctatgg gatgtgcctg ctcccaagga 4621 agtaaaaaag ggggagacca cagatggagt gtacagagta atgactcgta gactgctagg 4681 ttcaacacaa gttggagtgg gagttatgca agagggggtc tttcacacta tgtggcacgt 4741 cacaaaagga tccgcgctga gaagcggtga agggagactt gatccatact ggggagatgt 4801 caagcaggat ctggtgtcat actgtggtcc atggaagcta gatgccgcct gggacgggca 4861 cagcgaggtg cagctcttgg ccgtgccccc cggagagaga gcgaggaaca tccagactct 4921 gcccggaata tttaagacaa aggatgggga cattggagcg gttgcgctgg attacccagc 4981 aggaacttca ggatctccaa tcctagacaa gtgtgggaga gtgataggac tttatggcaa 5041 tggggtcgtg atcaaaaatg ggagttatgt tagtgccatc acccaaggga ggagggagga 5101 agagactcct gttgagtgct tcgagccttc gatgctgaag aagaagcagc taactgtctt 5161 agacttgcat cctggagctg ggaaaaccag gagagttctt cctgaaatag tccgtgaagc 5221 tataaaaaca agactccgta ctgtgatctt agctccaacc agggttgtcg ctgctgaaat 5281 ggaggaagcc cttagagggc ttccagtgcg ttatatgaca acagcagtca atgtcaccca 5341 ttctggaaca gaaatcgtcg acttaatgtg ccatgccacc ttcacttcac gtctactaca 5401 gccaatcaga gtccccaact ataatctgta tattatggat gaggcccact tcacagatcc 5461 ctcaagtata gcagcaagag gatacatttc aacaagggtt gagatgggcg aggcggctgc 5521 catcttcatg accgccacgc caccaggaac ccgtgacgca tttccggact ccaactcacc 5581 aattatggac accgaagtgg aagtcccaga gagagcctgg agctcaggct ttgattgggt 5641 gacggatcat tctggaaaaa cagtttggtt tgttccaagc gtgaggaacg gcaatgagat 5701 cgcagcttgt ctgacaaagg ctggaaaacg ggtcatacag ctcagcagaa agacttttga 5761 gacagagttc cagaaaacaa aacatcaaga gtgggacttt gtcgtgacaa ccgacatttc 5821 agagatgggc gccaacttta aagctgaccg tgtcatagat tccaggagat gcctaaagcc 5881 ggtcatactt gatggcgaga gagtcattct ggctggaccc atgcctgtca cacatgccag 5941 cgctgcccag aggagggggc gcataggcag gaatcccaac aaacctggag atgagtatct 6001 gtatggaggt gggtgcgcag agactgacga agaccatgca cactggcttg aagcaagaat 6061 gctccttgac aatatttacc tccaagatgg cctcatagcc tcgctctatc gacctgaggc 6121 cgacaaagta gcagccattg agggagagtt caagcttagg acggagcaaa ggaagacctt 6181 tgtggaactc atgaaaagag gagatcttcc tgtttggctg gcctatcagg ttgcatctgc 6241 cggaataact tacacagata gaagatggtg ctttgatggc acgaccaaca acaccataat 6301 ggaagacagt gtgccggcag aggtgtggac cagacacgga gagaaaagag tgctcaaacc 6361 gaggtggatg gacgccagag tttgttcaga tcatgcggcc ctgaagtcat tcaaggagtt 6421 tgccgctggg aaaagaggag cggcttttgg agtgatggaa gccctgggaa cactgccagg 6481 acacatgaca gagagattcc aggaagccat tgacaacctc gctgtgctca tgcgggcaga 6541 gactggaagc aggccttaca aagccgcggc ggcccaattg ccggagaccc tagagaccat 6601 tatgcttttg gggttgctgg gaacagtctc gctgggaatc tttttcgtct tgatgaggaa 6661 caagggcata gggaagatgg gctttggaat ggtgactctt ggggccagcg catggctcat 6721 gtggctctcg gaaattgagc cagccagaat tgcatgtgtc ctcattgttg tgttcctatt 6781 gctggtggtg ctcatacctg agccagaaaa gcaaagatct ccccaggaca accaaatggc 6841 aatcatcatc atggtagcag taggtcttct aggcttgatc accgccaatg aactcggatg 6901 gttggagaga acaaagagtg acctaagcca tctaatggga aggagagagg agggagcaac 6961 cataggattc tcaatggaca ttgacctgcg gccagcctca gcttgggcca tctatgctgc 7021 cttgacaact ttcattaccc cagccgtcca acatgcagtg accacttcat acaacaacta 7081 ctccttaatg gcgatggcca cgcaagctgg agtgttgttt ggtatgggca aagggatgcc 7141 attctacgca tgggactttg gagtcccgct gctaatgata ggttgctact cacaattaac 7201 acccctgacc ctaatagtgg ccatcatttt gctcgtggcg cactacatgt acttgatccc 7261 agggctgcag gcagcagctg cgcgtgctgc ccagaagaga acggcagctg gcatcatgaa 7321 gaaccctgtt gtggatggaa tagtggtgac tgacattgac acaatgacaa ttgaccccca 7381 agtggagaaa aagatgggac aggtgctact catagcagta gccgtctcca gcgccatact 7441 gtcgcggacc gcctgggggt ggggggaggc tggggccctg atcacagccg caacttccac 7501 tttgtgggaa ggctctccga acaagtactg gaactcctct acagccactt cactgtgtaa 7561 catttttagg ggaagttact tggctggagc ttctctaatc tacacagtaa caagaaacgc 7621 tggcttggtc aagagacgtg ggggtggaac aggagagacc ctgggagaga aatggaaggc 7681 ccgcttgaac cagatgtcgg ccctggagtt ctactcctac aaaaagtcag gcatcaccga 7741 ggtgtgcaga gaagaggccc gccgcgccct caaggacggt gtggcaacgg gaggccatgc 7801 tgtgtcccga ggaagtgcaa agctgagatg gttggtggag cggggatacc tgcagcccta 7861 tggaaaggtc attgatcttg gatgtggcag agggggctgg agttactacg ccgccaccat 7921 ccgcaaagtt caagaagtga aaggatacac aaaaggaggc cctggtcatg aagaacccgt 7981 gttggtgcaa agctatgggt ggaacatagt ccgtctcaag agtggggtgg acgtctttca 8041 tatggcggct gagccgtgtg acacgttgct atgtgacata ggtgagtcat catctagtcc 8101 tgaagtggaa gaagcacgga cgctcagagt cctctccatg gtgggggatt ggcttgaaaa 8161 aagaccagga gccttttgta taaaagtgtt gtgcccatac accagcacta tgatggaaac 8221 cctggagcga ctgcagcgta ggtatggggg aggactggtc agagtgccac tctcccgcaa 8281 ctctacacat gagatgtact gggtctctgg agcgaaaagc aacaccataa aaagtgtgtc 8341 caccacgagc cagctcctct tggggcgcat ggacgggcct aggaggccag tgaaatatga 8401 ggaggatgtg aatctcggct ctggcacgcg ggctgtggta agctgcgctg aagctcccaa 8461 catgaagatc attggtaacc gcattgaaag gatccgcagt gagcacgcgg aaacgtggtt 8521 ctttgacgag aaccacccat ataggacatg ggcttaccat ggaagctatg aggcccccac 8581 acaagggtca gcatcctctc tagtaaacgg ggttgtcagg ctcctgtcaa aaccctggga 8641 tgtggtgact ggagtcacag gaatagccat gaccgacacc acaccgtatg gtcagcaaag 8701 agttttcaag gaaaaagtgg acactagggt gccagacccc caagaaggca ctcgtcaggt 8761 tatgagcatg gtctcttcct ggttgtggaa agagctaggt aaacacaaac ggccacgagt 8821 ctgtaccaaa gaagagttca tcaacaaggt tcgtagcaat gcagcattag gggcaatatt 8881 tgaagaggaa aaagagtgga agactgcagt ggaagctgtg aacgatccaa ggttctgggc 8941 tctagtggac aaggaaagag agcaccacct gagaggagag tgccagagtt gtgtgtacaa 9001 catgatggga aaaagagaaa agaaacaagg ggaatttgga aaggccaagg gcagccgcgc 9061 catctggtat atgtggctag gggctagatt tctagagttc gaagcccttg gattcttgaa 9121 cgaggatcac tggatgggga gagagaactc aggaggtggt gttgaagggc tgggattaca 9181 aagactcgga tatgtcctag aagagatgag tcgcatacca ggaggaagga tgtatgcaga 9241 tgacactgct ggctgggata cccgcatcag caggtttgat ctagagaatg aagctctaat 9301 caccaaccaa atggagaaag ggcacagggc cttggcattg gccataatca agtacacata 9361 ccaaaacaaa gtggtaaagg tccttagacc agctgaaaaa gggaaaacag ttatggacat 9421 tatttcgaga caagaccaaa gggggagcgg acaagttgtc acttacgctc ttaacacatt 9481 taccaaccta gtggtgcaac tcattcggaa tatggaggct gaggaagttc tagagatgca 9541 agacttgtgg ctgctgcgga ggtcagagaa agtgaccaac tggttgcaga gcaacggatg 9601 ggataggctc aaacgaatgg cagtcagtgg agatgattgc gttgtgaagc caattgatga 9661 taggtttgca catgccctca ggttcttgaa tgatatggga aaagttagga aggacacaca 9721 agagtggaaa ccctcaactg gatgggacaa ctgggaagaa gttccgtttt gctcccacca 9781 cttcaacaag ctccatctca aggacgggag gtccattgtg gttccctgcc gccaccaaga 9841 tgaactgatt ggccgggccc gcgtctctcc aggggcggga tggagcatcc gggagactgc 9901 ttgcctagca aaatcatatg cgcaaatgtg gcagctcctt tatttccaca gaagggacct 9961 ccgactgatg gccaatgcca tttgttcatc tgtgccagtt gactgggttc caactgggag 10021 aactacctgg tcaatccatg gaaagggaga atggatgacc attgaagaca tgcttgtggt 10081 gtggaacaga gtgtggattg aggagaacga ccacatggaa gacaagaccc cagttacgaa 10141 atggacagac attccctatt tgggaaaaag ggaagacttg tggtgtggat ctctcatagg 10201 gcacagaccg cgcaccacct gggctgagaa cattaaaaac acagtcaaca tggtgcgcag 10261 gatcataggt gaggaagaaa agtacatgga ctacctatcc acccaagtcc gctacttggg 10321 tgaagaaggg tctacacctg gagtgctgta agcaccaatc ttaatgttgt caggcctgct 10381 agtcagccac agcttgggga aagctgtgca gcctgtgacc cccccaggag aagctgggaa 10441 accaagccta tagtcaggcc gagaacgcca tggcacggaa gaagccatgc tgcctgtgag 10501 cccctcagag gacactgagt caaaaaaccc cacgcgcttg gaggcgcagg atgggaaaag 10561 aaggtggcga ccttccccac ccttcaatct ggggcctgaa ctgga

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ&ll=25.834245664814095%2C-80.20197401455317&z=13

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ&ll=28.655097939756722%2C-81.27554426601802&z=10

November 8, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are three new travel related cases today with one in Miami-Dade, one in Orange and one in Palm Beach. Please visit our website to see the full list of travel-related cases. There is one new non-travel related case today linked to the investigation in Little River. DOH continues door-to-door outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the identified areas in Miami-Dade County. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 783 Non-Travel Related Infections of Zika 192 Infections Involving Pregnant Women 135 Out of State Cases (not Florida Residents) 20 Undetermined 7 Total 1,137 The timelines below are as of Nov. 4 and will be updated every Friday. Note: Asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 13 active investigations. The department has closed 34 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 10,096 people statewide. Florida currently has the capacity to test 7,296 people for active Zika virus and 5,916 for Zika antibodies. At Governor Scott’s direction, all county health departments offer free Zika risk assessment and testing to pregnant women. Florida’s small case clusters is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted areas in Miami-Dade County (see maps below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 135. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted more than 7,178 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. click image above to enlarge click image above to enlarge About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.

November 8, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are three new travel related cases today with one in Miami-Dade, one in Orange and one in Palm Beach. Please visit our website to see the full list of travel-related cases. There is one new non-travel related case today linked to the investigation in Little River. DOH continues door-to-door outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the identified areas in Miami-Dade County. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 783 Non-Travel Related Infections of Zika 192 Infections Involving Pregnant Women 135 Out of State Cases (not Florida Residents) 20 Undetermined 7 Total 1,137 The timelines below are as of Nov. 4 and will be updated every Friday. Note: Asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 13 active investigations. The department has closed 34 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 10,096 people statewide. Florida currently has the capacity to test 7,296 people for active Zika virus and 5,916 for Zika antibodies. At Governor Scott’s direction, all county health departments offer free Zika risk assessment and testing to pregnant women. Florida’s small case clusters is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted areas in Miami-Dade County (see maps below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 135. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted more than 7,178 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. click image above to enlarge click image above to enlarge About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.

There is one new non-travel related case today linked to the investigation in Little River.

There are three new travel related cases today with one in Miami-Dade, one in Orange and one in Palm Beach. Please visit our website to see the full list of travel-related cases. There is one new non-travel related case today linked to the investigation in Little River.

Infection Type Infection Count Travel-Related Infections of Zika 783 Non-Travel Related Infections of Zika 192 Infections Involving Pregnant Women 135 Out of State Cases (not Florida Residents) 20 Undetermined 7 Total 1,137 http://www.floridahealth.gov/newsroom/2016/11/110816-zika-update.html

Infection Type Infection Count Travel-Related Infections of Zika 783 Non-Travel Related Infections of Zika 192 Infections Involving Pregnant Women 135 Out of State Cases (not Florida Residents) 20 Undetermined 7 Total 1,137 http://www.floridahealth.gov/newsroom/2016/11/110816-zika-update.html

Highly pathogenic avian influenza, Poland Information received on 07/11/2016 from Dr Krzysztof Jazdzewski, Deputy Chief Veterinary Officer, Ministry of Agriculture and Rural Development, General Veterinary Inspectorate, VARSOVIE, Poland Summary Report type Immediate notification Date of start of the event 28/10/2016 Date of confirmation of the event 05/11/2016 Report date 07/11/2016 Date submitted to OIE 07/11/2016 Reason for notification New strain of a listed disease in the country Causal agent Highly pathogenic avian influenza virus Serotype H5N8 Nature of diagnosis Laboratory (advanced) This event pertains to a defined zone within the country New outbreaks (1) Outbreak 1 (1) Lubczyna, Goleniow, Goleniowski, ZACHODNIO-POMORSKIE Date of start of the outbreak 28/10/2016 Outbreak status Continuing (or date resolved not provided) Epidemiological unit Not applicable Affected animals Species Susceptible Cases Deaths Destroyed Slaughtered Anatidae (unidentified):Anatidae (incognita)(Anatidae) 5 5 0 0 Laridae (unidentified):Laridae (incognita)(Laridae) 1 1 0 0 Summary of outbreaks Total outbreaks: 1 Total animals affected Species Susceptible Cases Deaths Destroyed Slaughtered Anatidae (unidentified):Anatidae (incognita)(Anatidae) 5 5 0 0 Laridae (unidentified):Laridae (incognita)(Laridae) 1 1 0 0 Outbreak statistics Species Apparent morbidity rate Apparent mortality rate Apparent case fatality rate Proportion susceptible animals lost* Anatidae (unidentified):Anatidae (incognita)(Anatidae) ** ** 100.00% ** Laridae (unidentified):Laridae (incognita)(Laridae) ** ** 100.00% ** *Removed from the susceptible population through death, destruction and/or slaughter **Not calculated because of missing information Epidemiology Source of the outbreak(s) or origin of infection Unknown or inconclusive Control measures Measures applied Control of wildlife reservoirs Vaccination prohibited No treatment of affected animals Measures to be applied No other measures Diagnostic test results Laboratory name and type Species Test Test date Result National Veterinary Research Institute (National laboratory) Anatidae (unidentified) real-time reverse transcriptase/polymerase chain reaction (RRT-PCR) 05/11/2016 Positive National Veterinary Research Institute (National laboratory) Laridae (unidentified) real-time reverse transcriptase/polymerase chain reaction (RRT-PCR) 05/11/2016 Positive Future Reporting The event is continuing. Weekly follow-up reports will be submitted. Map of outbreak locations http://www.oie.int/wahis_2/public/wahid.php/Reviewreport/Review?page_refer=MapFullEventReport&reportid=21457

Dead ducks on Lake Dąbie around the Lubczyny and the Black Meadow were found last week. - A total of 74 art collected dead birds, mostly wild ducks and one seagull - told The West Regional Veterinary Inspector Maciej Prost. - We took the material for testing from five ducks and gulls, and one sent for virological tests in the direction of avian influenza. We received confirmation that appeared highly pathogenic bird flu. The virus that causes the flu is detected in clinical subtype H5N8 - added Prost. - H5N8 virus is pathogenic to birds, mainly waterfowl - said Prost. - Such virus was not isolated from humans or other animals, except for one case which was previously place. Once isolated the virus from the dog in Korea - he added. Infection only by direct contact with wild birds According to the inspector of H5N8 in humans could theoretically cause flu-like symptoms, but has never yet been detected in them. He added that to become infected with the virus, someone would have to have direct contact with wild birds, and this is unlikely. As a result of avian influenza designated in districts nowogardzkim, Szczecin and Police protection zone and threatened. As stressed by Prost, if someone finds a dead bird of aquatic species, it should notify the district veterinarian in the area of the three counties. Third time in Poland Avian influenza occurred in Poland, twice. In December 2007,. He appeared in 10 foci in the Mazowieckie (in the counties of Plock and Żuromin) and the Warmia-Mazury (in the counties of Lidzbark, Elblag and Ostróda). As a result of the detection of this disease veterinary services closed down 939 thousand. birds and more than 3 million 950 thousand. eggs. Losses poultry farmers in this respect rated at more than 19 million zł. Previously, bird flu appeared in Poland since the fall of 2005. Until the spring of 2006. It was detected in several fires, including in Torun, Bydgoszcz, Swinoujscie and in the province. Lubuskie. The virus was only detected in wild birds, there were cases of domestic poultry. PAP

Dead ducks on Lake Dąbie around the Lubczyny and the Black Meadow were found last week. - A total of 74 art collected dead birds, mostly wild ducks and one seagull - told The West Regional Veterinary Inspector Maciej Prost. - We took the material for testing from five ducks and gulls, and one sent for virological tests in the direction of avian influenza. We received confirmation that appeared highly pathogenic bird flu. The virus that causes the flu is detected in clinical subtype H5N8 - added Prost. http://www.polsatnews.pl/wiadomosc/2016-11-07/ptasia-grypa-atakuje-wykryto-wirus-u-dzikich-zwierzat-w-okolicach-szczecina/

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ&ll=26.04945477574539%2C-80.65200805625&z=10

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ&ll=26.04945477574539%2C-80.65200805625&z=10

November 7, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are three new travel related cases today with one in Miami-Dade County and two involving pregnant women. Please visit our website to see the full list of travel-related cases. There is one new non-travel related case today. The individual is a Miami-Dade County resident and the department is investigating to determine where exposure occurred. Additionally, there is one case who had travel to an area outside of Florida with widespread Zika transmission as well as in Miami, which makes it impossible to determine exactly where exposure occurred. This case is being added to the undetermined category. DOH continues door-to-door outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the identified areas in Miami-Dade County. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 780 Non-Travel Related Infections of Zika 191 Infections Involving Pregnant Women 135 Out of State Cases (not Florida Residents) 20 Undetermined 7 Total 1,133 The timelines below are as of Nov. 4 and will be updated every Friday. Note: Asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 13 active investigations. The department has closed 34 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 10,050 people statewide. Florida currently has the capacity to test 7,337 people for active Zika virus and 5,993 for Zika antibodies. At Governor Scott’s direction, all county health departments offer free Zika risk assessment and testing to pregnant women. Florida’s small case clusters is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted areas in Miami-Dade County (see maps below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 135. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted more than 7,144 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. click image above to enlarge click image above to enlarge About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.

November 7, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are three new travel related cases today with one in Miami-Dade County and two involving pregnant women. Please visit our website to see the full list of travel-related cases. There is one new non-travel related case today. The individual is a Miami-Dade County resident and the department is investigating to determine where exposure occurred. Additionally, there is one case who had travel to an area outside of Florida with widespread Zika transmission as well as in Miami, which makes it impossible to determine exactly where exposure occurred. This case is being added to the undetermined category. DOH continues door-to-door outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. DOH believes ongoing transmission is only taking place within the identified areas in Miami-Dade County. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 780 Non-Travel Related Infections of Zika 191 Infections Involving Pregnant Women 135 Out of State Cases (not Florida Residents) 20 Undetermined 7 Total 1,133 The timelines below are as of Nov. 4 and will be updated every Friday. Note: Asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 13 active investigations. The department has closed 34 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 10,050 people statewide. Florida currently has the capacity to test 7,337 people for active Zika virus and 5,993 for Zika antibodies. At Governor Scott’s direction, all county health departments offer free Zika risk assessment and testing to pregnant women. Florida’s small case clusters is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted areas in Miami-Dade County (see maps below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the impacted areas to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 135. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted more than 7,144 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. click image above to enlarge click image above to enlarge About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.

There is one new non-travel related case today. The individual is a Miami-Dade County resident and the department is investigating to determine where exposure occurred. Additionally, there is one case who had travel to an area outside of Florida with widespread Zika transmission as well as in Miami, which makes it impossible to determine exactly where exposure occurred. This case is being added to the undetermined category.

There are three new travel related cases today with one in Miami-Dade County and two involving pregnant women. Please visit our website to see the full list of travel-related cases. There is one new non-travel related case today. The individual is a Miami-Dade County resident and the department is investigating to determine where exposure occurred. Additionally, there is one case who had travel to an area outside of Florida with widespread Zika transmission as well as in Miami, which makes it impossible to determine exactly where exposure occurred. This case is being added to the undetermined category.

Infection Type Infection Count Travel-Related Infections of Zika 780 Non-Travel Related Infections of Zika 191 Infections Involving Pregnant Women 135 Out of State Cases (not Florida Residents) 20 Undetermined 7 Total 1,133 http://www.floridahealth.gov/newsroom/2016/11/110716-zika-update.html

Infection Type Infection Count Travel-Related Infections of Zika 780 Non-Travel Related Infections of Zika 191 Infections Involving Pregnant Women 135 Out of State Cases (not Florida Residents) 20 Undetermined 7 Total 1,133 http://www.floridahealth.gov/newsroom/2016/11/110716-zika-update.html

FLSR043_other_USA_2016-09-28 matches Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 18462 18462 100% 0.0 99% KX262887.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 18453 18453 100% 0.0 99% KX694534.1 Select seq gb|KY014327.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME167-PLA polyprotein gene, complete cds 18437 18437 100% 0.0 99% KY014327.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 18435 18435 100% 0.0 99% KX247632.1 Select seq gb|KY014315.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME152-SER polyprotein gene, complete cds 18431 18431 100% 0.0 99% KY014315.1 Select seq gb|KX856011.1| Zika virus strain ZIKV/Aedes sp./MEX_I-44/2016, complete genome 18426 18426 100% 0.0 99% KX856011.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 18426 18426 100% 0.0 99% KX446951.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 18426 18426 99% 0.0 99% KU501217.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 18422 18422 100% 0.0 99% KX446950.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 18422 18422 100% 0.0 99% KU870645.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 18420 18420 99% 0.0 99% KU501216.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 18408 18408 99% 0.0 99% KX447510.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 18399 18399 99% 0.0 99% KX447512.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 18399 18399 99% 0.0 99% KX369547.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 18399 18399 100% 0.0 99% KU509998.3 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 18393 18393 99% 0.0 99% KJ776791.2 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 18393 18393 99% 0.0 99% KX447509.1 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 18390 18390 100% 0.0 99% KX766029.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 18390 18390 99% 0.0 99% KX447513.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 18390 18390 100% 0.0 99% KU926309.1 Select seq gb|KR872956.1| Zika virus strain 17829 polyprotein gene, complete cds 18386 18386 100% 0.0 99% KR872956.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 18386 18386 100% 0.0 99% KX197205.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 18386 18386 100% 0.0 99% KX280026.1 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 18386 18386 100% 0.0 99% KU991811.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 18386 18386 100% 0.0 99% KU321639.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 18384 18384 99% 0.0 99% KX447515.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 18384 18384 99% 0.0 99% KX447511.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 18381 18381 99% 0.0 99% KX447514.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 18381 18381 100% 0.0 99% KX051563.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 18381 18381 100% 0.0 99% KU707826.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 18381 18381 100% 0.0 99% KU365779.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 18377 18377 100% 0.0 99% KU729218.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 18375 18375 99% 0.0 99% KX447516.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 18372 18372 100% 0.0 99% KU758877.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 18372 18372 100% 0.0 99% KX197192.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 18372 18372 100% 0.0 99% KU365780.1 Select seq gb|KX811222.1| Zika virus isolate Brazil_2015_MG, complete genome 18368 18368 100% 0.0 99% KX811222.1 Select seq gb|KY014297.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-6864-URI polyprotein gene, complete cds 18363 18363 100% 0.0 99% KY014297.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 18363 18363 100% 0.0 99% KX198135.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 18363 18363 100% 0.0 99% KU365777.1 Select seq gb|KX879604.1| Zika virus isolate SN089, complete genome 18361 18361 99% 0.0 99% KX879604.1 Select seq gb|KY014303.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0127-SER polyprotein gene, complete cds 18359 18359 100% 0.0 99% KY014303.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 18359 18359 100% 0.0 99% KU647676.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 18354 18354 100% 0.0 99% KX247646.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 18354 18354 100% 0.0 99% KX156776.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 18354 18354 100% 0.0 99% KU940228.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 18354 18354 100% 0.0 99% KU365778.1 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 18354 18354 100% 0.0 99% KU312312.1 Select seq gb|KX879603.1| Zika virus isolate SN062, complete genome 18352 18352 99% 0.0 99% KX879603.1 Select seq gb|KY014304.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0180-SER polyprotein gene, complete cds 18350 18350 100% 0.0 99% KY014304.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 18350 18350 100% 0.0 99% KX156774.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 18350 18350 100% 0.0 99% KU729217.2 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 18350 18350 100% 0.0 99% KU497555.1 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 18350 18350 100% 0.0 99% KU527068.1 Select seq gb|KX806557.2| Zika virus isolate TS17-2016, complete genome 18345 18345 99% 0.0 99% KX806557.2 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 18345 18345 100% 0.0 99% KU820897.5 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 18345 18345 99% 0.0 99% KX447517.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 18345 18345 100% 0.0 99% KU937936.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 18345 18345 100% 0.0 99% KX156775.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 18345 18345 100% 0.0 99% KX087102.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 18345 18345 100% 0.0 99% KU501215.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 18341 18341 100% 0.0 99% KX601168.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 18341 18341 100% 0.0 99% KX087101.2 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 18341 18341 100% 0.0 99% KU922960.1 Select seq gb|KY014296.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI polyprotein gene, complete cds 18336 18336 100% 0.0 99% KY014296.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 18336 18336 100% 0.0 99% KX548902.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 18336 18336 100% 0.0 99% KX520666.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 18336 18336 100% 0.0 99% KX377337.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 18336 18336 100% 0.0 99% KU926310.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 18336 18336 100% 0.0 99% KU922923.1 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 18336 18336 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 18336 18336 100% 0.0 99% KU853012.1 Select seq gb|KY014300.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0208-SER polyprotein gene, complete cds 18332 18332 100% 0.0 99% KY014300.1 Select seq dbj|LC190723.1| Zika virus genomic RNA, complete genome, strain: ZIKV/Hu/Yokohama/1/2016 18332 18332 100% 0.0 99% LC190723.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 18332 18332 100% 0.0 99% KU955590.1 Select seq gb|KX893855.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-2/2016, complete genome 18330 18330 100% 0.0 99% KX893855.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 18328 18328 100% 0.0 99% KX766028.1 Select seq gb|KY014321.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0115-SER polyprotein gene, complete cds 18327 18327 100% 0.0 99% KY014321.1 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 18327 18327 100% 0.0 99% KX702400.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 18327 18327 100% 0.0 99% KU740184.2 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 18327 18327 100% 0.0 99% KU761564.1 Select seq gb|KY014295.1| Zika virus isolate Zika virus/H.sapiens-wt/USA/2016/FL-010-URI polyprotein gene, complete cds 18323 18323 100% 0.0 99% KY014295.1 Select seq gb|KX842449.2| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL010U polyprotein gene, complete cds 18323 18323 100% 0.0 99% KX842449.2 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 18318 18318 99% 0.0 99% KU820898.1 Select seq gb|KX922707.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL039U polyprotein gene, complete cds 18314 18314 100% 0.0 99% KX922707.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 18314 18314 100% 0.0 99% KX673530.1 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 18312 18312 99% 0.0 99% KX056898.1 Select seq gb|KY014323.1| Zika virus isolate Zika virus/A.aegypti-wt/USA/2016/FL-02-MOS polyprotein gene, complete cds 18309 18309 100% 0.0 99% KY014323.1 Select seq gb|KY014314.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0436-SER polyprotein gene, complete cds 18309 18309 100% 0.0 99% KY014314.1 Select seq gb|KX922703.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL021U polyprotein gene, complete cds 18309 18309 99% 0.0 99% KX922703.1 Select seq gb|KX838905.2| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL02M polyprotein gene, complete cds 18309 18309 100% 0.0 99% KX838905.2 Select seq gb|KX832731.1| Zika virus isolate ZIKV/Homo_sapiens/USA//2016/Hu0015SA polyprotein gene, complete cds 18309 18309 100% 0.0 99% KX832731.1 Select seq gb|KX922706.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL038U polyprotein gene, complete cds 18307 18307 100% 0.0 99% KX922706.1 Select seq gb|KY014316.1| Zika virus isolate Zika virus/H.sapiens-wt/USA/2016/FL-039-URI polyprotein gene, complete cds 18305 18305 100% 0.0 99% KY014316.1 Select seq gb|KX922704.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL030U polyprotein gene, complete cds 18305 18305 100% 0.0 99% KX922704.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 18303 18303 99% 0.0 99% KX117076.1 Select seq gb|KY014320.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ42D1-URI polyprotein gene, complete cds 18301 18301 100% 0.0 99% KY014320.1 Select seq gb|KY014322.1| Zika virus isolate Zika virus/A.aegypti-wt/USA/2016/FL-03-MOS polyprotein gene, complete cds 18300 18300 100% 0.0 99% KY014322.1 Select seq gb|KX838906.2| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL03M polyprotein gene, complete cds 18300 18300 100% 0.0 99% KX838906.2 Select seq gb|KX838904.2| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL01M polyprotein gene, complete cds 18300 18300 100% 0.0 99% KX838904.2