niman

Pennsylvania Blood Tests Submitted for Zika TestingInformation updated Mondays at 2 p.m. Confirmed Infections: 95 Pending Test Results: 45 Last update: 08/29/2016

No new local or travel related Zika cases today.

Live feed http://www.wptv.com/news/region-s-palm-beach-county/boca-raton/zika-roundtable-monday-in-boca-raton

Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 18969 18969 100% 0.0 100% KX766029.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 18859 18859 100% 0.0 99% KX247632.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 18848 18848 100% 0.0 99% KX446951.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 18842 18842 100% 0.0 99% KX446950.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 18825 18825 100% 0.0 99% KX262887.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 18814 18814 100% 0.0 99% KX694534.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 18803 18803 100% 0.0 99% KU501217.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 18798 18798 100% 0.0 99% KU501216.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 18776 18776 100% 0.0 99% KU870645.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 18770 18770 100% 0.0 99% KX447510.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 18759 18759 100% 0.0 99% KX447512.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 18759 18759 100% 0.0 99% KX369547.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 18759 18759 100% 0.0 99% KU509998.3 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 18753 18753 100% 0.0 99% KX447509.1 Select seq gb|KJ776791.1| Zika virus strain H/PF/2013 polyprotein gene, complete cds 18753 18753 100% 0.0 99% KJ776791.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 18748 18748 100% 0.0 99% KX447513.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 18742 18742 100% 0.0 99% KX447515.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 18742 18742 100% 0.0 99% KX447511.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 18742 18742 100% 0.0 99% KX280026.1 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 18742 18742 100% 0.0 99% KU991811.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 18742 18742 100% 0.0 99% KU707826.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 18742 18742 100% 0.0 99% KU365779.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 18742 18742 100% 0.0 99% KU321639.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 18737 18737 100% 0.0 99% KX447514.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 18737 18737 100% 0.0 99% KX051563.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 18737 18737 100% 0.0 99% KU926309.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 18731 18731 100% 0.0 99% KX447516.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 18731 18731 100% 0.0 99% KU729218.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 18726 18726 100% 0.0 99% KU758877.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 18726 18726 100% 0.0 99% KX197192.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 18726 18726 100% 0.0 99% KU365780.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 18720 18720 100% 0.0 99% KU365777.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 18715 18715 100% 0.0 99% KX198135.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 18709 18709 100% 0.0 99% KU940228.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 18709 18709 100% 0.0 99% KU647676.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 18703 18703 100% 0.0 99% KX247646.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 18703 18703 100% 0.0 99% KX156776.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 18703 18703 100% 0.0 99% KU501215.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 18703 18703 100% 0.0 99% KU365778.1 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 18703 18703 100% 0.0 99% KU312312.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 18700 18700 99% 0.0 99% KU497555.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 18698 18698 100% 0.0 99% KX601168.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 18698 18698 100% 0.0 99% KX087101.2 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 18698 18698 100% 0.0 99% KX156774.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 18698 18698 100% 0.0 99% KU729217.2 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 18698 18698 100% 0.0 99% KU527068.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 18692 18692 100% 0.0 99% KU820897.5 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 18692 18692 100% 0.0 99% KX447517.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 18692 18692 100% 0.0 99% KX377337.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 18692 18692 100% 0.0 99% KU937936.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 18692 18692 100% 0.0 99% KX156775.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 18692 18692 100% 0.0 99% KX087102.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 18687 18687 100% 0.0 99% KX520666.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 18687 18687 100% 0.0 99% KU922960.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 18681 18681 100% 0.0 99% KX548902.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 18681 18681 100% 0.0 99% KU926310.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 18681 18681 100% 0.0 99% KU922923.1 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 18681 18681 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 18679 18679 100% 0.0 99% KU853012.1 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 18670 18670 100% 0.0 99% KX702400.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 18670 18670 100% 0.0 99% KU820898.1 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 18665 18665 100% 0.0 99% KX056898.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 18665 18665 100% 0.0 99% KU955590.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 18661 18661 100% 0.0 99% KX766028.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 18659 18659 100% 0.0 99% KU740184.2 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 18659 18659 100% 0.0 99% KU761564.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 18654 18654 100% 0.0 99% KX673530.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 18643 18643 100% 0.0 99% KX117076.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 18631 18631 100% 0.0 99% KX185891.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 18631 18631 100% 0.0 99% KU963796.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 18626 18626 100% 0.0 99% KX253996.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 18626 18626 100% 0.0 99% KU955589.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 18626 18626 100% 0.0 99% KU820899.2 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 18622 18622 100% 0.0 99% KX266255.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 18620 18620 100% 0.0 99% KU866423.2 Select seq gb|KU940224.1| Zika virus isolate Bahia09, partial genome 18611 18611 99% 0.0 99% KU940224.1 Select seq gb|KU744693.1| Zika virus isolate VE_Ganxian, complete genome 18465 18465 100% 0.0 99% KU744693.1 Select seq gb|KU681081.3| Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome 18332 18332 100% 0.0 99% KU681081.3 Select seq gb|KX694532.1| Zika virus strain ZIKV/Homo sapiens/THA/PLCal_ZV/2013, complete genome 18183 18183 100% 0.0 99% KX694532.1 Select seq gb|JN860885.1| Zika virus isolate FSS13025 polyprotein gene, partial cds 17980 17980 99% 0.0 98% JN860885.1 Select seq gb|KU955593.1| Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome 17978 17978 100% 0.0 98% KU955593.1 Select seq gb|KF993678.1| Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds 17946 17946 98% 0.0 99% KF993678.1 Select seq gb|EU545988.1| Zika virus polyprotein gene, complete cds 17771 17771 100% 0.0 98% EU545988.1 Select seq gb|KU681082.3| Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome 17584 17584 100% 0.0 98% KU681082.3 Select seq gb|KX447518.1| Zika virus isolate 1_0117_PF polyprotein gene, partial cds 16558 16558 88% 0.0 99% KX447518.1 Select seq gb|KX601167.1| Zika virus strain ZIKV/Aedes sp./MYS/P6-740/1966, complete genome 16366 16366 99% 0.0 95% KX601167.1 Select seq gb|HQ234499.1| Zika virus isolate P6-740 polyprotein gene, partial cds 16360 16360 99% 0.0 95% HQ234499.1 Select seq gb|KX694533.1| Zika virus strain ZIKV/Aedes aegypti/MYS/P6-740/1966, complete genome 16355 16355 99% 0.0 95% KX694533.1 Select seq gb|KX377336.1| Zika virus strain P6-740, complete genome 16349 16349 99% 0.0 95% KX377336.1 Select seq gb|KU720415.1| Zika virus strain MR 766 polyprotein gene, complete cds 12554 12554 100% 0.0 89% KU720415.1 Select seq gb|HQ234498.1| Zika virus isolate MR_766 polyprotein gene, partial cds 12549 12549 99% 0.0 89% HQ234498.1 Select seq gb|KX377335.1| Zika virus strain MR-766, complete genome 12538 12538 100% 0.0 89% KX377335.1 Select seq gb|KF383115.1| Zika virus strain ArB1362 polyprotein gene, complete cds 12534 12534 100% 0.0 89% KF383115.1 Select seq dbj|LC002520.1| Zika virus genomic RNA, complete genome, strain: MR766-NIID 12526 12526 100% 0.0 89% LC002520.1 Select seq gb|KF383119.1| Zika virus strain ArD158084 polyprotein gene, complete cds 12526 12526 100% 0.0 89% KF383119.1 Select seq gb|KU955595.1| Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome 12499 12499 100% 0.0 89% KU955595.1 Select seq gb|KF268948.1| Zika virus isolate ARB13565 polyprotein gene, complete cds 12495 12495 100% 0.0 89% KF268948.1 Select seq gb|KX601169.1| Zika virus strain ZIKV/Macaca mulatta/UGA/MR-766/1947, complete genome 12493 12493 100% 0.0 89% KX601169.1 Select seq gb|KU963573.1| Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds 12493 12493 100% 0.0 89% KU963573.1 Select seq gb|KU955594.1| Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome 12493 12493 100% 0.0 89% KU955594.1 Select seq gb|KU955592.1| Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome 12488 12488 100% 0.0 89% KU955592.1 Select seq gb|KF268950.1| Zika virus isolate ARB7701 polyprotein gene, complete cds 12488 12488 100% 0.0 89% KF268950.1 Select seq gb|KF268949.1| Zika virus isolate ARB15076 polyprotein gene, complete cds 12482 12482 100% 0.0 89% KF268949.1 Select seq gb|DQ859059.1| Zika virus strain MR 766 polyprotein gene, complete cds 12477 12477 100% 0.0 89% DQ859059.1 Select seq gb|KX198134.1| Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome 12471 12471 100% 0.0 89% KX198134.1 Select seq gb|KU955591.1| Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome 12466 12466 100% 0.0 89% KU955591.1 Select seq gb|KF383116.1| Zika virus strain ArD7117 polyprotein gene, complete cds 12460 12460 100% 0.0 89% KF383116.1 Select seq gb|AY632535.2| Zika virus strain MR 766, complete genome 12454 12454 100% 0.0 89% AY632535.2 Select seq gb|HQ234501.1| Zika virus isolate ArD_41519 polyprotein gene, partial cds 12429 12429 99% 0.0 89% HQ234501.1 Select seq gb|KF383117.1| Zika virus strain ArD128000 polyprotein gene, complete cds 12388 12388 100% 0.0 88% KF383117.1 Select seq gb|KX601166.1| Zika virus strain ZIKV/Aedes africanus/SEN/DakAr41524/1984, complete genome 12382 12382 100% 0.0 88% KX601166.1 Select seq gb|KU963574.1| Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds 12344 12344 100% 0.0 88% KU963574.1 Select seq gb|HQ234500.1| Zika virus isolate IbH_30656 polyprotein gene, partial cds 12344 12344 99% 0.0 88% HQ234500.1 Select seq gb|KF383118.1| Zika virus strain ArD157995 polyprotein gene, complete cds 12165 12165 100% 0.0 88% KF383118.1 Select seq gb|KF383121.1| Zika virus strain ArD158095 polyprotein gene, partial cds 12139 12139 97% 0.0 89% KF383121.1 Select seq gb|KX447520.1| Zika virus isolate 1_0016_PF polyprotein gene, partial cds 11738 16149 86% 0.0 99% KX447520.1 Select seq gb|KX576684.1| Zika virus vector pZIKV-ICD, complete sequence 11112 18741 100% 0.0 99% KX576684.1 Select seq gb|KX447519.1| Zika virus isolate 1_0199_PF polyprotein gene, partial cds 10207 16426 87% 0.0 99% KX447519.1 Select seq gb|KX447521.1| Zika virus isolate 1_0080_PF polyprotein gene, partial cds 10052 15288 81% 0.0 99% KX447521.1 Select seq gb|KF383120.1| Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence 9681 9681 97% 0.0 84% KF383120.1 Select seq gb|KX212103.1| Zika virus isolate BRZIKV_AB_ES polyprotein gene, partial cds 5099 5099 27% 0.0 99% KX212103.1 Select seq gb|KU758871.1| Zika virus isolate 17170 polyprotein gene, partial cds 5092 5092 27% 0.0 99% KU758871.1 Select seq gb|KU758875.1| Zika virus isolate 15042 polyprotein gene, partial cds 5090 5090 27% 0.0 99% KU758875.1 Select seq gb|KU758870.1| Zika virus isolate 17160 polyprotein gene, partial cds 5084 5084 27% 0.0 99% KU758870.1 Select seq gb|KU312314.1| Zika virus isolate Z1106031 polyprotein gene, partial cds 5083 5083 27% 0.0 99% KU312314.1 Select seq gb|KU758873.1| Zika virus isolate 18246 polyprotein gene, partial cds 5081 5081 27% 0.0 99% KU758873.1 Select seq gb|KU758872.1| Zika virus isolate 01170 polyprotein gene, partial cds 5066 5066 27% 0.0 99% KU758872.1 Select seq gb|KU758869.1| Zika virus isolate 05211 polyprotein gene, partial cds 5055 5055 26% 0.0 99% KU758869.1 Select seq gb|KU758876.1| Zika virus isolate 21068 polyprotein gene, partial cds 5053 5053 27% 0.0 99% KU758876.1 Select seq gb|KU312313.1| Zika virus isolate Z1106032 polyprotein gene, partial cds 5049 5049 27% 0.0 99% KU312313.1 Select seq gb|KU758868.1| Zika virus isolate 27229 polyprotein gene, partial cds 5024 5024 26% 0.0 99% KU758868.1 Select seq gb|KU758874.1| Zika virus isolate 20114 polyprotein gene, partial cds 5018 5018 26% 0.0 99% KU758874.1 Select seq gb|KU646828.1| Zika virus isolate Si322 polyprotein gene, partial cds 4732 4732 25% 0.0 99% KU646828.1 Select seq gb|KU646827.1| Zika virus isolate Si323 polyprotein gene, partial cds 4721 4721 25% 0.0 99% KU646827.1 Select seq gb|KU940227.1| Zika virus isolate Bahia08, partial genome 4527 14522 78% 0.0 98% KU940227.1 Select seq gb|KU312315.1| Zika virus isolate Z1106027 polyprotein gene, partial cds 3500 3500 18% 0.0 99% KU312315.1 Select seq gb|KU740199.1| Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds 3271 3271 17% 0.0 99% KU740199.1 Select seq gb|KX101066.1| Zika virus isolate Bahia01, partial genome 3173 13322 72% 0.0 99% KX101066.1 Select seq gb|KX101060.1| Zika virus isolate Bahia02, partial genome 3086 10977 59% 0.0 98% KX101060.1 Select seq gb|KJ634273.1| Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds 2748 2748 14% 0.0 99% KJ634273.1 Select seq dbj|LC171327.1| Zika virus gene for polyprotein, partial cds, strain: ZIKV/Hu/Chiba/S36/2016 2743 2743 14% 0.0 99% LC171327.1 Select seq gb|KU686218.1| Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds 2087 2087 11% 0.0 99% KU686218.1 Select seq gb|KU179098.1| Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds 2054 2054 11% 0.0 99% KU179098.1 Select seq gb|KU886298.1| Zika virus isolate MN NS5 gene, partial cds 1905 1905 10% 0.0 99% KU886298.1 Select seq gb|KX101061.1| Zika virus isolate Bahia03, partial genome 1879 13803 74% 0.0 99% KX101061.1 Select seq gb|KX059014.1| Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds 1875 1875 9% 0.0 99% KX059014.1 Select seq gb|KX059013.1| Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds 1875 1875 9% 0.0 99% KX059013.1 Select seq gb|KM078936.1| Zika virus strain CHI1410214 NS5 protein gene, partial cds 1786 1786 9% 0.0 99% KM078936.1 Select seq gb|KM078961.1| Zika virus strain CHI2612114 NS5 protein gene, partial cds 1783 1783 9% 0.0 99% KM078961.1 Select seq gb|KM078930.1| Zika virus strain CHI2283714 NS5 protein gene, partial cds 1781 1781 9% 0.0 99% KM078930.1 Select seq gb|KM078971.1| Zika virus strain CHI2613014 NS5 protein gene, partial cds 1777 1777 9% 0.0 99% KM078971.1 Select seq gb|KM078970.1| Zika virus strain CHI2490414 NS5 protein gene, partial cds 1777 1777 9% 0.0 99% KM078970.1 Select seq gb|KM078933.1| Zika virus strain CHI1058514 NS5 protein gene, partial cds 1777 1777 9% 0.0 99% KM078933.1 Select seq gb|KM078929.1| Zika virus strain CHI1805214 NS5 protein gene, partial cds 1775 1775 9% 0.0 99% KM078929.1 Select seq gb|KX173841.1| Zika virus isolate 16Z11 envelope protein gene, partial cds 1685 1685 9% 0.0 99% KX173841.1 Select seq gb|KX173840.1| Zika virus isolate 16Z10 envelope protein gene, partial cds 1685 1685 9% 0.0 99% KX173840.1 Select seq gb|KJ873160.1| Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds 1633 1633 8% 0.0 99% KJ873160.1 Select seq gb|KX101064.1| Zika virus isolate Bahia11, partial genome 1616 9202 49% 0.0 99% KX101064.1 Select seq gb|KX173843.1| Zika virus isolate 16Z62 envelope protein gene, partial cds 1552 1552 8% 0.0 99% KX173843.1 Select seq gb|KX173844.1| Zika virus isolate 16Z62 envelope protein gene, partial cds 1541 1541 8% 0.0 99% KX173844.1 Select seq gb|KJ873161.1| Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds 1447 1447 7% 0.0 99% KJ873161.1 Select seq gb|KM851039.1| Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds 1408 1408 7% 0.0 99% KM851039.1 Select seq gb|KU985087.1| Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds 1378 1378 7% 0.0 99% KU985087.1 Select seq gb|KU556802.1| Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds 1373 1373 7% 0.0 99% KU556802.1 Select seq gb|KM851038.1| Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds 1363 1363 7% 0.0 98% KM851038.1 Select seq gb|KU724096.1| Zika virus isolate 259249_2015_Panama NS5B gene, partial cds 1330 1330 7% 0.0 99% KU724096.1 Select seq gb|KT200609.1| Zika virus isolate BR/949/15 NS5 gene, partial cds 1269 1269 6% 0.0 99% KT200609.1 Select seq gb|KU232300.1| Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds 1262 1262 6% 0.0 99% KU232300.1 Select seq gb|KU232290.1| Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds 1253 1253 6% 0.0 99% KU232290.1 Select seq gb|KU232297.1| Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds 1249 1249 6% 0.0 99% KU232297.1 Select seq gb|KU232294.1| Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds 1243 1243 6% 0.0 99% KU232294.1 Select seq gb|KU232292.1| Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds 1240 1240 6% 0.0 99% KU232292.1 Select seq gb|KU232298.1| Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds 1236 1236 6% 0.0 99% KU232298.1 Select seq gb|KU232296.1| Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds 1232 1232 6% 0.0 99% KU232296.1 Select seq gb|KU232293.1| Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds 1232 1232 6% 0.0 99% KU232293.1 Select seq gb|AF013415.1| Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds 1230 1230 10% 0.0 88% AF013415.1 Select seq gb|KU232295.1| Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds 1229 1229 6% 0.0 99% KU232295.1 Select seq gb|KU232288.1| Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds 1218 1218 6% 0.0 99% KU232288.1 Select seq gb|KU232289.1| Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds 1214 1214 6% 0.0 99% KU232289.1 Select seq gb|KX101063.1| Zika virus isolate Bahia05, partial genome 1212 7434 40% 0.0 99% KX101063.1 Select seq gb|KU232299.1| Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds 1210 1210 6% 0.0 99% KU232299.1 Select seq gb|KU724097.1| Zika virus isolate 259250_2015_Panama NS5B gene, partial cds 1206 1206 6% 0.0 100% KU724097.1 Select seq gb|KU232291.1| Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds 1205 1205 6% 0.0 99% KU232291.1 Select seq gb|KX101065.1| Zika virus isolate Bahia15, partial genome 1201 7394 39% 0.0 99% KX101065.1 Select seq gb|KU724098.1| Zika virus isolate 259060_2015_Panama NS5B gene, partial cds 1194 1194 6% 0.0 99% KU724098.1 Select seq gb|KU758878.1| Zika virus polyprotein gene, partial cds 1158 1158 6% 0.0 99% KU758878.1 Select seq gb|KU724099.1| Zika virus isolate 259032_2015_Panama NS5B gene, partial cds 1127 1127 5% 0.0 99% KU724099.1 Select seq gb|KX101062.1| Zika virus isolate Bahia04, partial genome 1077 7325 40% 0.0 97% KX101062.1 Select seq gb|KU867812.1| Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds 1042 1042 5% 0.0 100% KU867812.1 Select seq gb|KF270886.1| Zika virus strain CCB-870 envelope glycoprotein gene, partial cds 1014 1014 8% 0.0 89% KF270886.1 Select seq gb|KU724100.1| Zika virus isolate 259043_2015_Panama NS5B gene, partial cds 965 965 5% 0.0 99% KU724100.1 Select seq gb|KF383022.1| Zika virus strain ArD127988 envelope protein gene, partial cds 926 926 7% 0.0 89% KF383022.1 Select seq gb|KF270887.1| Zika virus strain CCB-870 NS3 protein gene, partial cds 922 922 7% 0.0 88% KF270887.1 Select seq gb|KF383026.1| Zika virus strain ArD127994 envelope protein gene, partial cds 920 920 7% 0.0 89% KF383026.1 Select seq gb|AF372422.1|AF372422 Zika virus envelope protein (E) gene, partial cds 917 917 8% 0.0 87% AF372422.1 Select seq gb|KF383032.1| Zika virus strain ArD30101 envelope protein gene, partial cds 909 909 7% 0.0 88% KF383032.1 Select seq gb|EU303241.1| Zika virus note MR766 (p4 15/9/76) nonstructural protein 5 (NS5) gene, partial cds 905 905 7% 0.0 88% EU303241.1 Select seq gb|KF383037.1| Zika virus strain ArA506 envelope protein gene, partial cds 904 904 7% 0.0 88% KF383037.1 Select seq gb|KF383034.1| Zika virus strain ArD30156 envelope protein gene, partial cds 904 904 7% 0.0 88% KF383034.1 Select seq gb|KF383029.1| Zika virus strain ArD165522 envelope protein gene, partial cds 904 904 7% 0.0 88% KF383029.1 Select seq gb|KX247638.1| Zika virus isolate Dominican_Rep-Rus-3-2016 polyprotein gene, partial cds 898 898 4% 0.0 99% KX247638.1 Select seq gb|KF383036.1| Zika virus strain ArA975 envelope protein gene, partial cds 898 898 7% 0.0 88% KF383036.1 Select seq gb|KF383033.1| Zika virus strain AnD30332 envelope protein gene, partial cds 898 898 7% 0.0 88% KF383033.1 Select seq gb|KU978616.1| Zika virus isolate Dominican_Rep-Rus-2-2016 polyprotein gene, partial cds 893 893 4% 0.0 99% KU978616.1 Select seq gb|KF383039.1| Zika virus strain HD78788 envelope protein gene, partial cds 876 876 7% 0.0 88% KF383039.1 Select seq gb|KF383028.1| Zika virus strain ArD165531 envelope protein gene, partial cds 876 876 7% 0.0 88% KF383028.1 Select seq gb|KF383031.1| Zika virus strain ArD9957 envelope protein gene, partial cds 870 870 7% 0.0 88% KF383031.1 Select seq gb|KF383038.1| Zika virus strain ArA986 envelope protein gene, partial cds 865 865 7% 0.0 87% KF383038.1 Select seq gb|KF383046.1| Zika virus strain ArA982 envelope protein gene, partial cds 854 854 7% 0.0 87% KF383046.1 Select seq gb|KF383103.1| Zika virus strain ArA986 nonstructural protein 5 gene, partial cds 846 846 6% 0.0 88% KF383103.1 Select seq gb|KF383086.1| Zika virus strain ArA975 nonstructural protein 5 gene, partial cds 846 846 6% 0.0 88% KF383086.1 Select seq dbj|AB908162.1| Zika virus gene for polyprotein, partial cds, strain: ZIKV Hu/Tahiti/01u/2014NIID 846 846 4% 0.0 99% AB908162.1 Select seq gb|KU872850.1| Zika virus isolate Dominican Rep-Rus-2016, NS2 partial cds 837 837 4% 0.0 99% KU872850.1 Select seq gb|KF383045.1| Zika virus strain ArA27106 envelope protein gene, partial cds 837 837 7% 0.0 87% KF383045.1 Select seq gb|KF383043.1| Zika virus strain ArA27443 envelope protein gene, partial cds 832 832 7% 0.0 87% KF383043.1 Select seq gb|KX253994.1| Zika virus strain ZIKV/Homo sapiens/GER/GER-BNI-P2/2016 polyprotein gene, partial cds 826 826 4% 0.0 100% KX253994.1 Select seq gb|KF383041.1| Zika virus strain ArA27290 envelope protein gene, partial cds 826 826 7% 0.0 87% KF383041.1 Select seq gb|KX101067.1| Zika virus isolate Bahia12, partial genome 821 8707 48% 0.0 99% KX101067.1 Select seq gb|KF383042.1| Zika virus strain ArA27096 envelope protein gene, partial cds 821 821 7% 0.0 86% KF383042.1 Select seq gb|KF383104.1| Zika virus strain ArA982 nonstructural protein 5 gene, partial cds 813 813 6% 0.0 87% KF383104.1 Select seq gb|KF383085.1| Zika virus strain ArD9957 nonstructural protein 5 gene, partial cds 808 808 6% 0.0 87% KF383085.1 Select seq gb|KF383035.1| Zika virus strain MR1429 envelope protein gene, partial cds 804 804 7% 0.0 86% KF383035.1 Select seq gb|KF383106.1| Zika virus strain ArA27443 nonstructural protein 5 gene, partial cds 802 802 6% 0.0 87% KF383106.1 Select seq gb|KF383114.1| Zika virus strain AnD30332 nonstructural protein 5 gene, partial cds 797 797 6% 0.0 87% KF383114.1 Select seq gb|KF383107.1| Zika virus strain ArA27407 nonstructural protein 5 gene, partial cds 797 797 6% 0.0 87% KF383107.1 Select seq gb|KF383088.1| Zika virus strain ArD30101 nonstructural protein 5 gene, partial cds 797 797 6% 0.0 87% KF383088.1 Select seq gb|KF383087.1| Zika virus strain ArD30156 nonstructural protein 5 gene, partial cds 791 791 6% 0.0 87% KF383087.1 Select seq gb|KF383089.1| Zika virus strain ArD165531 nonstructural protein 5 gene, partial cds 774 774 6% 0.0 86% KF383089.1 Select seq gb|KF383101.1| Zika virus strain ArD127710 nonstructural protein 5 gene, partial cds 769 769 6% 0.0 86% KF383101.1 Select seq gb|KF383097.1| Zika virus strain ArD127994 nonstructural protein 5 gene, partial cds 769 769 6% 0.0 86% KF383097.1 Select seq gb|KF383099.1| Zika virus strain ArD127987 nonstructural protein 5 gene, partial cds 763 763 6% 0.0 86% KF383099.1 Select seq gb|KF383098.1| Zika virus strain ArD127988 nonstructural protein 5 gene, partial cds 758 758 6% 0.0 86% KF383098.1 Select seq gb|KF383113.1| Zika virus strain ArA1465 nonstructural protein 5 gene, partial cds 719 719 6% 0.0 85% KF383113.1 Select seq gb|KF258813.1| Zika virus isolate Java non-structural protein 5 mRNA, partial cds 704 704 3% 0.0 98% KF258813.1 Select seq gb|KX253995.1| Zika virus strain ZIKV/Homo sapiens/PRI/PRI-BNI-P1/2016 polyprotein gene, partial cds 697 697 3% 0.0 100% KX253995.1 Select seq gb|KU985088.1| Zika virus isolate MEX/InDRE/Zika-2/2015 envelope protein gene, partial cds 654 654 3% 0.0 99% KU985088.1 Select seq gb|KX062045.1| Zika virus isolate Haiti/1230/2014 envelope protein gene, partial cds 645 645 3% 6e-180 100% KX062045.1 Select seq gb|KX062044.1| Zika virus isolate Haiti/1227/2014 envelope protein gene, partial cds 640 640 3% 3e-178 99% KX062044.1 Select seq gb|KF383017.1| Zika virus strain ArD149938 envelope protein gene, partial cds 604 604 7% 1e-167 81% KF383017.1 Select seq gb|KR815989.1| Zika virus isolate 15095 envelope protein gene, partial cds 599 599 3% 5e-166 99% KR815989.1 Select seq gb|KF383016.1| Zika virus strain ArD147917 envelope protein gene, partial cds 599 599 7% 5e-166 81% KF383016.1 Select seq gb|KF383015.1| Zika virus strain ArD149810 envelope protein gene, partial cds 599 599 7% 5e-166 81% KF383015.1 Select seq gb|KX173842.1| Zika virus isolate 16Z08 envelope protein gene, partial cds 592 592 3% 8e-164 99% KX173842.1 Select seq gb|KF383021.1| Zika virus strain ArD132912 envelope protein gene, partial cds 592 592 7% 8e-164 81% KF383021.1 Select seq gb|KF383020.1| Zika virus strain ArA1465 envelope protein gene, partial cds 592 592 7% 8e-164 81% KF383020.1 Select seq gb|KF383019.1| Zika virus strain ArD132915 envelope protein gene, partial cds 577 577 7% 2e-159 81% KF383019.1 Select seq gb|KF383092.1| Zika virus strain ArD147917 nonstructural protein 5 gene, partial cds 566 566 6% 5e-156 81% KF383092.1 Select seq gb|KF383093.1| Zika virus strain ArD149810 nonstructural protein 5 gene, partial cds 564 564 6% 2e-155 81% KF383093.1 Select seq gb|KR816334.1| Zika virus isolate BR/UFBA/LabViro/Ex1 envelope protein gene, partial cds 556 556 2% 3e-153 99% KR816334.1 Select seq gb|KR816333.1| Zika virus isolate BR/UFBA/LabViro/23 envelope protein gene, partial cds 555 555 2% 1e-152 99% KR816333.1

LOCUS KX766029 10749 bp RNA linear VRL 26-AUG-2016 DEFINITION Zika virus isolate R116265, complete genome. ACCESSION KX766029 VERSION KX766029.1 GI:1059853344 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10749) AUTHORS Lanciotti,R.S. TITLE Direct Submission JOURNAL Submitted (23-AUG-2016) Diagnostic & Reference Laboratory, Arbovirus Diseases Branch, Centers for Disease Control & Prevention, 3150 Rampart Road, Fort Collins, CO 80521, USA COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. 7 Sequencing Technology :: IonTorrent ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10749 /organism="Zika virus" /mol_type="genomic RNA" /isolate="R116265" /host="Homo sapiens" /db_xref="taxon:64320" /country="Mexico" /collection_date="23-Jun-2016" CDS 103..10374 /note="C-prM/M-E-NS1-NS2a-NS2b-NS3-NS4A-NS4B-NS5" /codon_start=1 /product="polyprotein" /protein_id="AOG18296.1" /db_xref="GI:1059853345" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRAPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAEDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGIMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIL EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRTPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 ttgatctgyg tgaatcagac tgcgacagtt cgagtttgaa gcgaaagcta gcaacagtat 61 caacaggttt tattttggat ttggaaacga gagtttctgg tcatgaaaaa cccaaaaaag 121 aaatccggag gattccggat tgtcaatatg ctaaaacgcg gagtagcccg tgtgagcccc 181 tttgggggct tgaagaggct gccagccgga cttctgctgg gtcatgggcc catcaggatg 241 gtcttggcga ttctagcctt tttgagattc acggcaatca agccatcact gggtctcatc 301 aatagatggg gttcagtggg gaaaaaagag gctatggaaa taataaagaa gttcaagaaa 361 gatctggctg ccatgctgag aataatcaat gctaggaagg agaagaagag acgaggcgca 421 gatactagtg tcggaattgt tggcctcctg ctgaccacag ctatggcagc ggaggtcact 481 agacgtggga gtgcatacta tatgtacttg gacagaaacg atgctgggga ggccatatct 541 tttccaacca cattggggat gaataagtgt tatatacaga tcatggatct tggacacatg 601 tgtgatgcca ccatgagcta tgaatgccct atgctggatg agggggtgga accagatgac 661 gtcgattgtt ggtgcaacac gacgtcaact tgggttgtgt acggaacctg ccatcacaaa 721 aaaggtgaag cacggagatc tagaagagct gtgacgctcc cctcccattc cactaggaag 781 ctgcaaacgc ggtcgcaaac ctggttggaa tcaagagaat acacaaagca cttgattaga 841 gtcgaaaatt ggatattcag gaaccctggc ttcgcgttag cagcagctgc catcgcttgg 901 cttttgggaa gctcaacgag ccaaaaagtc atatacttgg tcatgatact gctgattgcc 961 ccggcataca gcatcaggtg cataggagtc agcaataggg actttgtgga aggtatgtca 1021 ggtgggactt gggttgatgt tgtcttggaa catggaggtt gtgtcaccgt aatggcacag 1081 gacaaaccga ctgtcgacat agagctggtc acaacaacag tcagcaacat ggcggaggta 1141 agatcctact gctatgaggc atcaatatca gacatggctt cggacagccg ctgcccaaca 1201 caaggtgaag cctaccttga caagcaatca gacactcaat atgtctgtaa aagaacgtta 1261 gtggacagag gctggggaaa tggatgtgga ctttttggca aagggagcct ggtgacatgc 1321 gctaagtttg cttgctccaa gaaaatgacc gggaagagca tccagccaga gaatctggag 1381 taccggataa tgctgtcagt tcatggctcc cagcacagtg ggatgatcgt taatgacaca 1441 ggacatgaaa ctgatgagaa tagagcgaag gttgagataa cgcccaattc accaagagcc 1501 gaagccaccc tggggggttt tggaagccta ggacttgatt gtgaaccgag gacaggcctt 1561 gacttttcag atttgtatta cttgactatg aataacaagc actggttggt tcacaaggag 1621 tggttccacg acattccatt accttggcac gctggggcag acaccggaac tccacactgg 1681 aacaacaaag aagcactggt agagttcaag gacgcacatg ccaaaaggca aactgtcgtg 1741 gttctaggga gtcaagaagg agcagttcac acggcccttg ctggagctct ggaggctgag 1801 atggatggtg caaagggaag gctgtcctct ggccacttga aatgtcgcct gaaaatggat 1861 aaacttagat tgaagggcgt gtcatactcc ttgtgtaccg cagcgttcac attcaccaag 1921 atcccggctg aaacactgca cgggacagtc acagtggagg tacagtacgc agggacagat 1981 ggaccttgca aggttccagc tcagatggcg gtggacatgc aaactctgac cccagttggg 2041 aggttgataa ccgctaaccc cgtaatcact gaaagcactg agaactctaa gatgatgctg 2101 gaacttgatc caccatttgg ggactcttac attgtcatag gagtcgggga gaagaagatc 2161 acccaccact ggcacaggag tggcagcacc attggaaaag catttgaagc cactgtgaga 2221 ggtgccaaga gaatggcagt cttgggagac acagcctggg actttggatc agttggaggc 2281 gctctcaact cattgggcaa gggcatccat caaatttttg gagcagcttt caaatcattg 2341 tttggaggaa tgtcctggtt ctcacaaatt ctcattggaa cgttgctgat gtggttgggt 2401 ctgaacacaa agaatggatc tatttccctt atgtgcttgg ccttaggggg agtgttgatc 2461 ttcttatcca cagccgtctc tgctgatgtg gggtgctcgg tggacttctc aaagaaggag 2521 acgagatgcg gtacaggggt gttcgtctat aacgacgttg aagcctggag ggacaggtat 2581 aagtaccatc ctgactcccc ccgtagattg gcagcagcag tcaagcaagc ctgggaagat 2641 ggtatctgcg ggatctcctc tgtttcaaga atggaaaaca tcatgtggag atcagtagaa 2701 ggggagctca acgcaatcct ggaagagaat ggagttcaac tgacggtcgt tgtgggatct 2761 gtaaaaaacc ccatgtggag agctccacag agattgcccg tgcctgtgaa cgagctgccc 2821 cacggctgga aggcttgggg gaaatcgtac ttcgttagag cagcaaagac aaataacagc 2881 tttgtcgtgg atggtgacac actgaaggaa tgcccactca aacatagagc atggaacagc 2941 tttcttgtgg aggatcatgg gttcggggta ttccacacta gtgtctggct caaggttaga 3001 gaagattatt cattagagtg tgatccagcc gttattggaa cagctgtcaa gggaaaggag 3061 gctgtacaca gtgatctagg ctactggatt gagagtgaga agaatgacac atggaggctg 3121 aagagggccc atctgatcga gatgaaaaca tgtgaatggc caaagtccca cacattgtgg 3181 acagatggaa tagaagagag tgatctgatc atacccaagt ctttagctgg gccactcagc 3241 catcacaata ccagagaggg ctacaggacc caaatgaaag ggccatggca cagtgaagag 3301 cttgaaattc ggtttgagga atgcccaggc actaaggtcc acgtggagga aacatgtgga 3361 acaagaggac catctctgag atcaaccact gcaagcggaa gggtgatcga ggaatggtgc 3421 tgcagggagt gcacaatgcc cccactgtcg ttccgggctg aagatggctg ttggtatgga 3481 atggagataa ggcccaggaa agaaccagaa agcaacttag taaggtcaat ggtgactgca 3541 ggatcaactg atcacatgga tcacttctcc cttggagtgc ttgtgattct gctcatggtg 3601 caggaagggc taaagaagag aatgaccaca aagatcatca taagcacatc aatggcagtg 3661 ctggtagcta tgatcctggg aggattttca atgagtgacc tggctaagct tgcaattttg 3721 atgggtgcca ccttcgcgga aatgaacact ggaggagatg tagctcatct ggcgctgata 3781 gcggcattca aagtcagacc agcgttgctg gtatctttca tcttcagagc taattggaca 3841 ccccgtgaaa gcatgctact ggccttggcc tcgtgtcttt tgcaaactgc gatctccgcc 3901 ttggaaggcg acctgatggt tctcatcaat ggttttgctt tggcctggtt ggcaatacga 3961 gcgatggttg ttccacgcac tgataacatc accttggcaa tcctggctgc tctgacacca 4021 ctggcccggg gcacactgct tgtggcgtgg agagcaggcc ttgctacttg cggggggttt 4081 atgctcctct ctctgaaggg aaaaggcagt gtgaagaaga acttaccatt tgtcatggcc 4141 ctgggactaa ccgctgtgag gctggtcgac cccatcaacg tggtgggact gctgttgctc 4201 acaaggagtg ggaagcggag ctggccccct agcgaagtac tcacagctgt tggcctgata 4261 tgcgcattgg ctggagggtt cgccaaggca gatatagaga tggctgggcc catggccgcg 4321 gtcggtctgc taattgtcag ttacgtggtc tcaggaaaga gtgtggacat gtacattgaa 4381 agagcaggtg acatcacatg ggaaaaagat gcggaagtca ctggaaacag tccccggctc 4441 gatgtggcgc tagatgagag tggtgatttc tccctggtgg aggatgacgg tccccccatg 4501 agagagatca tactcaaggt ggtcctgatg accatctgtg gcatgaaccc aatagccata 4561 ccctttgcag ctggagcgtg gtacgtatac gtgaagactg ggaaaaggag tggtgctcta 4621 tgggatgtgc ctgctcccaa ggaagtaaaa aagggggaga ccacagatgg agtgtacaga 4681 gtaatgactc gtagactgct aggttcaaca caagttggag tgggaattat gcaagagggg 4741 gtctttcaca ctatgtggca cgtcacaaaa ggatccgcac tgagaagcgg tgaagggaga 4801 cttgatccat actggggaga tgtcaagcag gatctggtgt catactgtgg tccatggaag 4861 ctagatgccg cctgggacgg gcacagcgag gtgcagctct tggccgtgcc ccccggagag 4921 agagcgagga acatccagac tctgcccgga atatttaaga caaaggatgg ggacattgga 4981 gcggttgcgc tggattaccc agcaggaact tcaggatctc caatcctaga caagtgtggg 5041 agagtgatag gactttatgg caatggggtc gtgatcaaaa acgggagtta tgttagtgcc 5101 atcacccaag ggaggaggga ggaagagact cctgttgagt gcttcgagcc ttcgatgctg 5161 aagaagaagc agctaactgt cttagactta catcctggag ctgggaaaac caggagagtt 5221 cttcctgaaa tagtccgtga agccataaaa acaagactcc gtactgtgat cttagctcca 5281 accagggttg tcgctgctga aatggaggag gcccttagag ggcttccagt gcgttatatg 5341 acaacagcag tcaatgtcac ccactctgga acagaaatcg tcgacttaat gtgccatgcc 5401 accttcactt cacgtctact acagccaatc agagtcccca actataatct gtatattatg 5461 gatgaggccc acttcacaga tccctcaagt atagcagcaa gaggatacat ttcaacaagg 5521 gttgagatgg gcgaggcggc tgccatcttc atgaccgcca cgccaccagg aacccgtgac 5581 gcatttccgg actccaactc accaattatg gacaccgaag tggaagtccc agagagagcc 5641 tggagctcag gctttgattg ggtgacggat cattctggga aaacagtttg gtttgttcca 5701 agcgtgagga acggcaatga gatcgcagct tgtctgacaa aggctggaaa acgggtcata 5761 cagctcagca gaaagacttt tgagacagag ttccagaaaa caaaacatca agagtgggac 5821 tttgtcgtga caactgacat ttcagagatg ggcgccaact ttaaagctga ccgtgtcata 5881 gattccagga gatgcctaaa gccggtcata cttgatggcg agagagtcat tctggctgga 5941 cccatgcctg tcacacatgc cagcgctgcc cagaggaggg ggcgcatagg caggaatccc 6001 aacaaacctg gagatgagta tctgtatgga ggtgggtgcg cagagactga cgaagaccat 6061 gcacactggc ttgaagcaag aatgctcctt gacaatattt acctccaaga tggcctcata 6121 gcctcgctct atcgacctga ggccgacaaa gtagcagcca ttgagggaga gttcaagctt 6181 aggacggagc aaaggaagac ctttgtggaa ctcatgaaaa gaggagatct tcctgtttgg 6241 ctggcctatc aggttgcatc tgccggaata acctacacag atagaagatg gtgctttgat 6301 ggcacgacca acaacaccat actggaagac agtgtgccgg cagaggtgtg gaccagacac 6361 ggagagaaaa gagtgctcaa accgaggtgg atggacgcca gagtttgttc agatcatgcg 6421 gccctgaagt cattcaagga gtttgccgct ggaaaaagag gagcggcttt tggggtgatg 6481 gaagccctgg gaacactgcc aggacacatg acagagagat tccaggaagc cattgacaac 6541 ctcgctgtgc tcatgcgggc agagactgga agcaggcctt acaaagccgc ggcggcccaa 6601 ttgccggaga ccctagagac cattatgctt ttggggttgc tgggaacagt ctcgctggga 6661 atctttttcg tcttgatgag gaacaagggc atagggaaga tgggctttgg aatggtgacc 6721 cttggggcca gtgcatggct catgtggctc tcggaaattg agccagccag aattgcatgt 6781 gtcctcattg ttgtgttcct attgctggtg gtgctcatac ctgagccaga aaagcaaaga 6841 tctccccagg acaaccaaat ggcaatcatc atcatggtag cagtaggtct tctgggcttg 6901 attaccgcca atgaactcgg atggttggag agaacaaaga gtgacctaag ccatctaatg 6961 ggaaggagag aggagggggc aaccatagga ttctcaatgg acattgacct gcggccagcc 7021 tcagcttggg ccatctatgc tgccttgaca actttcatta ccccagccgt ccaacatgca 7081 gtgaccactt catacaacaa ctactcctta atggcgatgg ccacgcaagc tggagtgttg 7141 tttggtatgg gcaaagggat gccattctac gcatgggact ttggagtccc gctactaatg 7201 ataggttgct actcacaatt aacacccctg accctaatag tggccatcat tttgctcgtg 7261 gcgcactaca tgtacttgat cccagggctg caggcagcag ccgcgcgtgc tgcccagaag 7321 agaacggcag ctggcatcat gaagaaccct gttgtggatg gaatagtggt gactgacatt 7381 gacacaatga caattgaccc ccaagtggag aaaaagatgg gacaggtgct actcatagca 7441 gtagccgtct ccagcgccat actgtcgcgg accgcctggg ggtgggggga ggctggggcc 7501 ctgatcacag ccgcaacttc cactttgtgg gaaggctctc cgaacaagta ctggaactcc 7561 tctacagcca cttcactgtg taacattttt aggggaagtt acttggctgg agcttctcta 7621 atctacacag taacaagaaa cgctggcttg gtcaagagac gtgggggtgg aacaggagag 7681 accctgggag agaaatggaa ggcccgcttg aaccagatgt cggccctgga gttctactcc 7741 tacaaaaagt caggcatcac cgaggtgtgc agagaagagg cccgccgcgc cctcaaggac 7801 ggtgtggcaa cgggaggcca tgctgtgtcc cgaggaagtg caaagctgag atggttggtg 7861 gagcggggat acctgcagcc ctatggaaag gtcattgatc ttggatgtgg cagagggggc 7921 tggagttact acgccgccac catccgcaaa gttcaagaag tgaaaggata cacaaaagga 7981 ggccctggtc atgaggaacc cgtgttggtg caaagctatg ggtggaacat agtccgtctt 8041 aagagtgggg tggacgtctt tcatatggcg gctgagccgt gtgacacgtt gctgtgtgac 8101 ataggtgagt catcatctag tcctgaagtg gaagaagcac ggacgctcag agtcctctcc 8161 atggtggggg attggcttga aaaaagacca ggagcctttt gtataaaagt gttgtgccca 8221 tacaccagca ctatgatgga aaccctggag cgactgcagc gtaggtatgg gggaggactg 8281 gtcagagtgc cactatcccg caactctaca catgagatgt actgggtctc tggagcgaaa 8341 agcaacacca taaaaagtgt gtccaccacg agccagctcc tcttggggcg catggacggg 8401 cctaggaggc cagtgaaata tgaggaggat gtgaatctcg gctctggcac gcgggctgtg 8461 gtaagctgcg ctgaagctcc caacatgaag atcattggta accgcattga aaggatccgc 8521 agtgagcacg cggaaacgtg gttctttgac gagaaccacc catataggac atgggcttac 8581 catggaagct atgaggcccc cacacaaggg tcagcgtcct ctctaataaa cggggttgtc 8641 aggctcctgt caaaaccctg ggatgtggtg actggagtca caggaatagc catgaccgac 8701 accacaccgt atggtcagca aagagttttc aaggaaaaag tggacactag ggtgccagac 8761 ccccaagaag gcactcgtca ggttatgagc atggtctctt cctggttgtg gaaagagcta 8821 ggcaaacaca aacggccacg agtctgtacc aaagaagagt tcatcaacaa ggttcgtagc 8881 aatgcagcat taggggcaat atttgaagag gaaaaagagt ggaagactgc agtggaagct 8941 gtgaacgatc caaggttctg ggctctagtg gacaaggaaa gagagcacca cctgagagga 9001 gagtgccaga gttgtgtgta caacatgatg ggaaaaagag aaaagaaaca aggggaattt 9061 ggaaaggcca agggcagccg cgccatctgg tatatgtggc taggggctag atttctagag 9121 ttcgaagccc ttggattctt gaacgaggat cactggatgg ggagagagaa ctcaggaggt 9181 ggtgttgaag ggctgggatt acaaagactc ggatatgtcc tagaagagat gagtcgcaca 9241 ccaggaggaa ggatgtatgc agatgacact gctggctggg acacccgcat cagcaggttt 9301 gacctggaga atgaagctct aatcaccaac caaatggaga aagggcacag ggccttggca 9361 ttggccataa tcaagtacac ataccaaaac aaagtggtaa aggtccttag accagctgaa 9421 aaagggaaaa cagttatgga cattatttcg agacaagacc aaagggggag cggacaagtt 9481 gtcacttacg ctcttaacac atttaccaac ctagtggtgc aactcattcg gaatatggag 9541 gctgaggaag ttctagagat gcaagacttg tggctgctgc ggaggtcaga gaaagtgacc 9601 aactggttgc agagcaacgg atgggatagg ctcaaacgaa tggcagtcag tggagatgat 9661 tgcgttgtga agccaattga tgataggttt gcacatgccc tcaggttctt gaatgatatg 9721 ggaaaagtta ggaaggacac acaagagtgg aaaccctcaa ctggatggga caactgggaa 9781 gaagttccgt tttgctccca ccacttcaac aagctccatc tcaaggacgg gaggtccatt 9841 gtggttccct gccgccacca agatgaactg attggccggg cccgcgtctc tccaggggcg 9901 ggatggagca tccgggagac tgcttgccta gcaaaatcat atgcgcaaat gtggcagctc 9961 ctttatttcc acagaaggga cctccgactg atggccaatg ccatttgttc atctgtgcca 10021 gttgactggg ttccaactgg gagaactacc tggtcaatcc atggaaaggg agaatggatg 10081 accactgaag acatgcttgt ggtgtggaac agagtgtgga ttgaggagaa cgaccacatg 10141 gaagacaaga ccccagttac gaaatggaca gacattccct atttgggaaa aagggaagac 10201 ttgtggtgtg gatctctcat agggcacaga ccgcgcacca cctgggctga gaacattaaa 10261 aacacagtca acatggtgcg caggatcata ggtgatgaag aaaagtacat ggactaccta 10321 tccacccaag ttcgctactt gggtgaagaa gggtctacac ctggagtgct gtaagcacca 10381 atcttaatgt tgtcaggcct gctagtcagc cacagcttgg ggaaagctgt gcagcctgtg 10441 acccccccag gagaagctgg gaaaccaagc ctatagtcag gccgagaacg ccatggcacg 10501 gaagaagcca tgctgcctgt gagcccctca gaggacactg agtcaaaaaa ccccacgcgc 10561 ttggaggcgc aggatgggaa aagaaggtgg cgaccttccc cacccttcaa tctggggcct 10621 gaactggaga tcagctgtgg atctccagaa gagggactag tggttagagg agaccccccg 10681 gaaaacgcaa aacagcatat tgacgctggg aaagaccaga gactccatga gtttccacca 10741 cgctggccg

LOCUS KX766029 10749 bp RNA linear VRL 26-AUG-2016 DEFINITION Zika virus isolate R116265, complete genome. ACCESSION KX766029 VERSION KX766029.1 GI:1059853344 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10749) AUTHORS Lanciotti,R.S. TITLE Direct Submission JOURNAL Submitted (23-AUG-2016) Diagnostic & Reference Laboratory, Arbovirus Diseases Branch, Centers for Disease Control & Prevention, 3150 Rampart Road, Fort Collins, CO 80521, USA COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. 7 Sequencing Technology :: IonTorrent ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10749 /organism="Zika virus" /mol_type="genomic RNA" /isolate="R116265" /host="Homo sapiens" /db_xref="taxon:64320" /country="Mexico" /collection_date="23-Jun-2016"

Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 18966 18966 100% 0.0 100% KX766028.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 18888 18888 100% 0.0 99% KU740184.2 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 18888 18888 100% 0.0 99% KU761564.1 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 18883 18883 100% 0.0 99% KX056898.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 18877 18877 100% 0.0 99% KU820898.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 18872 18872 100% 0.0 99% KU955590.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 18800 18800 100% 0.0 99% KU758877.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 18794 18794 100% 0.0 99% KU707826.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 18794 18794 100% 0.0 99% KU365779.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 18788 18788 100% 0.0 99% KU365778.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 18777 18777 100% 0.0 99% KU937936.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 18777 18777 100% 0.0 99% KU501215.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 18777 18777 100% 0.0 99% KU365780.1 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 18777 18777 100% 0.0 99% KU312312.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 18772 18772 100% 0.0 99% KX447510.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 18772 18772 100% 0.0 99% KX601168.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 18772 18772 100% 0.0 99% KX087101.2 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 18772 18772 100% 0.0 99% KU365777.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 18766 18766 100% 0.0 99% KX377337.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 18761 18761 100% 0.0 99% KX447512.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 18761 18761 100% 0.0 99% KX369547.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 18761 18761 100% 0.0 99% KU509998.3 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 18755 18755 100% 0.0 99% KX447511.1 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 18755 18755 100% 0.0 99% KX447509.1 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 18755 18755 100% 0.0 99% KU991811.1 Select seq gb|KJ776791.1| Zika virus strain H/PF/2013 polyprotein gene, complete cds 18755 18755 100% 0.0 99% KJ776791.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 18750 18750 100% 0.0 99% KX447513.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 18750 18750 100% 0.0 99% KX198135.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 18744 18744 100% 0.0 99% KX447515.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 18744 18744 100% 0.0 99% KX280026.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 18744 18744 100% 0.0 99% KU321639.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 18739 18739 100% 0.0 99% KX447514.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 18739 18739 100% 0.0 99% KX262887.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 18739 18739 100% 0.0 99% KX051563.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 18733 18733 100% 0.0 99% KX447516.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 18733 18733 100% 0.0 99% KU729218.1 Select seq gb|KX694534.1| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 18727 18727 100% 0.0 99% KX694534.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 18727 18727 100% 0.0 99% KX247646.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 18727 18727 100% 0.0 99% KX197192.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 18727 18727 100% 0.0 99% KU926309.1 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 18716 18716 100% 0.0 99% KU820897.5 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 18716 18716 100% 0.0 99% KX156776.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 18716 18716 100% 0.0 99% KX087102.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 18716 18716 100% 0.0 99% KU501217.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 18713 18713 99% 0.0 99% KU497555.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 18711 18711 100% 0.0 99% KX156774.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 18711 18711 100% 0.0 99% KU940228.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 18711 18711 100% 0.0 99% KU729217.2 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 18711 18711 100% 0.0 99% KU647676.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 18711 18711 100% 0.0 99% KU501216.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 18705 18705 100% 0.0 99% KX447517.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 18705 18705 100% 0.0 99% KX247632.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 18705 18705 100% 0.0 99% KX156775.1 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 18700 18700 100% 0.0 99% KU527068.1 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 18694 18694 100% 0.0 99% KX702400.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 18694 18694 100% 0.0 99% KX446951.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 18689 18689 100% 0.0 99% KX520666.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 18689 18689 100% 0.0 99% KX446950.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 18689 18689 100% 0.0 99% KU870645.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 18689 18689 100% 0.0 99% KU922960.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 18683 18683 100% 0.0 99% KX548902.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 18683 18683 100% 0.0 99% KU926310.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 18683 18683 100% 0.0 99% KU922923.1 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 18672 18672 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 18670 18670 100% 0.0 99% KU853012.1 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 18661 18661 100% 0.0 99% KX766029.1 Select seq gb|KX673530.1| Zika virus isolate PHE_semen_Guadeloupe, complete genome 18644 18644 100% 0.0 99% KX673530.1 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 18644 18644 100% 0.0 99% KX117076.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 18633 18633 100% 0.0 99% KX185891.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 18633 18633 100% 0.0 99% KU963796.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 18628 18628 100% 0.0 99% KX253996.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 18628 18628 100% 0.0 99% KU955589.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 18628 18628 100% 0.0 99% KU820899.2 Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 18624 18624 100% 0.0 99% KX266255.1 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 18622 18622 100% 0.0 99% KU866423.2 Select seq gb|KU940224.1| Zika virus isolate Bahia09, partial genome 18613 18613 99% 0.0 99% KU940224.1 Select seq gb|KU744693.1| Zika virus isolate VE_Ganxian, complete genome 18511 18511 100% 0.0 99% KU744693.1 Select seq gb|KU681081.3| Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome 18356 18356 100% 0.0 99% KU681081.3 Select seq gb|KX694532.1| Zika virus strain ZIKV/Homo sapiens/THA/PLCal_ZV/2013, complete genome 18207 18207 100% 0.0 99% KX694532.1 Select seq gb|JN860885.1| Zika virus isolate FSS13025 polyprotein gene, partial cds 17981 17981 99% 0.0 98% JN860885.1 Select seq gb|KU955593.1| Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome 17980 17980 100% 0.0 98% KU955593.1 Select seq gb|KF993678.1| Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds 17970 17970 98% 0.0 99% KF993678.1 Select seq gb|EU545988.1| Zika virus polyprotein gene, complete cds 17795 17795 100% 0.0 98% EU545988.1 Select seq gb|KU681082.3| Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome 17608 17608 100% 0.0 98% KU681082.3 Select seq gb|KX447518.1| Zika virus isolate 1_0117_PF polyprotein gene, partial cds 16571 16571 88% 0.0 99% KX447518.1 Select seq gb|KX601167.1| Zika virus strain ZIKV/Aedes sp./MYS/P6-740/1966, complete genome 16373 16373 99% 0.0 95% KX601167.1 Select seq gb|HQ234499.1| Zika virus isolate P6-740 polyprotein gene, partial cds 16367 16367 99% 0.0 95% HQ234499.1 Select seq gb|KX694533.1| Zika virus strain ZIKV/Aedes aegypti/MYS/P6-740/1966, complete genome 16362 16362 99% 0.0 95% KX694533.1 Select seq gb|KX377336.1| Zika virus strain P6-740, complete genome 16356 16356 99% 0.0 95% KX377336.1 Select seq gb|KF383115.1| Zika virus strain ArB1362 polyprotein gene, complete cds 12630 12630 100% 0.0 89% KF383115.1 Select seq gb|KU720415.1| Zika virus strain MR 766 polyprotein gene, complete cds 12595 12595 100% 0.0 89% KU720415.1 Select seq gb|HQ234498.1| Zika virus isolate MR_766 polyprotein gene, partial cds 12589 12589 99% 0.0 89% HQ234498.1 Select seq gb|KX377335.1| Zika virus strain MR-766, complete genome 12578 12578 100% 0.0 89% KX377335.1 Select seq gb|KF268949.1| Zika virus isolate ARB15076 polyprotein gene, complete cds 12578 12578 100% 0.0 89% KF268949.1 Select seq gb|KU955595.1| Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome 12573 12573 100% 0.0 89% KU955595.1 Select seq gb|KF268948.1| Zika virus isolate ARB13565 polyprotein gene, complete cds 12569 12569 100% 0.0 89% KF268948.1 Select seq dbj|LC002520.1| Zika virus genomic RNA, complete genome, strain: MR766-NIID 12567 12567 100% 0.0 89% LC002520.1 Select seq gb|KF383119.1| Zika virus strain ArD158084 polyprotein gene, complete cds 12567 12567 100% 0.0 89% KF383119.1 Select seq gb|KU955592.1| Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome 12562 12562 100% 0.0 89% KU955592.1 Select seq gb|KF268950.1| Zika virus isolate ARB7701 polyprotein gene, complete cds 12562 12562 100% 0.0 89% KF268950.1 Select seq gb|KX198134.1| Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome 12545 12545 100% 0.0 89% KX198134.1 Select seq gb|KF383116.1| Zika virus strain ArD7117 polyprotein gene, complete cds 12545 12545 100% 0.0 89% KF383116.1 Select seq gb|KU955591.1| Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome 12539 12539 100% 0.0 89% KU955591.1 Select seq gb|KX601169.1| Zika virus strain ZIKV/Macaca mulatta/UGA/MR-766/1947, complete genome 12534 12534 100% 0.0 89% KX601169.1 Select seq gb|KU963573.1| Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds 12534 12534 100% 0.0 89% KU963573.1 Select seq gb|KU955594.1| Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome 12534 12534 100% 0.0 89% KU955594.1 Select seq gb|DQ859059.1| Zika virus strain MR 766 polyprotein gene, complete cds 12523 12523 100% 0.0 89% DQ859059.1 Select seq gb|HQ234501.1| Zika virus isolate ArD_41519 polyprotein gene, partial cds 12502 12502 99% 0.0 89% HQ234501.1 Select seq gb|AY632535.2| Zika virus strain MR 766, complete genome 12495 12495 100% 0.0 89% AY632535.2 Select seq gb|KF383117.1| Zika virus strain ArD128000 polyprotein gene, complete cds 12478 12478 100% 0.0 89% KF383117.1 Select seq gb|KX601166.1| Zika virus strain ZIKV/Aedes africanus/SEN/DakAr41524/1984, complete genome 12454 12454 100% 0.0 89% KX601166.1 Select seq gb|KU963574.1| Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds 12410 12410 100% 0.0 89% KU963574.1 Select seq gb|HQ234500.1| Zika virus isolate IbH_30656 polyprotein gene, partial cds 12410 12410 99% 0.0 89% HQ234500.1 Select seq gb|KF383118.1| Zika virus strain ArD157995 polyprotein gene, complete cds 12205 12205 100% 0.0 88% KF383118.1 Select seq gb|KF383121.1| Zika virus strain ArD158095 polyprotein gene, partial cds 12185 12185 97% 0.0 89% KF383121.1 Select seq gb|KX447520.1| Zika virus isolate 1_0016_PF polyprotein gene, partial cds 11756 16156 86% 0.0 99% KX447520.1 Select seq gb|KX576684.1| Zika virus vector pZIKV-ICD, complete sequence 11140 18743 100% 0.0 99% KX576684.1 Select seq gb|KX447519.1| Zika virus isolate 1_0199_PF polyprotein gene, partial cds 10213 16444 87% 0.0 99% KX447519.1 Select seq gb|KX447521.1| Zika virus isolate 1_0080_PF polyprotein gene, partial cds 10054 15285 81% 0.0 99% KX447521.1 Select seq gb|KF383120.1| Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence 9788 9788 97% 0.0 84% KF383120.1 Select seq gb|KU758871.1| Zika virus isolate 17170 polyprotein gene, partial cds 5110 5110 27% 0.0 99% KU758871.1 Select seq gb|KU758875.1| Zika virus isolate 15042 polyprotein gene, partial cds 5108 5108 27% 0.0 99% KU758875.1 Select seq gb|KX212103.1| Zika virus isolate BRZIKV_AB_ES polyprotein gene, partial cds 5105 5105 27% 0.0 99% KX212103.1 Select seq gb|KU758870.1| Zika virus isolate 17160 polyprotein gene, partial cds 5103 5103 27% 0.0 99% KU758870.1 Select seq gb|KU312314.1| Zika virus isolate Z1106031 polyprotein gene, partial cds 5101 5101 27% 0.0 99% KU312314.1 Select seq gb|KU758873.1| Zika virus isolate 18246 polyprotein gene, partial cds 5099 5099 27% 0.0 99% KU758873.1 Select seq gb|KU758872.1| Zika virus isolate 01170 polyprotein gene, partial cds 5084 5084 27% 0.0 99% KU758872.1 Select seq gb|KU758876.1| Zika virus isolate 21068 polyprotein gene, partial cds 5072 5072 27% 0.0 99% KU758876.1 Select seq gb|KU312313.1| Zika virus isolate Z1106032 polyprotein gene, partial cds 5068 5068 27% 0.0 99% KU312313.1 Select seq gb|KU758869.1| Zika virus isolate 05211 polyprotein gene, partial cds 5046 5046 26% 0.0 99% KU758869.1 Select seq gb|KU758868.1| Zika virus isolate 27229 polyprotein gene, partial cds 5020 5020 26% 0.0 99% KU758868.1 Select seq gb|KU758874.1| Zika virus isolate 20114 polyprotein gene, partial cds 5014 5014 26% 0.0 99% KU758874.1 Select seq gb|KU646828.1| Zika virus isolate Si322 polyprotein gene, partial cds 4750 4750 25% 0.0 99% KU646828.1 Select seq gb|KU646827.1| Zika virus isolate Si323 polyprotein gene, partial cds 4739 4739 25% 0.0 99% KU646827.1 Select seq gb|KU940227.1| Zika virus isolate Bahia08, partial genome 4532 14500 78% 0.0 98% KU940227.1 Select seq gb|KU312315.1| Zika virus isolate Z1106027 polyprotein gene, partial cds 3530 3530 18% 0.0 99% KU312315.1 Select seq gb|KU740199.1| Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds 3310 3310 17% 0.0 99% KU740199.1 Select seq gb|KX101066.1| Zika virus isolate Bahia01, partial genome 3181 13110 71% 0.0 99% KX101066.1 Select seq gb|KX101060.1| Zika virus isolate Bahia02, partial genome 2848 10207 54% 0.0 99% KX101060.1 Select seq gb|KJ634273.1| Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds 2750 2750 14% 0.0 99% KJ634273.1 Select seq dbj|LC171327.1| Zika virus gene for polyprotein, partial cds, strain: ZIKV/Hu/Chiba/S36/2016 2745 2745 14% 0.0 99% LC171327.1 Select seq gb|KU686218.1| Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds 2087 2087 11% 0.0 99% KU686218.1 Select seq gb|KU179098.1| Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds 2043 2043 11% 0.0 99% KU179098.1 Select seq gb|KU886298.1| Zika virus isolate MN NS5 gene, partial cds 1893 1893 10% 0.0 99% KU886298.1 Select seq gb|KX101061.1| Zika virus isolate Bahia03, partial genome 1879 13816 74% 0.0 99% KX101061.1 Select seq gb|KX059014.1| Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds 1864 1864 9% 0.0 99% KX059014.1 Select seq gb|KX059013.1| Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds 1864 1864 9% 0.0 99% KX059013.1 Select seq gb|KM078936.1| Zika virus strain CHI1410214 NS5 protein gene, partial cds 1775 1775 9% 0.0 99% KM078936.1 Select seq gb|KM078961.1| Zika virus strain CHI2612114 NS5 protein gene, partial cds 1772 1772 9% 0.0 99% KM078961.1 Select seq gb|KM078930.1| Zika virus strain CHI2283714 NS5 protein gene, partial cds 1770 1770 9% 0.0 99% KM078930.1 Select seq gb|KM078971.1| Zika virus strain CHI2613014 NS5 protein gene, partial cds 1766 1766 9% 0.0 99% KM078971.1 Select seq gb|KM078970.1| Zika virus strain CHI2490414 NS5 protein gene, partial cds 1766 1766 9% 0.0 99% KM078970.1 Select seq gb|KM078933.1| Zika virus strain CHI1058514 NS5 protein gene, partial cds 1766 1766 9% 0.0 99% KM078933.1 Select seq gb|KM078929.1| Zika virus strain CHI1805214 NS5 protein gene, partial cds 1764 1764 9% 0.0 99% KM078929.1 Select seq gb|KX173841.1| Zika virus isolate 16Z11 envelope protein gene, partial cds 1692 1692 9% 0.0 99% KX173841.1 Select seq gb|KX173840.1| Zika virus isolate 16Z10 envelope protein gene, partial cds 1692 1692 9% 0.0 99% KX173840.1 Select seq gb|KJ873160.1| Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds 1628 1628 8% 0.0 99% KJ873160.1 Select seq gb|KX101064.1| Zika virus isolate Bahia11, partial genome 1611 9199 49% 0.0 99% KX101064.1 Select seq gb|KX173843.1| Zika virus isolate 16Z62 envelope protein gene, partial cds 1559 1559 8% 0.0 99% KX173843.1 Select seq gb|KX173844.1| Zika virus isolate 16Z62 envelope protein gene, partial cds 1548 1548 8% 0.0 99% KX173844.1 Select seq gb|KJ873161.1| Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds 1441 1441 7% 0.0 99% KJ873161.1 Select seq gb|KM851039.1| Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds 1402 1402 7% 0.0 99% KM851039.1 Select seq gb|KU985087.1| Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds 1373 1373 7% 0.0 99% KU985087.1 Select seq gb|KU556802.1| Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds 1367 1367 7% 0.0 99% KU556802.1 Select seq gb|KM851038.1| Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds 1358 1358 7% 0.0 98% KM851038.1 Select seq gb|KU724096.1| Zika virus isolate 259249_2015_Panama NS5B gene, partial cds 1336 1336 7% 0.0 99% KU724096.1 Select seq gb|KT200609.1| Zika virus isolate BR/949/15 NS5 gene, partial cds 1264 1264 6% 0.0 99% KT200609.1 Select seq gb|KU232290.1| Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds 1258 1258 6% 0.0 99% KU232290.1 Select seq gb|KU232300.1| Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds 1256 1256 6% 0.0 99% KU232300.1 Select seq gb|KU232297.1| Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds 1254 1254 6% 0.0 99% KU232297.1 Select seq gb|KU232294.1| Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds 1243 1243 6% 0.0 99% KU232294.1 Select seq gb|KU232298.1| Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds 1242 1242 6% 0.0 99% KU232298.1 Select seq gb|KU232292.1| Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds 1240 1240 6% 0.0 99% KU232292.1 Select seq gb|KU232296.1| Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds 1238 1238 6% 0.0 99% KU232296.1 Select seq gb|KU232293.1| Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds 1238 1238 6% 0.0 99% KU232293.1 Select seq gb|AF013415.1| Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds 1236 1236 10% 0.0 88% AF013415.1 Select seq gb|KU232295.1| Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds 1230 1230 6% 0.0 99% KU232295.1 Select seq gb|KU232288.1| Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds 1218 1218 6% 0.0 99% KU232288.1 Select seq gb|KU232289.1| Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds 1214 1214 6% 0.0 99% KU232289.1 Select seq gb|KU232299.1| Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds 1210 1210 6% 0.0 99% KU232299.1 Select seq gb|KU232291.1| Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds 1205 1205 6% 0.0 99% KU232291.1 Select seq gb|KU724097.1| Zika virus isolate 259250_2015_Panama NS5B gene, partial cds 1201 1201 6% 0.0 99% KU724097.1 Select seq gb|KX101065.1| Zika virus isolate Bahia15, partial genome 1201 7390 39% 0.0 99% KX101065.1 Select seq gb|KX101063.1| Zika virus isolate Bahia05, partial genome 1190 7423 40% 0.0 99% KX101063.1 Select seq gb|KU724098.1| Zika virus isolate 259060_2015_Panama NS5B gene, partial cds 1188 1188 6% 0.0 99% KU724098.1 Select seq gb|KU758878.1| Zika virus polyprotein gene, partial cds 1164 1164 6% 0.0 99% KU758878.1 Select seq gb|KU724099.1| Zika virus isolate 259032_2015_Panama NS5B gene, partial cds 1122 1122 5% 0.0 99% KU724099.1 Select seq gb|KX101062.1| Zika virus isolate Bahia04, partial genome 1072 7308 40% 0.0 97% KX101062.1 Select seq gb|KU867812.1| Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds 1037 1037 5% 0.0 99% KU867812.1 Select seq gb|KF270886.1| Zika virus strain CCB-870 envelope glycoprotein gene, partial cds 1005 1005 8% 0.0 88% KF270886.1 Select seq gb|KU724100.1| Zika virus isolate 259043_2015_Panama NS5B gene, partial cds 959 959 5% 0.0 99% KU724100.1 Select seq gb|KF270887.1| Zika virus strain CCB-870 NS3 protein gene, partial cds 933 933 7% 0.0 89% KF270887.1 Select seq gb|KF383022.1| Zika virus strain ArD127988 envelope protein gene, partial cds 922 922 7% 0.0 89% KF383022.1 Select seq gb|KF383026.1| Zika virus strain ArD127994 envelope protein gene, partial cds 917 917 7% 0.0 89% KF383026.1 Select seq gb|EU303241.1| Zika virus note MR766 (p4 15/9/76) nonstructural protein 5 (NS5) gene, partial cds 911 911 7% 0.0 88% EU303241.1 Select seq gb|KF383037.1| Zika virus strain ArA506 envelope protein gene, partial cds 905 905 7% 0.0 88% KF383037.1 Select seq gb|KF383036.1| Zika virus strain ArA975 envelope protein gene, partial cds 900 900 7% 0.0 88% KF383036.1 Select seq gb|KX247638.1| Zika virus isolate Dominican_Rep-Rus-3-2016 polyprotein gene, partial cds 881 881 4% 0.0 99% KX247638.1 Select seq gb|KU978616.1| Zika virus isolate Dominican_Rep-Rus-2-2016 polyprotein gene, partial cds 876 876 4% 0.0 99% KU978616.1 Select seq gb|KF383039.1| Zika virus strain HD78788 envelope protein gene, partial cds 872 872 7% 0.0 88% KF383039.1 Select seq gb|KF383038.1| Zika virus strain ArA986 envelope protein gene, partial cds 867 867 7% 0.0 87% KF383038.1 Select seq dbj|AB908162.1| Zika virus gene for polyprotein, partial cds, strain: ZIKV Hu/Tahiti/01u/2014NIID 857 857 4% 0.0 99% AB908162.1 Select seq gb|KF383046.1| Zika virus strain ArA982 envelope protein gene, partial cds 856 856 7% 0.0 87% KF383046.1 Select seq gb|KF383103.1| Zika virus strain ArA986 nonstructural protein 5 gene, partial cds 846 846 6% 0.0 88% KF383103.1 Select seq gb|KF383086.1| Zika virus strain ArA975 nonstructural protein 5 gene, partial cds 846 846 6% 0.0 88% KF383086.1 Select seq gb|KF383045.1| Zika virus strain ArA27106 envelope protein gene, partial cds 833 833 7% 0.0 87% KF383045.1 Select seq gb|KF383043.1| Zika virus strain ArA27443 envelope protein gene, partial cds 828 828 7% 0.0 87% KF383043.1 Select seq gb|KX253994.1| Zika virus strain ZIKV/Homo sapiens/GER/GER-BNI-P2/2016 polyprotein gene, partial cds 826 826 4% 0.0 100% KX253994.1 Select seq gb|KF383041.1| Zika virus strain ArA27290 envelope protein gene, partial cds 822 822 7% 0.0 86% KF383041.1 Select seq gb|KF383042.1| Zika virus strain ArA27096 envelope protein gene, partial cds 817 817 7% 0.0 86% KF383042.1 Select seq gb|KX101067.1| Zika virus isolate Bahia12, partial genome 815 8692 48% 0.0 99% KX101067.1 Select seq gb|KU872850.1| Zika virus isolate Dominican Rep-Rus-2016, NS2 partial cds 815 815 4% 0.0 99% KU872850.1 Select seq gb|KF383104.1| Zika virus strain ArA982 nonstructural protein 5 gene, partial cds 813 813 6% 0.0 87% KF383104.1 Select seq gb|KF383085.1| Zika virus strain ArD9957 nonstructural protein 5 gene, partial cds 808 808 6% 0.0 87% KF383085.1 Select seq gb|KF383106.1| Zika virus strain ArA27443 nonstructural protein 5 gene, partial cds 802 802 6% 0.0 87% KF383106.1 Select seq gb|KF383114.1| Zika virus strain AnD30332 nonstructural protein 5 gene, partial cds 797 797 6% 0.0 87% KF383114.1 Select seq gb|KF383107.1| Zika virus strain ArA27407 nonstructural protein 5 gene, partial cds 797 797 6% 0.0 87% KF383107.1 Select seq gb|KF383088.1| Zika virus strain ArD30101 nonstructural protein 5 gene, partial cds 797 797 6% 0.0 87% KF383088.1 Select seq gb|KF383087.1| Zika virus strain ArD30156 nonstructural protein 5 gene, partial cds 791 791 6% 0.0 87% KF383087.1 Select seq gb|KF383089.1| Zika virus strain ArD165531 nonstructural protein 5 gene, partial cds 774 774 6% 0.0 86% KF383089.1 Select seq gb|KF383101.1| Zika virus strain ArD127710 nonstructural protein 5 gene, partial cds 769 769 6% 0.0 86% KF383101.1 Select seq gb|KF383097.1| Zika virus strain ArD127994 nonstructural protein 5 gene, partial cds 769 769 6% 0.0 86% KF383097.1 Select seq gb|KF383099.1| Zika virus strain ArD127987 nonstructural protein 5 gene, partial cds 763 763 6% 0.0 86% KF383099.1 Select seq gb|KF383098.1| Zika virus strain ArD127988 nonstructural protein 5 gene, partial cds 758 758 6% 0.0 86% KF383098.1 Select seq gb|KF383113.1| Zika virus strain ArA1465 nonstructural protein 5 gene, partial cds 719 719 6% 0.0 85% KF383113.1 Select seq gb|KX253995.1| Zika virus strain ZIKV/Homo sapiens/PRI/PRI-BNI-P1/2016 polyprotein gene, partial cds 697 697 3% 0.0 100% KX253995.1 Select seq gb|KF258813.1| Zika virus isolate Java non-structural protein 5 mRNA, partial cds 693 693 3% 0.0 98% KF258813.1 Select seq gb|KU985088.1| Zika virus isolate MEX/InDRE/Zika-2/2015 envelope protein gene, partial cds 662 662 3% 0.0 99% KU985088.1 Select seq gb|KX062045.1| Zika virus isolate Haiti/1230/2014 envelope protein gene, partial cds 634 634 3% 1e-176 99% KX062045.1 Select seq gb|KX062044.1| Zika virus isolate Haiti/1227/2014 envelope protein gene, partial cds 628 628 3% 6e-175 99% KX062044.1 Select seq gb|KF383017.1| Zika virus strain ArD149938 envelope protein gene, partial cds 617 617 7% 1e-171 81% KF383017.1 Select seq gb|KF383016.1| Zika virus strain ArD147917 envelope protein gene, partial cds 612 612 7% 6e-170 81% KF383016.1 Select seq gb|KF383015.1| Zika virus strain ArD149810 envelope protein gene, partial cds 612 612 7% 6e-170 81% KF383015.1 Select seq gb|KF383021.1| Zika virus strain ArD132912 envelope protein gene, partial cds 604 604 7% 1e-167 81% KF383021.1 Select seq gb|KF383020.1| Zika virus strain ArA1465 envelope protein gene, partial cds 604 604 7% 1e-167 81% KF383020.1 Select seq gb|KX173842.1| Zika virus isolate 16Z08 envelope protein gene, partial cds 603 603 3% 4e-167 99% KX173842.1 Select seq gb|KF383019.1| Zika virus strain ArD132915 envelope protein gene, partial cds 590 590 7% 3e-163 81% KF383019.1 Select seq gb|KR815989.1| Zika virus isolate 15095 envelope protein gene, partial cds 588 588 3% 1e-162 99% KR815989.1 Select seq gb|KF383092.1| Zika virus strain ArD147917 nonstructural protein 5 gene, partial cds 566 566 6% 5e-156 81% KF383092.1 Select seq gb|KF383093.1| Zika virus strain ArD149810 nonstructural protein 5 gene, partial cds 564 564 6% 2e-155 81% KF383093.1 Select seq gb|KF383091.1| Zika virus strain ArD149938 nonstructural protein 5 gene, partial cds 553 553 6% 4e-152 81% KF383091.1 Select seq gb|KM212966.1| Zika virus isolate NC13(FP)-26112013-22072 glycoprotein gene, partial cds 547 547 2% 2e-150 100% KM212966.1 Select seq gb|KR816334.1| Zika virus isolate BR/UFBA/LabViro/Ex1 envelope protein gene, partial cds 545 545 2% 6e-150 99% KR816334.1 Select seq gb|KR816333.1| Zika virus isolate BR/UFBA/LabViro/23 envelope protein gene, partial cds 544 544 2% 2e-149 99% KR816333.1 Select seq gb|KM212965.1| Zika virus isolate NC13(FP)-20112013-22015 glycoprotein gene, partial cds 542 542 2% 8e-149 99% KM212965.1 Select seq gb|KM212964.1| Zika virus isolate NC14-17042014-4554 glycoprotein gene, partial cds 542 542 2% 8e-149 99% KM212964.1 Select seq gb|KM212963.1| Zika virus isolate NC14-23012014-250 glycoprotein gene, partial cds 542 542 2% 8e-149 99% KM212963.1 Select seq gb|KR816335.1| Zika virus isolate BR/UFBA/LabViro/18 envelope protein gene, partial cds 540 540 2% 3e-148 98% KR816335.1 Select seq gb|KJ579441.1| Zika virus isolate PF13-CP221013c polyprotein gene, partial cds 520 520 2% 4e-142 100% KJ579441.1 Select seq gb|KJ680134.1| Zika virus strain PF13-091213-121 polyprotein gene, partial cds 514 514 2% 2e-140 99% KJ680134.1

LOCUS KX766028 10680 bp RNA linear VRL 26-AUG-2016 DEFINITION Zika virus isolate R114916, complete genome. ACCESSION KX766028 VERSION KX766028.1 GI:1059853342 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10680) AUTHORS Lanciotti,R.S. TITLE Direct Submission JOURNAL Submitted (23-AUG-2016) Diagnostic & Reference Laboratory, Arbovirus Diseases Branch, Centers for Disease Control & Prevention, 3150 Rampart Road, Fort Collins, CO 80521, USA COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. 7 Sequencing Technology :: IonTorrent ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10680 /organism="Zika virus" /mol_type="genomic RNA" /isolate="R114916" /host="Homo sapiens" /db_xref="taxon:64320" /country="Dominican Republic" /collection_date="06-Jun-2016" CDS 103..10374 /note="Cap-prM/M-E-NS1-NS2a-NS2b-NS3-NS4a-NS4b-NS5" /codon_start=1 /product="polyprotein" /protein_id="AOG18295.1" /db_xref="GI:1059853343" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGTDTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAVRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVASCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 ttgattgycg tgaatcagac tgcgacagtt cgagtttgaa gcgaaagcta gcaacagtat 61 caacaggttt tattttggat ttggaaacga gagtttctgg tcatgaaaaa cccaaaaaag 121 aaatccggag gattccggat tgtcaatatg ctaaaacgcg gagtagcccg tgtgagcccc 181 tttgggggct tgaagaggct gccagccgga cttctgctgg gtcatgggcc catcaggatg 241 gtcttggcga ttctagcctt tttgagattc acggcaatca agccatcact gggtctcatc 301 aatagatggg gttcagtggg gaaaaaagag gctatggaaa taataaagaa gttcaagaaa 361 gatctggctg ccatgctgag aataatcaat gctaggaagg agaagaagag acgaggcaca 421 gatactagtg tcggaattgt tggcctcctg ctgaccacag ctatggcagc ggaggtcact 481 agacgtggga gtgcatacta tatgtacttg gacagaaacg atgctgggga ggccatatct 541 tttccaacca cattggggat gaataagtgt tatatacaga tcatggatct tggacacatg 601 tgtgatgcca ccatgagcta tgaatgccct atgctggatg agggggtgga accagatgac 661 gtcgattgtt ggtgcaacac gacgtcaact tgggttgtgt acggaacctg ccatcacaaa 721 aaaggtgaag cacggagatc tagaagagct gtgacgctcc cttcccattc cactaggaag 781 ctgcaaacgc ggtcgcaaac ctggttggaa tcaagagaat acacaaagca cttgattaga 841 gtcgaaaatt ggatattcag gaaccctggc ttcgcgttag cagcagctgc catcgcttgg 901 cttttgggaa gctcaacgag ccaaaaagtc atatacttgg tcatgatact gctgattgcc 961 ccggcataca gcatcaggtg cataggagtc agcaataggg actttgtgga aggtatgtca 1021 ggtgggactt gggttgatgt tgtcttggaa catggaggtt gtgtcaccgt aatggcacag 1081 gacaaaccga ctgtcgacat agagctggtt acaacaacag tcagcaacat ggcggaggta 1141 agatcctact gctatgaggc atcaatatca gacatggctt cggacagccg ctgcccaaca 1201 caaggtgaag cctaccttga caagcaatca gacactcaat atgtctgcaa aagaacgtta 1261 gtggacagag gctggggaaa tggatgtgga ctttttggca aagggagcct ggtgacatgc 1321 gctaagtttg catgctccaa gaaaatgacc gggaagagca tccagccaga gaatctggag 1381 taccggataa tgctgtcagt tcatggctcc cagcacagtg ggatgatcgt taatgacaca 1441 ggacatgaaa ctgatgagaa tagagcgaar gttgagataa cgcccaattc accaagagcc 1501 gaagccaccc tggggggttt tggaagccta ggacttgatt gtgaaccgag gacaggcctt 1561 gacttttcag atttgtatta cttgactatg aataacaagc actggttggt tcacaaggag 1621 tggttccacg acattccatt accttggcac gctggggcag acaccggaac tccacactgg 1681 aacaacaaag aagcactggt agagttcaag gacgcacatg ccaaaaggca aactgtcgtg 1741 gttctaggga gtcaagaagg agcagttcac acggcccttg ctggagctct ggaggctgag 1801 atggatggag caaagggaag gctgtcctct ggccacttga aatgtcgcct gaaaatggat 1861 aaacttagat tgaagggcgt gtcatactcc ttgtgtactg cagcgttcac attcaccaag 1921 atcccggctg aaacactgca cgggacagtc acagtggagg tacagtacgc agggacagat 1981 ggaccttgca aggttccagc tcagatggcg gtggacatgc aaactctgac cccagttggg 2041 aggttgataa ccgctaaccc cgtaatcact gaaagcactg agaactctaa gatgatgctg 2101 gaacttgatc caccatttgg ggactcttac attgtcatag gagtcgggga gaagaagatc 2161 acccaccact ggcacaggag tggcagcacc attggaaaag catttgaagc cactgtgaga 2221 ggtgccaaga gaatggcagt cttgggagac acagcctggg actttggatc agttggaggc 2281 gctctcaact cattgggcaa gggcatccat caaatttttg gagcagcttt caaatcattg 2341 tttggaggaa tgtcctggtt ctcacaaatt ctcattggaa cgttgctgat gtggttgggt 2401 ctgaacacaa agaatggatc tatttccctt atgtgcttgg ccttaggggg agtgttgatc 2461 ttcttatcca cagccgtctc tgctgatgtg gggtgctcgg tggacttctc aaagaaggag 2521 acgagatgcg gtacaggggt gtttgtctat aacgacgttg aagcctggag ggacaggtac 2581 aagtaccatc ctgactcccc ccgtagattg gcagcagcag tcaagcaagc ctgggaagat 2641 ggtatctgcg ggatctcctc tgtttcaaga atggaaaaca tcatgtggag atcagtagaa 2701 ggggagctca acgcaatcct ggaagagaat ggagttcaac tgacggtcgt tgtgggatct 2761 gtaaaaaacc ccatgtggag aggtccacag agattgcccg tgcctgtgaa cgagctgccc 2821 cacggctgga aggcttgggg gaaatcgtac ttcgtcagag cagcaaagac aaataacagc 2881 tttgtcgtgg atggtgacac actgaaggaa tgcccactca aacatagagc atggaacagc 2941 tttcttgtgg aggatcatgg gttcggggta tttcacacta gtgtctggct caaggttaga 3001 gaagattatt cattagagtg tgatccagcc gttattggaa cagctgttaa gggaaaggag 3061 gctgtacaca gtgatctagg ctactggatt gagagtgaga agaatgacac atggaggctg 3121 aagagggccc atctgatcga gatgaaaaca tgtgaatggc caaagtccca cacattgtgg 3181 acagatggaa tagaagagag tgatctgatc atacccaagt ctttagctgg gccactcagc 3241 catcacaaca ccagagaggg ctacaggacc caaatgaaag ggccatggca cagtgaagag 3301 cttgaaattc ggtttgagga atgcccaggc actaaggtcc acgtggagga aacatgtgga 3361 acaagaggac catctctgag atcaaccact gcaagcggaa gggtgatcga ggaatggtgc 3421 tgcagggagt gcacaatgcc cccactgtcg ttccgggcta aagatggctg ttggtatgga 3481 atggagataa ggcccaggaa agaaccagaa agcaacttag taaggtcaat ggtgactgca 3541 ggatcaactg atcacatgga ccacttctcc cttggagtgc ttgtgatcct gctcatggtg 3601 caggaagggc tgaagaagag aatgaccaca aagatcatca taagcacatc aatggcagtg 3661 ctggtagcta tgatcctggg aggattttca atgagtgacc tggctaagct tgcaattttg 3721 atgggtgcca ccttcgcgga aatgaacact ggaggagatg tagctcatct ggcgctgata 3781 gcggcattca aagtcagacc agcgttgctg gtatccttca tcttcagagc taattggaca 3841 ccccgtgaaa gcatgctgct ggccttggcc tcgtgtcttt tgcaaactgc gatctccgcc 3901 ttggaaggcg acctgatggt tctcatcaat ggttttgctt tggcctggtt ggcagtacga 3961 gcgatggttg ttccacgcac tgataacatc accttagcaa tcctggctgc tctgacacca 4021 ctggcccggg gcacactgct tgtggcgtgg agagcaggcc ttgccacttg cggggggttt 4081 atgctcctct ctctgaaggg aaaaggcagt gtgaagaaga acttaccatt tgtcatggcc 4141 ctgggactaa ccgctgtgag gctggtcgac cccatcaacg tggtgggact gctgctgctc 4201 acaaggagtg ggaagcggag ctggccccct agcgaagtac tcacagctgt tggcctgata 4261 tgcgcattgg ctggagggtt cgccaaggca gatatagaga tggctgggcc catggccgcg 4321 gtcggtctgc taattgtcag ttacgtggtc tcaggaaaga gtgtggacat gtacattgaa 4381 agagcaggtg acatcacatg ggaaaaagat gcggaagtca ctggaaacag tccccggctc 4441 gatgtggcgc tagatgagag tggtgatttc tccctggtgg aggatgacgg tccccccatg 4501 agagagatca tactcaaggt ggtcctgatg accatctgtg gcatgaaccc aatagccata 4561 ccctttgcag ctggagcgtg gtacgtatac gtgaagactg gaaaaaggag tggtgctcta 4621 tgggatgtgc ctgctcccaa ggaagtaaaa aagggggaga ccacagatgg agtgtacaga 4681 gtaatgactc gcagactgct aggttcaaca caagttggag tgggagttat gcaagagggg 4741 gtctttcaca ctatgtggca cgtcacaaaa ggatccgcgc tgagaagcgg tgaagggaga 4801 cttgatccat actggggaga tgtcaagcag gatctggtgt catactgtgg tccatggaag 4861 ctagatgccg cctgggacgg gcacagcgag gtgcagctct tggccgtgcc ccccggagag 4921 agagcgagga acatccagac tctgcccgga atatttaaga caaaggatgg ggacattgga 4981 gcggttgcgc tggattaccc agcaggaact tcaggatctc caatcctaga caagtgtggg 5041 agagtgatag gactttatgg caatggggtc gtgatcaaaa atgggagtta tgttagtgcc 5101 atcacccaag ggaggaggga ggaagagact cctgttgagt gcttcgagcc ttcgatgctg 5161 aagaagaagc agctaactgt cttagacttg catcctggag ctgggaaaac caggagagtt 5221 cttcctgaaa tagtccgtga agccataaaa acaagactcc gtactgtgat cttagctcca 5281 accagggttg tcgctgctga aatggaggag gcccttagag ggcttccagt gcgttatatg 5341 acaacagcag tcaatgtcac ccactctgga acagaaatcg tcgacttaat gtgccatgcc 5401 accttcactt cacgtctact acagccaatt agagtcccca actataatct gtatattatg 5461 gatgaggccc acttcacaga tccctcaagt atagcagcaa gaggatacat ttcaacaagg 5521 gttgagatgg gcgaggcggc tgccatcttc atgaccgcca cgccaccagg aacccgtgac 5581 gcatttccgg actccaactc accaattatg gacaccgaag tggaagtccc agagagagcc 5641 tggagctcag gctttgattg ggtgacggat cattctggaa aaacagtttg gtttgttcca 5701 agcgtgagga acggcaatga gatcgcagct tgtctgacaa aggctggaaa acgggtcata 5761 cagctcagca gaaagacttt tgagacagag ttccagaaaa caaaacatca agagtgggac 5821 tttgtcgtga caactgacat ttcagagatg ggcgccaact ttaaagctga ccgtgtcata 5881 gattccagga gatgcctaaa gccggtcata cttgatggcg agagagtcat tctggctgga 5941 cccatgcctg tcacacatgc cagcgctgcc cagaggaggg ggcgcatagg caggaatccc 6001 aacaaacctg gagatgagta tctgtatgga ggtgggtgcg cagagactga cgaagaccat 6061 gcacactggc ttgaagcaag aatgctcctt gacaatattt acctccaaga tggcctcata 6121 gcctcgctct atcgacctga ggccgacaaa gtagcagcca ttgagggaga gttcaagctt 6181 aggacggagc aaaggaagac ctttgtggaa ctcatgaaaa gaggagatct tcctgtttgg 6241 ctggcctatc aggttgcatc tgccggaata acctacacag atagaagatg gtgctttgat 6301 ggcacgacca acaacaccat aatggaagac agtgtgccgg cagaggtgtg gaccagacat 6361 ggagagaaaa gagtgctcaa accgaggtgg atggacgcca gagtttgttc agatcatgcg 6421 gccctgaagt cattcaagga gtttgccgct gggaaaagag gagcggcttt tggagtgatg 6481 gaagccctgg gaacactgcc aggacacatg acagagagat tccaggaagc cattgacaac 6541 ctcgctgtgc tcatgcgggc agagactgga agcaggcctt acaaagccgc ggcagcccaa 6601 ttgccggaga ccctagagac cattatgctt ttggggttgc tgggaacagt ctcgctggga 6661 atcttcttcg tcttgatgag gaacaagggc atagggaaga tgggctttgg aatggtgact 6721 cttggggcca gcgcatggct catgtggctc tcggaaattg agccagccag aattgcatgt 6781 gtcctcattg ttgtgttcct attgctggtg gtgctcatac ctgagccaga aaagcaaaga 6841 tctccccagg acaaccaaat ggcaatcatc atcatggtag cagtaggtct tctgggcttg 6901 attaccgcca atgaactcgg atggttggag agaacaaaga gtgacctaag ccatctaatg 6961 ggaaggagag aggagggggc aaccatagga ttctcaatgg acattgacct gcggccagcc 7021 tcagcttggg ccatctatgc tgccttgaca actttcatta ccccagccgt ccaacatgca 7081 gtgaccacct catacaacaa ctactcctta atggcgatgg ccacgcaagc tggagtgttg 7141 tttggtatgg gcaaagggat gccattctac gcatgggact ttggagtccc gctgctaatg 7201 ataggttgct actcacaatt aacacccctg accctaatag tggccatcat tttgctcgtg 7261 gcgcactaca tgtacttgat cccagggctg caggcagcag ctgcgcgtgc tgcccagaag 7321 agaacggcag ctggcatcat gaagaatcct gttgtggatg gaatagtggt gactgacatt 7381 gacacaatga caattgaccc ccaagtggag aaaaagatgg gacaggtgct actcatagca 7441 gtagccgtct ccagcgccat actgtcgcgg accgcctggg ggtgggggga ggctggggcc 7501 ctgatcacag ccgcaacttc cactttgtgg gaaggctctc cgaacaagta ctggaactcc 7561 tctacagcca cttcactgtg taacattttt aggggaagtt acttggctgg agcttctcta 7621 atctacacag taacaagaaa cgctggcttg gtcaagagac gtgggggtgg aacaggagag 7681 accctgggag agaaatggaa ggcccgcttg aaccagatgt cggccctgga gttctactcc 7741 tacaaaaagt caggcatcac cgaggtgtgc agagaagagg cccgccgcgc cctcaaggac 7801 ggtgtggcaa cgggaggcca tgctgtgtcc cgaggaagtg caaagctgag atggttggtg 7861 gagcggggat acctgcagcc ctatggaaag gtcattgatc ttggatgtgg cagagggggc 7921 tggagttact acgccgccac catccgcaaa gttcaagaag tgaaaggata cacaaaagga 7981 ggccctggtc atgaagaacc cgtgttggtg caaagctatg ggtggaacat agtccgtctt 8041 aagagtgggg tggacgtctt tcatatggcg gctgagccgt gtgacacgtt gctgtgtgac 8101 ataggtgagt catcatctag tcctgaagtg gaagaagcac ggacgctcag agtcctctcc 8161 atggtggggg attggcttga aaaaagacca ggagcctttt gcataaaagt gttgtgccca 8221 tacaccagca ctatgatgga aaccctggag cgactgcagc gtaggtatgg gggaggactg 8281 gtcagagtgc cactctcccg caactctaca catgagatgt actgggtctc tggagcgaaa 8341 agcaacacca taaaaagtgt gtccaccacg agccagctcc tcttggggcg catggacggg 8401 cctaggaggc cagtgaaata tgaggaggat gtgaatctcg gctctggcac gcgggctgtg 8461 gcaagctgcg ctgaagctcc caacatgaag atcattggta accgcattga aaggatccgc 8521 agtgagcacg cggaaacgtg gttctttgac gagaaccacc catataggac atgggcttac 8581 catggaagct atgaggcccc cacacaaggg tcagcgtcct ctctaataaa cggggttgtc 8641 aggctcctgt caaaaccctg ggatgtggtg actggagtca caggaatagc catgaccgac 8701 accacaccgt atggtcagca aagagttttc aaggaaaaag tggacactag ggtgccagac 8761 ccccaagaag gcactcgtca ggttatgagc atggtctctt cctggttgtg gaaagagcta 8821 ggcaaacaca aacggccacg agtctgtacc aaagaagagt tcatcaacaa ggttcgtagc 8881 aatgcagcat taggggcaat atttgaagag gaaaaagagt ggaagactgc agtggaagct 8941 gtgaacgatc caaggttctg ggctctagtg gacaaggaaa gagagcacca cctgagagga 9001 gagtgccaga gttgtgtgta caacatgatg ggaaaaagag aaaagaaaca aggggaattt 9061 ggaaaggcca agggcagccg cgccatctgg tatatgtggc tgggggctag atttctagag 9121 ttcgaagccc ttggattctt gaacgaggat cactggatgg ggagagagaa ctcaggaggt 9181 ggtgttgaag ggctgggatt acaaagactc ggatatgtcc tagaagagat gagtcgtata 9241 ccaggaggaa ggatgtatgc agatgacact gctggctggg acacccgcat tagcaggttt 9301 gatctggaga atgaagctct aatcaccaac caaatggaga aagggcacag ggccttggca 9361 ttggccataa tcaagtacac ataccaaaac aaagtggtaa aggtccttag accagctgaa 9421 aaagggaaaa cagttatgga cattatttcg agacaagacc aaagggggag cggacaagtt 9481 gtcacttacg ctcttaacac atttaccaac ctagtggtgc aactcattcg gaatatggag 9541 gctgaggaag ttctagagat gcaagacttg tggctgctgc ggaggtcaga gaaagtgacc 9601 aactggttgc agagcaacgg atgggatagg ctcaaacgaa tggcagtcag tggagatgat 9661 tgcgttgtga agccaattga tgataggttt gcacatgccc tcaggttctt gaatgatatg 9721 ggaaaagtta ggaaggacac acaagagtgg aaaccctcaa ctggatggga caactgggaa 9781 gaagttccgt tttgctccca ccatttcaac aagctccatc tcaaggacgg gaggtccatt 9841 gtggttccct gccgccacca agatgaactg attggccggg cccgcgtctc tccaggggcg 9901 ggatggagca tccgggagac tgcttgccta gcaaaatcat atgcgcaaat gtggcagctc 9961 ctttatttcc acagaaggga cctccgactg atggccaatg ccatttgttc atctgtgcca 10021 gttgactggg ttccaactgg gagaactacc tggtcaatcc atggaaaggg agaatggatg 10081 accactgaag acatgcttgt ggtgtggaac agagtgtgga ttgaggagaa cgaccacatg 10141 gaagacaaga ccccagttac gaaatggaca gacattccct atttgggaaa aagggaagac 10201 ttgtggtgtg gatctctcat agggcacaga ccgcgcacca cctgggctga gaacattaaa 10261 aacacagtca acatggtgcg caggatcata ggtgatgaag aaaagtacat ggattaccta 10321 tccacccaag ttcgctactt gggtgaagaa gggtctacac ctggagtgct gtaagcacca 10381 atcttaatgt tgtcaggcct gctagtcagc cacagcttgg ggaaagctgt gcagcctgtg 10441 acccccccag gagaagctgg gaaaccaagc ctatagtcag gccgagaacg ccatggcacg 10501 gaagaagcca tgctgcctgt gagcccctca gaggacactg agtcaaaaaa ccccacgcgc 10561 ttggaggcgc aggatgggaa aagaaggtgg cgaccttccc cacccttcaa tctggggcct 10621 gaactggaga tcagctgtgg atctccagaa gagggactag tggttagagg agaccccccg

LOCUS KX766028 10680 bp RNA linear VRL 26-AUG-2016 DEFINITION Zika virus isolate R114916, complete genome. ACCESSION KX766028 VERSION KX766028.1 GI:1059853342 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10680) AUTHORS Lanciotti,R.S. TITLE Direct Submission JOURNAL Submitted (23-AUG-2016) Diagnostic & Reference Laboratory, Arbovirus Diseases Branch, Centers for Disease Control & Prevention, 3150 Rampart Road, Fort Collins, CO 80521, USA COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. 7 Sequencing Technology :: IonTorrent ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10680 /organism="Zika virus" /mol_type="genomic RNA" /isolate="R114916" /host="Homo sapiens" /db_xref="taxon:64320" /country="Dominican Republic" /collection_date="06-Jun-2016"

Singapore Zika cases rise to 56 at one construction site; Malaysia starts border screening By Ariana Eunjung Cha August 29 at 12:39 PM A public service announcement against the spread of Aedes mosquitoes, a carrier for the Zika virus, at a residential block at Aljunied Crescent neighborhood in Singapore on Aug. 29. (Roslan Rahman/Agence France-Presse via Getty Images) Global health officials stepped up defensive measures against Zika over the weekend as the virus continued to expand its reach at a rapid pace. Singapore reported one of the largest single clusters outside of the Americas, confirming 56 infections, mostly among foreign workers at a construction site. On Monday, inspectors armed with insecticide were visiting high-rise public housing buildings to look at toilets and other areas for stagnant water, according to theAgence France-Presse. The outbreak in the city-state of Singapore, a hub for Southeast Asia, has alarmed its neighbors. Indonesia, the Philippines, Thailand and Vietnam have each seen a case of Zika and have been concerned that the infections might be spreading locally but have not been able to confirm whether that is the case. In the past 48 hours, Taiwan has issued a travel advisory for Singapore, and Malaysia ordered thermal screening at checkpoints for travelers who enter from Singapore by bus. Subramaniam Sathasivam, Malaysia's health minister, said at a news conference that 150,000 to 200,000 people commute between Johor in Malaysia and Singapore each day. "The risk is imminent," he said, according to Singapore's Straits Times. "The main thing is to reduce the risk of the virus spreading to others." On the opposite side of the world, Disney World, Universal, SeaWorld, Busch Gardens and other theme parks in Florida said Sunday that they would begin distributing free insect repellent to visitors. Gov. Rick Scott's office told the Orlando Sentinel that he had "talked to many of the attractions and theme parks. He's held multiple conference calls with Visit Florida and tourism leaders to make them aware of things they can do. He appreciates all of these businesses doing this." Cities still hundreds of miles away from the current mosquito-borne outbreaks in the United States, which have so far been limited to Florida and Puerto Rico, began spraying densely populated areas to try to ward off mosquitoes for as long as possible. Baltimore advised residents of some neighborhoods to stay indoors after 10 p.m. Sunday to avoid being exposed to mosquito-killing spray from trucks, the Baltimore Sunreported. [Heartbreaking images of how Zika destroys babies’ brains] The U.S. Food and Drug Administration, after finding Zika in blood that had been donated by someone in Florida, began efforts to screen the entire country's blood supply for the virus. In a separate action, regulators issued an emergency use authorization for Swiss drugmaker Roche's molecular diagnostic test for Zika. Samples from patients with fever, rash and other symptoms of the virus can now be sent to a lab that can use Roche's technology to rapidly test for infection. In a statement, the company reaffirmed its "commitment to help healthcare professionals who are working to combat this serious disease." An Aedes aegypti mosquito sits inside a glass tube at the Fiocruz institute where they have been screening for mosquitos naturally infected with the Zika virus in Rio de Janeiro, Brazil. (AP Photo/Felipe Dana, File) [FDA takes radical measure of recommending Zika screening for entire U.S. blood supply] Zika first drew the alarm of public health officials because of its link to thousands of babies with severe birth defects in Brazil. The virus is now actively spreading in 51 countries. In the United States, six babies were miscarried, stillborn or aborted due to birth defects that appear to be related to the virus. The Centers for Disease Control and Prevention says an additional 17 babies infected with the virus in the womb were born with microcephaly, a condition defined by an abnormally small head. [U.S. warning: Zika could spread to Gulf States, persist for one to two years] This post has been updated. https://www.washingtonpost.com/news/to-your-health/wp/2016/08/29/zika-fears-spread-as-singapore-baltimore-disney-and-others-fight-mosquitoes/

Why the MOH did not announce the Zika cases earlier MOH explains why. 29 Aug 2016 Listen moh-800x500Q) When was the earliest case that Ministry of Health backtracked to?Dr Derrick Heng (MOH Group Director for Public Health Group): The (earliest) case that we know of was July 31. We would not have picked up on all the cases, (so) we would not be able to pinpoint definitively the first index case (patient zero).Mr Koh Peng Keng (MOH Group Director, Operations): The first case we knew of was patient A (the 47-year-old Malaysian woman whose case was reported on Saturday). The rest of it we had to work with the GPs, to do a lot of tracking to try and look back.Dr Heng: We went back to look at people who were part of the GP (cases), and (at the) construction site, the people who had reported symptoms in the past. We took samples...the samples (tested) positive sometime late last night (on Saturday).Mr Koh: The GP alerted us of this unusual cluster of cases with mild symptoms, it’s only (then) we went back to check....most of them had already recovered. So it was a look back...Initial hypothesis was that it was just some mild viral infection that transmits from person to person. Zika was not specifically suspected at that point when the GP was seeing this group.Q) Saturday was confirmation that the woman (patient A) had Zika. But you had preliminary results, did you start looking before Saturday, or did you only start work on Saturday when you had confirmed results?Dr Heng: We started preparations when the preliminary results (came out). But we had to wait for confirmation in order not to create false alarm.Q) Patient A was at CDC on Aug 25, and it takes about three hours to do the test. So you should have known by that night.Professor Leo Yee Sin (clinical director of Communicable Disease Centre): Her presence at CDC from the time we received her as a case, to the time she did the blood test, all this is actually a very compressed period of time, including getting her back for further assessment.Q) The first case was announced on Saturday, and it jumped to 41 cases. Could the MOH have announced all these cases earlier?Health Minister Gan Kim Yong: Part of the reason that we have discovered more cases is because we have now gone back to the cases that were seen before by doctors. They were not suspected to have Zika, because they have no travel history and so on. Now that we know there is a case ...we’ve therefore gone back to all these cases that were surfaced before, and checked their blood tests, and that’s why we have discovered more cases, as a result of the first case. So out of the 41 cases, I think some 36 cases were a result of this active testing of the patients who were in the areas of concern, whom we felt there was the potential they would be infected by Zika. Then we went back to relook at their test results. Some were even retested to determine whether they were infected by Zika.Q) Why did it take two days before the MOH announced patient A’s case?Mr Gan: Some required double confirmation. So first we tested them on the urine test...various steps of testing.Q) So it’s not like you knew about it earlier, but was keeping quiet about it?Mr Gan: No, of course not.Source: TODAY Online - See more at: https://www.gov.sg/news/content/today-online-why-the-moh-did-not-announce-the-zika-cases-earlier#sthash.48IMgP2m.dpuf

Channel NewsAsia - Locally transmitted Zika cases: A timeline There have been 41 cases of locally transmitted Zika virus infections in Singapore. 29 Aug 2016 Listen HDB7 mockupThere have been 41 cases of locally transmitted Zika virus infections in Singapore, with the transmisson likely to be localised within the Aljunied Crescent-Sims Drive area, say authorities.Health Minister Gan Kim Yong confirmed on Sunday (Aug 28) that it was the report of the first locally transmitted case that prompted the Ministry of Health (MOH) to look back into past cases “where people were seen by doctors but were not suspected to have Zika”.In a press briefing, officials from MOH and the National Environment Agency (NEA) said that fresh blood and urine tests conducted on some of these individuals picked up the Zika virus, which can be detected “up to a month” after recovery. Based on these tests, the earliest case of locally transmitted Zika infection is likely to have occurred on Jul 31, according to MOH.TRANSMISSIBILITY OF ZIKA VIRUSAccording to MOH, Zika is a generally a “mild” illness, with four in five people not showing symptoms. For the one in five who develop symptoms, it causes a viral fever with skin rashes, body aches and headache. Mild or asymptomatic cases may still transmit the infection.Patients are usually not infectious after the fifth day after developing symptoms, as the transmissibility period is between three and five days, said Professor Leo Yee Sin, Senior Consultant of the Communicable Disease Centre (CDC) at Tan Tock Seng Hospital.TIMELINE OF EVENTSAug 22: A clinic in the Aljunied area, Sims Drive Medical Clinic, informed MOH of an unusual increase in cases with fever, rash and joint pains. Cases were mild.Aug 23: MOH visited the clinic and discussed the cases with the GP. The initial hypothesis was a cluster of mild viral illness transmitted from person to person. MOH then made arrangements for the clinic to refer new cases to the CDC for further testing and to start tracing past cases for review, and testing if appropriate. The ministry also communicated with nearby clinics and construction sites to increase vigilance and report cases to them.Aug 25: MOH approached the contractor of a nearby construction site for records of workers with fever. At the same time, a 47-year-old Malaysian woman, who is the first reported locally transmitted case, developed fever, rash, and conjunctivitis.Aug 26: The woman, the only female among all 41 cases to date, visited the same GP and was referred to the CDC.Aug 27: The woman was confirmed by the CDC to have the Zika virus infection. She was warded. As she was assessed to have been infected in Singapore, NEA was notified and they commenced vector control (anti-mosquito breeding) operations. Members of the woman's household were screened. Tests were conducted on 123 people who were recently or currently symptomatic. This includes 118 construction workers of the nearby construction site. Aug 28: MOH and NEA hold a press briefing during which it is announced that 41 locally transmitted Zika cases have been identified, with 34 patients making a full recovery. The remaining seven are recovering in hospital. The authorities say more cases are likely. - See more at: https://www.gov.sg/news/content/channel-newsasia-locally-transmitted-zika-cases-a-timeline#sthash.9gM0FFhd.dpuf

41 confirmed cases of Zika in Aljunied A day after confirming the first locally transmitted case of Zika, the Ministry of Health (MOH) revealed that 40 more patients have been confirmed in the Aljunied Crescent-Sims Drive area, through the tracing of past cases. 29 Aug 2016 Listen Aedes MosquitoIntensified operations to control mosquito breeding, which began on Saturday, will continue in Aljunied Crescent and Sims Drive over the next two weeks.These operations include inspecting all premises, ground and congregation areas, ultra-low volume (ULV) misting and spraying of premises and thermal fogging of outdoor areas, more frequent drain flushing and oiling to prevent breeding, and public outreach and distribution of insect repellent.They will also be carried out in “areas of concern” flagged by the authorities, namely Khatib Camp, Sembawang Drive, Kranji Road, Joo Chiat Place, Senoko South Road, Toh Guan Road East and Lorong 101 Changi.Yesterday, the Ministry of Health (MOH) revealed that there were 41 confirmed Zika cases in the Aljunied Crescent and Sims Drive area — the first cases of local transmission here. The area includes a construction site at Sims Drive and dormitories and workers’ quarters.In total, the National Environment Agency’s (NEA) operations and checks are set to cover more than 6,000 premises including 5,000 HDB flats and workers’ quarters.More than 200 NEA officers were deployed on Saturday to inspect the area, conduct vector control, as well as to reach out to residents. The NEA said it has successfully accessed more than 1,800 premises to carry out checks for mosquito breeding.Nineteen breeding habitats were detected and destroyed, of which 13 were in homes and six in common areas. Of the two dormitories in Kranji and Senoko South that were inspected, one breeding site was detected in Kranji. A stop work order was also issued to the construction site at Sims Drive on Saturday, for creating conditions for mosquito breeding.The NEA said its staff had visited 14 blocks in the vicinity of Aljunied Crescent and Sims Drive, distributed Zika information leaflets and insect repellent, and continued to reach out to the rest of the blocks in the area yesterday. NEA staff started visiting residents in Sembawang Drive yesterday evening.From as early as 9am yesterday, the typically sleepy residential estate of Aljunied Crescent was abuzz with a flurry of activity, as officers conducted fogging and misting operations, checked drains, and knocked on residents’ doors to hand out flyers and bottles of insect repellent.Senior Minister of State for Health and Ministry of Environment and Water Resources Dr Amy Khor, who was distributing flyers to residents in the Sims Drive area, said that residents so far had been “cooperative” and were willing to open up their homes for officers to check for potential mosquito breeding areas and let their premises be misted. Homeowners who were not in will find letters left for them instructing them to make future appointments.When asked if the ministry would expand efforts islandwide, Dr Khor would only say that the priority is to reduce the size of the Aedes mosquito population. “Residents should play their role in helping to control the population by taking steps like the five-step mozzie wipeout, checking their homes are free of mosquito breeding sites and being vigilant by informing a doctor of potential symptoms, as well as (sharing) their travel history, especially if they have been to areas affected by Zika.”Speaking to reporters after a media briefing on the spate of cases yesterday, Health Minister Gan Kim Yong said that vector control efforts need to be “redoubled”, to reduce mosquito breeding sites and minimise the risk of transmission.“I think this is an effort that must be sustained, and we must continue to do so. It’s not easy to achieve good results, partly because of weather conditions in the tropical area, which is very conducive for mosquitoes to breed. Therefore, we need to re-double our efforts in managing our vector control,” he said.In a joint statement, the MOH and the NEA advised those working or living in the Aljunied Crescent and Sims Drive area, especially pregnant women, to monitor their health.They should seek medical attention especially if they have symptoms of fever and rash, and inform their doctors of the location of their homes and workplaces.Pregnant women are especially susceptible as Zika, which is transmitted by the bite of an infected Aedes mosquito, can cause microcephaly, a birth defect where the head of the infant is abnormally small, in their unborn foetuses. - See more at: https://www.gov.sg/news/content/today-online-41-confirmed-cases-of-zika-in-aljunied#sthash.AgoXPha5.dpuf

MC Map Update https://www.google.com/maps/d/u/0/edit?mid=1RcVTrkYW6hax_iITjKUkEcBCVeI

Review 26 August 2016 Among the epidemiological weeks 01 to 33 of 2016 have been confirmed thirty-four (34) cases of microcephaly associated the Zika virus, 158 cases were dismissed and 209 cases are in study. http://www.ins.gov.co/boletin-epidemiologico/Boletn Epidemiolgico/2016 Boletin epidemiologico semana 32.pdf

week conf discard untested total weekly increase 33 34 158 209 401 16 32 29 102 254 385 18 31 24 101 242 367 23 30 22 97 225 344 24 29 21 92 207 320 23 28 21 80 196 297 41 27 21 75 160 256 62 26 18 64 112 194 13 25 13 56 112 181 17 24 11 51 102 164 27 23 6 50 81 137 19 22 6 43 69 118 23 21 6 41 48 95 7 20 5 26 57 88 7 19 5 26 50 81 9 18 5 24 43 72 14 17 5 21 32 58 8 16 4 20 26 50 6 15 4 18 22 44 11 14 2 15 16 33 0

Review 26 August 2016 Among the epidemiological weeks 01 to 33 of 2016 have been confirmed thirty-four (34) cases of microcephaly associated the Zika virus, 158 cases were dismissed and 209 cases are in study. http://www.ins.gov.co/boletin-epidemiologico/Boletn Epidemiolgico/2016 Boletin epidemiologico semana 32.pdf

References Lanciotti RS, Kosoy OL, Laven JJ, et al. Genetic and serologic properties of Zika virus associated with an epidemic, Yap State, Micronesia, 2007. Emerg Infect Dis 2008;14:1232–9. CrossRef PubMed Fréour T, Mirallié S, Hubert B, et al. Sexual transmission of Zika virus in an entirely asymptomatic couple returning from a Zika epidemic area, France, April 2016. Euro Surveill 2016;21:30254. CrossRef PubMed Brooks JT, Friedman A, Kachur RE, LaFlam M, Peters PJ, Jamieson DJ. Update: interim guidance for prevention of sexual transmission of Zika virus—United States, July 2016. MMWR Morb Mortal Wkly Rep 2016;65:745–7. CrossRef PubMed Oster AM, Russell K, Stryker JE, et al. Update: interim guidance for prevention of sexual transmission of Zika virus—United States, 2016. MMWR Morb Mortal Wkly Rep 2016;65:323–5. CrossRef PubMed Davidson A, Slavinski S, Komoto K, Rakeman J, Weiss D. Suspected female-to-male sexual transmission of Zika virus—New York City, 2016. MMWR Morb Mortal Wkly Rep 2016;65:716–7. CrossRef PubMed Petersen EE, Polen KN, Meaney-Delman D, et al. Update: interim guidance for health care providers caring for women of reproductive age with possible Zika virus exposure—United States, 2016. MMWR Morb Mortal Wkly Rep 2016;65:315–22. CrossRef PubMed

In June 2016, the Maryland Department of Health and Mental Hygiene (DHMH) was notified of a nonpregnant woman who sought treatment for a subjective fever and an itchy rash, which was described as maculopapular by her provider. Laboratory testing at the Maryland DHMH Laboratories Administration confirmed Zika virus infection. Case investigation revealed that the woman had not traveled to a region with ongoing transmission of Zika virus, but did have sexual contact with a male partner who had recently traveled to the Dominican Republic. The male partner reported exposure to mosquitoes while traveling, but no symptoms consistent with Zika virus infection either before or after returning to the United States. The woman reported no other sex partners during the 14 days before onset of her symptoms and no receipt of blood products or organ transplants. The couple reported having had condomless vaginal intercourse twice after the man’s return from the Dominican Republic and before the woman’s symptom onset, approximately 10 days (day 10) and 14 days (day 14) after the man’s return. The man also reported that he received fellatio from the woman during their sexual encounter on day 14. On day 16 (2 and 6 days after the episodes of condomless vaginal intercourse) the woman developed symptoms of Zika virus infection, including fever and rash. On day 19 (3 days after symptom onset) she sought medical care; the provider suspected Zika virus infection, and serum and urine specimens were collected. Flavivirus and chikungunya virus tests were performed at the Maryland DHMH Laboratories Administration. Zika virus RNA was detected in urine, but not in serum, by real-time reverse transcription–polymerase chain reaction (rRT-PCR) using a test based on an assay developed at CDC (1). Serum rRT-PCR testing for dengue virus and chikungunya virus was negative. Serologic testing was negative for Zika virus immunoglobulin M (IgM) antibodies using the CDC Zika IgM antibody capture enzyme-linked immunosorbent assay (Zika MAC-ELISA) and negative for dengue virus and chikungunya virus IgM antibodies using InBios ELISA kits (InBios International, Inc., Seattle, Washington). Confirmatory serologic testing at the CDC Arbovirus Diagnostic Laboratory was equivocal for Zika virus IgM antibodies using the Zika MAC-ELISA. Plaque-reduction neutralization tests (PRNTs) performed at the CDC Arbovirus Diagnostic Laboratory confirmed a recent Zika virus infection. Convalescent serologic testing performed at the Maryland DHMH Laboratories Administration on day 56 (40 days after symptom onset) was equivocal for Zika virus IgM antibodies using the CDC Zika MAC-ELISA and negative for dengue virus and chikungunya virus IgM antibodies using InBios ELISA kits. PRNTs performed at the CDC Arbovirus Diagnostic Laboratory confirmed a recent, unspecified flavivirus infection. The woman’s male sex partner was interviewed on day 26 after his return to the United States. He reported that he had no symptoms consistent with Zika virus infection (i.e., fever, rash, conjunctivitis, or arthralgias) either during his travel or since his return, and he did not have any of the following other symptoms: myalgias, chills, eye pain, oral ulcers, genital ulcers, anal ulcers, hematospermia, hematuria, dysuria, and prostate pain. He reported feeling tired, which he attributed to having recently traveled. Serum, plasma, and urine specimens were collected from him on day 29, at which time he reported no new symptoms. Zika virus rRT-PCR testing performed at the Maryland DHMH Laboratories Administration was negative on serum and plasma and equivocal on urine. Serologic testing was positive for Zika virus IgM antibodies using the CDC Zika MAC-ELISA and positive for dengue virus IgM antibodies using an InBios ELISA kit. PRNTs performed at the CDC Arbovirus Diagnostic Laboratory confirmed a recent, unspecified flavivirus infection. Semen collected on day 31 had no detectable Zika virus RNA by rRT-PCR testing performed at the Maryland DHMH Laboratories Administration. To date, only one other case has been reported in which a man without symptoms might have sexually transmitted Zika virus to his female partner (2). However, in that reported case, both the man and the woman had traveled to a country with ongoing Zika virus transmission where they were likely exposed to mosquitoes. In that case, although the detection of Zika virus RNA in the woman’s serum and urine by rRT-PCR 39 days after return from travel suggested sexual transmission from her male partner, it could not be ruled out that she had been infected from a mosquito bite during travel and had a longer than average incubation period or a prolonged period of viremia. No cases of sexual transmission of Zika virus from an asymptomatic man returning from travel to an area with active Zika transmission to his female sex partner who did not travel have been reported. Absence of Zika virus symptoms in persons returning from areas with ongoing Zika virus transmission might not preclude sexual transmission of Zika virus to their sex partners. Ongoing surveillance is needed to determine the risk for sexual transmission of Zika virus infection from asymptomatic persons. The findings in this report indicate that it might be appropriate to consider persons who have condomless sex with partners returning from areas with ongoing Zika virus transmission as exposed to Zika virus, regardless of whether the returning traveler reports symptoms of Zika virus infection. Providers should request Zika virus testing for any patients with illness compatible with Zika virus disease who have had sexual exposure without barrier devices to prevent infections to a partner who traveled to an area with active Zika virus transmission (3). Such patients should also be reported to local or state health departments (4,5). Current recommendations for the prevention of sexual transmission of Zika virus in returning travelers differ depending on whether the returning traveler is symptomatic and on whether the couple is planning to become pregnant (3,6). Couples in areas without active Zika transmission with circumstances in which one partner traveled to an area with active Zika virus transmission but did not develop symptoms of Zika virus disease should wait at least 8 weeks after the partner who traveled returned from the Zika-affected area before attempting conception, regardless of the sex of the traveler. Men with a diagnosis of Zika virus infection should wait at least 6 months before attempting conception, and women with a diagnosis of Zika virus infection should wait at least 8 weeks before attempting conception. Health care providers should counsel couples that correct and consistent use of condoms reduces the risk for sexually transmitted diseases and discuss the use of the most effective contraceptive methods that can be used correctly and consistently (6). Couples who do not desire pregnancy should consider abstaining from sex or using the most effective contraceptive methods that can be used correctly and consistently in addition to barrier methods, such as condoms, which reduce the risk for sexual transmission of Zika virus and other sexually transmitted infections (3). As more is learned about the incidence and duration of seminal shedding of Zika virus in infected men, recommendations to prevent sexual transmission of Zika virus will be updated if needed.

Richard B. Brooks, MD1,2; Maria Paz Carlos, PhD3; Robert A. Myers, PhD3; Mary Grace White, MPH4; Tanya Bobo-Lenoci, MS4; Debra Aplan, MSN5; David Blythe, MD2; Katherine A. Feldman, DVM2 Corresponding author: Richard B. Brooks, [email protected], 410-767-7395. Top 1Epidemic Intelligence Service, Division of Scientific Education and Professional Development, CDC; 2Prevention and Health Promotion Administration, Maryland Department of Health and Mental Hygiene; 3Maryland Department of Health and Mental Hygiene Laboratories Administration; 4Baltimore City Health Department, Maryland; 5Montgomery County Department of Health and Human Services, Maryland

Likely Sexual Transmission of Zika Virus from a Man with No Symptoms of Infection — Maryland, 2016 Early Release / August 26, 2016 / 65 http://www.cdc.gov/mmwr/volumes/65/wr/mm6534e2.htm?s_cid=mm6534e2_w

Aug 24 update ACTIVE INVESTIGATIONS The department is currently conducting 10 active investigations. 1) Identified one-square mile in Miami-Dade – Two (2) original cases Total # of Samples Collected Negative Samples Positive Samples Pending Results 519 492 27 0 Door to door outreach and sampling continue. Mosquito abatement and reduction activities are on-going. The department has cleared three portions within the one-square mile as no additional people tested positive in those areas. The CDC continues to monitor the area per their guidelines. 2) First Miami-Dade investigation outside of Wynwood: One (1) case Total # of Samples Collected Negative Samples Positive Samples Pending Results* 21 19 0 2 *Awaiting confirmatory testing from CDC to rule out infection. 3) One (1) case in Palm Beach County: Total # of Samples Collected Negative Samples Positive Samples Pending Results 3 3 0 0 4) Second Miami-Dade investigation outside of Wynwood: One (1) case The investigation is beginning in this area in Miami-Dade County. Mosquito abatement and reduction activities will take place around the area of interest. 5) Third Miami-Dade investigation outside of Wynwood: One (1) case Total # of Samples Collected Negative Samples Positive Samples Pending Results 6 1 0 5 6) Fourth Miami-Dade investigation outside of Wynwood: One (1) case Total # of Samples Collected Negative Samples Positive Samples Pending Results 27 24 0 3 7) Sixth Miami-Dade investigation outside of Wynwood: One (1) case The investigation is beginning in this area in Miami-Dade County. Mosquito abatement and reduction activities will take place around the area of interest. 8) Miami-Beach Investigation: Five index cases, 3 are out of state The investigation is beginning in this area in Miami-Dade County. Mosquito abatement and reduction activities will take place around the area of interest. 9) Pinellas Investigation: One (1) case Total # of Samples Collected Negative Samples Positive Samples Pending Results 3 0 0 3 10) Second Palm Beach County Investigation: One (1) case The investigation is beginning in Palm Beach County. Mosquito abatement and reduction activities will take place around the area of interest. CLOSED INVESTIGATIONS The department has closed out the investigations into the first cases in Miami-Dade and Broward County (two cases). On Aug. 23, the department had enough information to close two of the ongoing investigations in Miami-Dade County, both were determined to be single cases with no additional transmission or linkage to areas of active transmission. Data as of Aug. 24, 2016 - 12:58pm EST http://www.floridahealth.gov/diseases-and-conditions/zika-virus/index.html?utm_source=flhealthIndex

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ