niman

Recent reports on the mosquito spread of Zika in the Wynwood area of Miami, Florida have highlighted the effects of CDC guidelines which focused on imported cases of Zika and largely ignored local spread. Although the CDC and Florida Department of Health noted the spread of Zika in localized area in Wynwood, the more detailed media reports describe a very high attack rate involving local spread, beginning in early June. The focus on imported cases creates a challenging environment for testing for cases who had not recently traveled outside of of the United States, and created the myth that local transmission was not a serious consideration in the continental US. The WSJ report on the index location cited an unpublished report noting that 14 of the 30 employees at the index company had been symptomatic, beginning in early June, signaling local spread for two months prior to confirmation of the first local case (which was in Miami Dade county, but not linked to the Wynwood cluster). The description of the index location, which included multiple trips of employees to Brazil, as well as the roommate of the index case, matches a local pipe and plumbing supply company located in the hot zone. Stored at the company's sites were pipes of a variety of sizes as well as cement buckets, which would provide an ideal environment for mosquito breeding. The local company had expanded its business to the Caribbean and Central and South America, creating multiple opportunities for Zika seeding of the local mosquito population. Moreover, the composition of the workforce would help explain the dominance of male confirmed cases. In addition, the report of symptoms in almost 50% of the local workforce suggests that the attack rate was near 100% since most Zika cases are asymptomatic. This high attack rate was supported by uro-surveillance of residents near the intersection of NW 30th St & First Avenue, which is one block from the pipe company. The surveillance of 52 asymptomatic residents identified 6 reported cases. However, the frequency of infections was likely higher because the uro-surveillance would only detect recent infections, and cases infected in June or early July would largely test as negative due to viral clearance. In contrast to the IgM testing of employees, CDC reports suggested that similar antibody testing was not done on asymptomatic residents. In addition to the above results for local residents, media reports for another site, Wynwood Yards, which is located 1 1/2 blocks from the pipe company, cited multiple symptomatic employees, including hospitalized cases. At least two of those employees have been PCR Zika confirmed, with results from most cases having not been reported yet. Like the index company, the multiple symptomatic cases suggest a significantly larger number of employees who were infected, but were asymptomatic or had a limited number of mild symptoms. These reports describe alarming mosquito spread while CDC guidelines excluded testing of non-travel cases and created an environment that significantly reduced consideration for testing of victims by health care providers.

Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KX266255.1| Zika virus isolate ZIKV_SMGC-1, complete genome 18521 18521 100% 0.0 100% KX266255.1 Select seq gb|KX253996.1| Zika virus isolate ZKC2/2016, complete genome 18521 18521 100% 0.0 99% KX253996.1 Select seq gb|KU955589.1| Zika virus isolate Z16006 polyprotein gene, complete cds 18521 18521 100% 0.0 99% KU955589.1 Select seq gb|KX185891.1| Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds 18516 18516 100% 0.0 99% KX185891.1 Select seq gb|KU963796.1| Zika virus isolate SZ-WIV01 polyprotein gene, complete cds 18516 18516 100% 0.0 99% KU963796.1 Select seq gb|KU820899.2| Zika virus isolate ZJ03, complete genome 18512 18512 100% 0.0 99% KU820899.2 Select seq gb|KU866423.2| Zika virus isolate Zika virus/SZ01/2016/China polyprotein gene, complete cds 18507 18507 100% 0.0 99% KU866423.2 Select seq gb|KX117076.1| Zika virus isolate Zhejiang04, complete genome 18507 18507 100% 0.0 99% KX117076.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 18386 18386 100% 0.0 99% KX369547.1 Select seq gb|KJ776791.1| Zika virus strain H/PF/2013 polyprotein gene, complete cds 18386 18386 100% 0.0 99% KJ776791.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 18341 18341 100% 0.0 99% KU509998.3 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 18323 18323 100% 0.0 99% KX280026.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 18323 18323 100% 0.0 99% KX051563.1 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 18318 18318 100% 0.0 99% KU991811.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 18318 18318 100% 0.0 99% KU321639.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 18309 18309 100% 0.0 99% KU729218.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 18309 18309 100% 0.0 99% KU707826.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 18309 18309 100% 0.0 99% KU365779.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 18305 18305 100% 0.0 99% KX262887.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 18305 18305 100% 0.0 99% KX197192.1 Select seq gb|KX198135.1| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 18296 18296 100% 0.0 99% KX198135.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 18296 18296 100% 0.0 99% KU926309.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 18296 18296 100% 0.0 99% KU501217.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 18296 18296 100% 0.0 99% KU365780.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 18291 18291 100% 0.0 99% KU940228.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 18291 18291 100% 0.0 99% KU647676.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 18291 18291 100% 0.0 99% KU501216.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 18291 18291 100% 0.0 99% KU365777.1 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 18287 18287 100% 0.0 99% KU758877.1 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 18287 18287 100% 0.0 99% KX247646.1 Select seq gb|KX156776.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 18287 18287 100% 0.0 99% KX156776.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 18283 18283 99% 0.0 99% KU497555.1 Select seq gb|KX156774.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 18282 18282 100% 0.0 99% KX156774.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 18282 18282 100% 0.0 99% KU729217.2 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 18282 18282 100% 0.0 99% KU527068.1 Select seq gb|KU820897.3| Zika virus isolate FLR polyprotein gene, complete cds 18278 18278 100% 0.0 99% KU820897.3 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 18278 18278 100% 0.0 99% KX247632.1 Select seq gb|KX156775.1| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 18278 18278 100% 0.0 99% KX156775.1 Select seq gb|KX087102.1| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 18278 18278 100% 0.0 99% KX087102.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 18278 18278 100% 0.0 99% KU365778.1 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 18278 18278 100% 0.0 99% KU312312.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 18273 18273 100% 0.0 99% KX520666.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 18273 18273 100% 0.0 99% KU922960.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 18269 18269 100% 0.0 99% KX548902.1 Select seq gb|KX446951.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 18269 18269 100% 0.0 99% KX446951.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 18269 18269 100% 0.0 99% KU937936.1 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 18269 18269 100% 0.0 99% KU926310.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 18269 18269 100% 0.0 99% KU922923.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 18269 18269 100% 0.0 99% KU501215.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 18264 18264 100% 0.0 99% KX601168.1 Select seq gb|KX446950.1| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 18264 18264 100% 0.0 99% KX446950.1 Select seq gb|KX087101.2| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 18264 18264 100% 0.0 99% KX087101.2 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 18264 18264 100% 0.0 99% KU870645.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 18260 18260 100% 0.0 99% KX377337.1 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 18260 18260 100% 0.0 99% KU853013.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 18258 18258 100% 0.0 99% KU853012.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 18251 18251 100% 0.0 99% KU820898.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 18251 18251 100% 0.0 99% KU740184.2 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 18251 18251 100% 0.0 99% KU761564.1 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 18245 18245 100% 0.0 99% KX056898.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 18245 18245 100% 0.0 99% KU955590.1 Select seq gb|KU940224.1| Zika virus isolate Bahia09, partial genome 18197 18197 99% 0.0 99% KU940224.1 Select seq gb|KU744693.1| Zika virus isolate VE_Ganxian, complete genome 18101 18101 100% 0.0 99% KU744693.1 Select seq gb|KU681081.3| Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome 18047 18047 100% 0.0 99% KU681081.3 Select seq gb|KU955593.1| Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome 17750 17750 100% 0.0 98% KU955593.1 Select seq gb|JN860885.1| Zika virus isolate FSS13025 polyprotein gene, partial cds 17750 17750 99% 0.0 98% JN860885.1 Select seq gb|KF993678.1| Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds 17685 17685 98% 0.0 99% KF993678.1 Select seq gb|EU545988.1| Zika virus polyprotein gene, complete cds 17603 17603 100% 0.0 98% EU545988.1 Select seq gb|KU681082.3| Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome 17439 17439 100% 0.0 98% KU681082.3 Select seq gb|KX601167.1| Zika virus strain ZIKV/Aedes sp./MYS/P6-740/1966, complete genome 16438 16438 100% 0.0 95% KX601167.1 Select seq gb|HQ234499.1| Zika virus isolate P6-740 polyprotein gene, partial cds 16429 16429 99% 0.0 95% HQ234499.1 Select seq gb|KX377336.1| Zika virus strain P6-740, complete genome 16424 16424 100% 0.0 95% KX377336.1 Select seq gb|KU720415.1| Zika virus strain MR 766 polyprotein gene, complete cds 13283 13283 100% 0.0 89% KU720415.1 Select seq gb|HQ234498.1| Zika virus isolate MR_766 polyprotein gene, partial cds 13277 13277 99% 0.0 89% HQ234498.1 Select seq gb|KX377335.1| Zika virus strain MR-766, complete genome 13268 13268 100% 0.0 89% KX377335.1 Select seq gb|KF383115.1| Zika virus strain ArB1362 polyprotein gene, complete cds 13266 13266 100% 0.0 89% KF383115.1 Select seq gb|KF383119.1| Zika virus strain ArD158084 polyprotein gene, complete cds 13265 13265 100% 0.0 89% KF383119.1 Select seq gb|KF268949.1| Zika virus isolate ARB15076 polyprotein gene, complete cds 13263 13263 100% 0.0 89% KF268949.1 Select seq gb|DQ859059.1| Zika virus strain MR 766 polyprotein gene, complete cds 13263 13263 100% 0.0 89% DQ859059.1 Select seq gb|KU955595.1| Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome 13259 13259 100% 0.0 89% KU955595.1 Select seq dbj|LC002520.1| Zika virus genomic RNA, complete genome, strain: MR766-NIID 13259 13259 100% 0.0 89% LC002520.1 Select seq gb|KU955592.1| Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome 13250 13250 100% 0.0 89% KU955592.1 Select seq gb|KF268948.1| Zika virus isolate ARB13565 polyprotein gene, complete cds 13245 13245 100% 0.0 89% KF268948.1 Select seq gb|KX601169.1| Zika virus strain ZIKV/Macaca mulatta/UGA/MR-766/1947, complete genome 13243 13243 100% 0.0 89% KX601169.1 Select seq gb|KU963573.1| Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds 13243 13243 100% 0.0 89% KU963573.1 Select seq gb|KU955594.1| Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome 13243 13243 100% 0.0 89% KU955594.1 Select seq gb|KX198134.1| Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome 13238 13720 100% 0.0 89% KX198134.1 Select seq gb|KF268950.1| Zika virus isolate ARB7701 polyprotein gene, complete cds 13238 13238 100% 0.0 89% KF268950.1 Select seq gb|KU955591.1| Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome 13232 13232 100% 0.0 89% KU955591.1 Select seq gb|HQ234501.1| Zika virus isolate ArD_41519 polyprotein gene, partial cds 13210 13210 99% 0.0 89% HQ234501.1 Select seq gb|KF383116.1| Zika virus strain ArD7117 polyprotein gene, complete cds 13209 13209 100% 0.0 89% KF383116.1 Select seq gb|AY632535.2| Zika virus strain MR 766, complete genome 13201 13201 100% 0.0 89% AY632535.2 Select seq gb|KX601166.1| Zika virus strain ZIKV/Aedes africanus/SEN/DakAr41524/1984, complete genome 13176 13176 100% 0.0 88% KX601166.1 Select seq gb|KF383117.1| Zika virus strain ArD128000 polyprotein gene, complete cds 13138 13138 100% 0.0 88% KF383117.1 Select seq gb|KU963574.1| Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds 13118 13221 100% 0.0 88% KU963574.1 Select seq gb|HQ234500.1| Zika virus isolate IbH_30656 polyprotein gene, partial cds 13117 13117 99% 0.0 88% HQ234500.1 Select seq gb|KF383118.1| Zika virus strain ArD157995 polyprotein gene, complete cds 12947 13015 100% 0.0 88% KF383118.1 Select seq gb|KF383121.1| Zika virus strain ArD158095 polyprotein gene, partial cds 12861 12861 97% 0.0 89% KF383121.1 Select seq gb|KX576684.1| Zika virus vector pZIKV-ICD, complete sequence 10900 18324 100% 0.0 99% KX576684.1

LOCUS KX266255 10785 bp RNA linear VRL 10-AUG-2016 DEFINITION Zika virus isolate ZIKV_SMGC-1, complete genome. ACCESSION KX266255 VERSION KX266255.1 GI:1032810274 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10785) AUTHORS Bi,Y., Wang,Q., Yang,Y., Liu,Y. and Gao,G.F. TITLE Genetic and Biological Characterization for Zika Viruses Imported through Shenzhen Port JOURNAL Chin. Sci. Bull. 61 (22), 2463-2474 (2016) REFERENCE 2 (bases 1 to 10785) AUTHORS Bi,Y., Wang,Q., Yang,Y., Liu,Y. and Gao,G.F. TITLE Direct Submission JOURNAL Submitted (11-MAY-2016) CAS Key Laboratory of Pathogenic Microbiology and Immunology, Institute of Microbiology, Chinese Academy of Sciences, No. 1 West Beichen Road Chaoyang District, Beijing 100101, China COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10785 /organism="Zika virus" /mol_type="genomic RNA" /isolate="ZIKV_SMGC-1" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="China" /collection_date="14-Feb-2016" /note="passage details: Vero cells" CDS 99..10370 /codon_start=1 /product="polyprotein" /protein_id="ANH21697.1" /db_xref="GI:1032810275" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTNVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGARRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFQAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPXVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPMLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRSMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVRPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 tctgtgtgaa tcagactgcg acagttcgag tttgaagcga aagctagcaa cagtatcaac 61 aggttttatt ttggatttgg aaacgagagt ttctggtcat gaaaaaccca aaaaagaaat 121 ccggaggatt ccggattgtc aatatgctaa aacgcggagt agcccgtgtg agcccctttg 181 ggggcttgaa gaggctgcca gccggacttc tgctgggtca tgggcccatc aggatggtct 241 tggcgattct agccttcttg agattcacgg caatcaagcc atcactgggt ctcatcaata 301 gatggggttc agtggggaaa aaagaggcta tggaaataat aaagaagttc aagaaagatc 361 tggctgccat gctgagaata atcaatgcta ggaaggagaa gaagagacga ggcgcagata 421 ctaatgtcgg aattgttggc ctcctgctga ccacagctat ggcagcggag gtcactagac 481 gtgggagtgc atactatatg tacttggaca gaaacgatgc tggggaggcc atatcttttc 541 caaccacatt ggggatgaat aagtgttata tacagatcat ggatcttgga cacatgtgtg 601 atgccaccat gagctatgaa tgccctatgc tggatgaggg ggtggaacca gatgacgtcg 661 attgttggtg caacacgacg tcaacttggg ttgtgtacgg aacctgccat cacaaaaaag 721 gtgaagcacg gagatctaga agagctgtga cgctcccctc ccattccact aggaagctgc 781 aaacgcggtc gcaaacttgg ttggaatcaa gagaatacac aaagcacttg attagagtcg 841 aaaattggat attcaggaac cctggcttcg cgttagcagc agctgccatc gcttggcttt 901 tgggaagctc aacgagccaa aaagtcatat acttggtcat gatactgctg attgccccgg 961 catacagcat caggtgcata ggagtcagca atagggactt tgtggaaggt atgtcaggtg 1021 ggacttgggt tgatgttgtc ttggaacatg gaggttgtgt caccgtaatg gcacaggaca 1081 aaccgactgt cgacatagag ctggttacaa caacagtcag caacatggcg gaggtaagat 1141 cctactgcta tgaggcatca atatcggaca tggcttcgga cagccgctgc ccaacacaag 1201 gtgaagccta ccttgacaag caatcagaca ctcaatatgt ctgcaaaaga acgttagtgg 1261 acagaggctg gggaaatgga tgtggacttt ttggcaaagg gagcctggtg acatgcgcta 1321 agtttgcatg ctccaagaaa atgaccggga agagcatcca gccagagaat ctggagtacc 1381 ggataatgct gtcagttcat ggctcccagc acagtgggat gatcgttaat gacacaggac 1441 atgaaactga tgagaataga gcgaaggttg agataacgcc caattcacca agagccgaag 1501 ccaccctggg gggttttgga agcctaggac ttgattgtga accgaggaca ggccttgact 1561 tttcagattt gtattacttg actatgaata acaagcactg gttggttcac aaggagtggt 1621 tccacgacat tccattacct tggcacgctg gggcagacac cggaactcca cactggaaca 1681 acaaagaagc actggtagag ttcaaggacg cacatgccaa aaggcaaact gtcgtggttc 1741 tagggagtca agaaggagca gttcacacgg cccttgctgg agctctggag gctgagatgg 1801 atggtgcaaa gggaaggctg tcctctggcc acttgaaatg tcgcctgaaa atggataaac 1861 ttagattgaa gggcgtgtca tactccttgt gtaccgcagc gttcacattc accaagatcc 1921 cggctgaaac actgcacggg acagtcacag tggaggtaca gtacgcaggg acagatggac 1981 cttgcaaggt tccagctcag atggcggtgg acatgcaaac tctgacccca gttgggaggc 2041 tgataaccgc taaccccgta atcactgaaa gcactgagaa ctccaagatg atgctggaac 2101 ttgatccacc atttggggac tcttacattg tcataggagt cggggagaag aagatcaccc 2161 accactggca caggagtggc agcaccattg gaaaagcatt tgaagccact gtgagaggtg 2221 ccaggagaat ggcagtcttg ggagacacag cctgggactt tggatcagtt ggaggcgctc 2281 tcaactcatt gggcaagggc atccatcaaa tttttggagc agctttcaaa tcattgtttg 2341 gaggaatgtc ctggttctca caaattctca ttggaacgtt gctgatgtgg ttgggtctga 2401 acacaaagaa tggatctatt tcccttatgt gcttggcctt agggggagtg ttgatcttct 2461 tatccacagc cgtctctgct gatgtggggt gctcggtgga cttctcaaag aaggagacga 2521 gatgcggtac aggggtgttc gtctataacg acgttgaagc ctggagggac aggtacaagt 2581 accatcctga ctccccccgt agattggcag cagcagtcaa gcaagcctgg gaagatggta 2641 tctgtgggat ctcctctgtt tcaagaatgg aaaacatcat gtggagatca gtagaagggg 2701 agctcaacgc aatcctggaa gagaatggag ttcaactgac ggtcgttgtg ggatctgtaa 2761 aaaaccccat gtggagaggt ccacagagat tgcccgtgcc tgtgaacgag ctgccccacg 2821 gctggaaggc ttgggggaaa tcgtacttcg tcagagcagc aaagacaaat aacagctttg 2881 tcgtggatgg tgacacactg aaggaatgcc cactcaaaca tagagcatgg aacagctttc 2941 ttgtggagga tcatgggttc ggggtatttc acactagtgt ctggctcaag gttagagaag 3001 attattcatt agagtgtgat ccagccgtta ttggaacagc tgttaaggga aaggaggctg 3061 tacacagtga tctaggctac tggattgaga gtgagaagaa tgacacatgg aggctgaaga 3121 gggcccatct gatcgagatg aaaacatgtg aatggccaaa gtcccacaca ttgtggacag 3181 atggaataga agagagtgat ctgatcatac ccaagtcttt agctgggcca ctcagccatc 3241 acaataccag agagggctac aggacccaaa tgaaagggcc atggcacagt gaagagcttg 3301 aaattcggtt tgaggaatgc ccaggcacca aggtccacgt ggaggaaaca tgtggaacaa 3361 gaggaccatc tctgagatca accactgcaa gcggaagggt gatcgaggaa tggtgctgca 3421 gggagtgcac aatgccccca ctgtcgttcc aggctaaaga tggctgttgg tatggaatgg 3481 agataaggcc caggaaagaa ccagaaagta acttagtaag gtcaatggtg actgcaggat 3541 caactgatca catggatcac ttctcccttg gagtgcttgt gattctgctc atggtgcagg 3601 aagggctgaa gaagagaatg accacaaaga tcatcataag cacatcaatg gcagtgctgg 3661 tagctatgat cctgggagga ttttcaatga gtgacctggc taagcttgca attttgatgg 3721 gtgccacctt cgcggaaatg aacactggag gagatgtagc tcatctggcg ctgatagcgg 3781 cattcaaagt cagaccagcg ttgctggtat ctttcatctt cagagctaat tggacacccc 3841 gtgaaagcat gctgctggcc ttggcctcgt gtcttttgca aactgcgatc tccgccttgg 3901 aaggcgacct gatggttctc atcaatggtt ttgctttggc ctggttggca atacgagcga 3961 tggttgttcc acgcactgat aacatcacct tggcaatcct ggctgctctg acaccactgg 4021 cccggggcac actgcttgtg gcgtggagag caggccttgc tacttgcggg gggtttatgc 4081 tcctctctct gaagggaaaa ggcagtgtga agaagaactt accanttgtc atggccctgg 4141 gactaaccgc tgtgaggctg gtcgacccca tcaacgtggt gggactgctg ttgctcacaa 4201 ggagtgggaa gcggagctgg ccccctagcg aagtactcac agctgttggc ctgatatgcg 4261 cattggctgg agggttcgcc aaggcagata tagagatggc tgggcccatg gccgcggtcg 4321 gtctgctaat tgtcagttac gtggtctcag gaaagagtgt ggacatgtac attgaaagag 4381 caggtgacat cacatgggaa aaagatgcgg aagtcactgg aaacagtccc cggcttgatg 4441 tggcgctaga tgagagtggt gatttctccc tggtggagga tgacggtccc cccatgagag 4501 agatcatact caaggtggtc ctgatgacca tctgtggcat gaacccaata gccataccct 4561 ttgcagctgg agcgtggtac gtatacgtga agactggaaa aaggagtgga gctctatggg 4621 atgtgcctgc tcccaaggaa gtaaaaaagg gggagaccac agatggagtg tacagagtga 4681 tgactcgtag actgctaggt tcaacacaag ttggagtggg agttatgcaa gagggggtct 4741 ttcacaccat gtggcacgtc acaaaaggat ccgcgctgag aagcggtgaa gggagacttg 4801 atccatactg gggagatgtc aagcaggatc tggtgtcata ctgtggtcca tggaagctag 4861 atgccgcctg ggacgggcac agcgaggtgc agctcttggc cgtgcccccc ggagagagag 4921 cgaggaacat ccagactctg cccggaatat ttaagacaaa ggatggggac attggagcgg 4981 ttgcgctgga ttacccagca ggaacttcag gatctccaat cctagacaag tgtgggagag 5041 tgataggact ttatggcaat ggggtcgtga tcaaaaatgg gagttatgtt agtgccatca 5101 cccaagggag gagggaggaa gagactcctg ttgagtgctt cgagccttcg atgctgaaga 5161 agaagcagct aactgtctta gacttgcatc ctggagctgg gaaaaccagg agagttcttc 5221 ctgaaatagt ccgtgaagcc ataaaaacaa gactccgtac tgtgatctta gctccaacca 5281 gggttgtcgc tgccgaaatg gaggaagccc ttagagggct tccagtgcgt tatatgacaa 5341 cagcagtcaa tgtcacccac tctggaacag aaatcgtcga cttaatgtgc catgccacct 5401 tcacttcacg tctactacag ccaatcagag tccccaacta taatctgtat attatggatg 5461 aggcccactt cacagatccc tcaagtatag cagcaagagg atacatttca acaagggttg 5521 agatgggcga ggcggctgcc atcttcatga ccgccacgcc accaggaacc cgtgacgcat 5581 ttccggactc caactcacca attatggaca ccgaagtgga agtcccagag agagcctgga 5641 gctcaggctt tgattgggtg acggatcatt ctggaaaaac agtctggttt gttccaagcg 5701 tgaggaacgg caatgagatc gcagcttgtc tgacaaaggc tggaaaacgg gtcatacagc 5761 tcagcagaaa gacttttgag acagagttcc agaaaacaaa acatcaagag tgggactttg 5821 tcgtgacaac tgacatttca gagatgggcg ccaactttaa agctgaccgt gtcatagatt 5881 ccaggagatg cctaaagccg gtcatacttg atggcgagag agtcattctg gctggaccca 5941 tgcctgtcac acatgccagc gctgcccaga ggagggggcg cataggcagg aatcccaaca 6001 aacctggaga tgagtatctg tatggaggtg ggtgcgcaga gactgacgaa gaccatgcac 6061 actggcttga agcaagaatg ctccttgaca atatttacct ccaagatggc ctcatagcct 6121 cgctctatcg acctgaggcc gacaaagtag cagccattga gggagagttc aagcttagga 6181 cggagcaaag gaagaccttt gtggaactca tgaaaagagg agatcttcct gtttggctgg 6241 cctatcaggt tgcatctgcc ggaataacct acacagatag aagatggtgc tttgatggca 6301 cgaccaacaa caccataatg gaagacagtg tgccggcaga ggtgtggacc agacacggag 6361 agaaaagagt gctcaaaccg aggtggatgg acgccagagt ttgttcagat cacgcggccc 6421 tgaagtcatt caaggagttt gccgctggga aaagaggagc ggcttttgga gtgatggaag 6481 ccttgggaac actgccagga cacatgacag agagattcca ggaagccatt gacaacctcg 6541 ctgtgctcat gcgggcagag actggaagca ggccttacaa agccgcggcg gcccaattgc 6601 cggagaccct agagaccatt atgcttttgg ggttgctggg aacagtctcg ctgggaatct 6661 ttttcgtctt gatgaggaac aagggcatag ggaagatggg ctttggaatg gtgactcttg 6721 gggccagcgc atggctcatg tggctctcgg aaattgagcc agccagaatt gcatgtgtcc 6781 tcattgttgt gttcctattg ctggtggtgc tcatacctga gccagaaaag caaagatctc 6841 cccaggacaa ccaaatggca atcatcatca tggtagcagt aggtcttctg ggcttgatta 6901 ccgccaatga actcggatgg ttggagagaa caaagagtga cctaagccat ctaatgggaa 6961 ggagagagga gggggcaacc ataggattct caatggacat tgacctgcgg ccagcctcag 7021 cttgggccat ctacgctgcc ttgacaactt tcattacccc agccgtccaa catgcagtga 7081 ccacttcata caacaactac tccttaatgg cgatggccac gcaagctgga gtgttgtttg 7141 gtatgggcaa agggatgcca ttctacgcat gggactttgg agtcccgctg ctaatgatag 7201 gttgctactc acaattaaca cccctgaccc taatagtagc catcattttg ctcgtggcgc 7261 actacatgta cttgatccca gggctgcagg cagcagctgc gcgtgctgcc cagaagagaa 7321 cggcagctgg catcatgaag aaccctgttg tggatggaat agtggtgact gacattgaca 7381 caatgacaat tgacccccaa gtggagaaaa agatgggaca ggtgctactc atagcagtag 7441 ccgtctccag cgccatactg tcgcggaccg cctgggggtg gggggaggct ggggccctga 7501 tcacagctgc aacttccact ttgtgggaag gctctccgaa caagtactgg aactcctcta 7561 cagccacttc actgtgtaac atttttaggg gaagttactt ggctggagct tctctaatct 7621 acacagtaac aagaaacgct ggcttggtca agagacgtgg gggtggaaca ggagagaccc 7681 tgggagagaa atggaaggcc cgcttgaacc agatgtcggc cctggagttc tactcctaca 7741 aaaagtcagg catcaccgag gtgtgcagag aagaggcccg ccgcgccctc aaggacggtg 7801 tggcaacggg aggccatgct gtgtcccgag gaagtgcaaa gctgagatgg ttggtggagc 7861 ggggatacct gcagccctat ggaaaggtca ttgatcttgg atgtggcaga gggggctgga 7921 gttactacgc cgccaccatc cgcaaagttc aagaagtgaa aggatacaca aaaggaggcc 7981 ctggtcatga agaacccatg ttggtgcaaa gctatgggtg gaacatagtc cgtcttaaga 8041 gtggggtgga cgtctttcat atggcggctg agccgtgtga cacgttgctg tgtgacatag 8101 gtgagtcatc atctagtcct gaagtggaag aagcacggac gctcagagtc ctttccatgg 8161 tgggggattg gcttgaaaaa agaccaggag ccttttgtat aaaagtgttg tgcccataca 8221 ccagcactat gatggaaacc ctggagcgac tgcagcgtag gtatggggga ggactggtca 8281 gagtgccact ctcccgcaac tctacacatg agatgtactg ggtctctgga gcgaaaagca 8341 acaccataaa aagtgtgtcc accacgagcc agctcctctt ggggcgcatg gacgggccca 8401 ggaggccagt gaaatatgag gaggatgtga atctcggctc tggcacgcgg gctgtggtaa 8461 gctgcgctga agctcccaac atgaagatca ttggtaaccg cattgaaagg atccgcagtg 8521 agcacgcgga aacgtggttc tttgacgaga accacccata taggacatgg gcttaccatg 8581 gaagctatga ggcccccaca caagggtcag cgtcctctct aataaacggg gttgtcaggc 8641 tcctgtcaaa accctgggac gtggtgactg gagtcacagg aatagccatg accgacacca 8701 caccgtatgg tcagcaaaga gttttcaagg aaaaagtgga cactagggtg ccagatcccc 8761 aagaaggcac tcgtcaggtt atgagcatgg tctcttcctg gttgtggaaa gagctaggca 8821 aacacaaacg gccacgagtc tgtaccaaag aagagttcat caacaaggtt cgtagcaatg 8881 cagcattagg ggcaatattt gaagaggaaa aagagtggaa gactgcagtg gaagctgtga 8941 acgatccaag gttctgggct ctagtggaca aggaaagaga gcaccacctg agaggagagt 9001 gccagagttg tgtgtacaac atgatgggaa aaagagaaaa gaaacaaggg gaatttggaa 9061 aggccaaggg cagccgcgcc atctggtata tgtggctagg ggctagattt ctagagttcg 9121 aagcccttgg attcttgaac gaggatcact ggatggggag agagaactca ggaggtggtg 9181 ttgaagggct gggattacaa agactcggat atgtcctaga agagatgagt cgcataccag 9241 gaggaaggat gtatgcagat gacactgctg gctgggacac ccgcatcagc aggtttgatc 9301 tggagaatga agctctaatc accaaccaaa tggagaaagg gcacagggcc ttggcattgg 9361 ccataatcaa gtacacatac caaaacaaag tggtaaaggt ccttagacca gctgaaaaag 9421 ggaagacagt tatggacatt atttcgagac aagaccaaag ggggagcgga caagttgtca 9481 cttacgctct taacacattt accaacctag tggtgcaact cattcggagt atggaggctg 9541 aggaagttct agagatgcaa gacttgtggc tgctgcggag gtcagagaaa gtgaccaact 9601 ggctgcagag caacggatgg gataggctca aacgaatggc agtcagtgga gatgattgcg 9661 ttgtgaggcc aattgatgat aggtttgcac atgccctcag gttcttgaat gatatgggga 9721 aagttaggaa ggacacacaa gagtggaaac cctcaactgg atgggacaac tgggaggaag 9781 ttccgttttg ctcccaccac ttcaacaagc tccatctcaa ggacgggagg tccattgtgg 9841 ttccctgccg ccaccaagat gaactgattg gccgggcccg cgtctctcca ggggcgggat 9901 ggagcatccg ggagactgct tgcctagcaa aatcatatgc gcaaatgtgg cagctccttt 9961 atttccacag aagggacctc cgactgatgg ccaatgccat ttgttcatct gtgccagttg 10021 actgggttcc aactgggaga actacctggt caatccatgg aaagggagaa tggatgacca 10081 ctgaagacat gcttgtggtg tggaacagag tgtggattga ggagaacgac cacatggaag 10141 acaagacccc agttacgaaa tggacagaca ttccctattt gggaaaaagg gaagacttgt 10201 ggtgtggatc tctcataggg cacagaccgc gcaccacctg ggctgagaac attaaaaaca 10261 cagtcaacat ggtgcgcagg atcataggtg atgaagaaaa gtacatggac tacctatcca 10321 cccaagttcg ctacttgggt gaagaagggt ctacacctgg agtgctgtaa gcaccaatct 10381 tagtgttgtc aggcctgcta gtcagccaca gcttggggaa agctgtgcag cctgtgaccc 10441 ccccaggaga agctgggaaa ccaagcctat agtcaggccg agaacgccat ggcacggaag 10501 aagccatgct gcctgtgagc ccctcagagg acactgagtc aaaaaacccc acgcgcttgg 10561 aggcgcagga tgggaaaaga aggtggcgac cttccccacc ctttaatctg gggcctgaac 10621 tggagatcag ctgtggatct ccagaagagg gactagtggt tagaggagac cccccggaaa 10681 acgcaaaaca gcatattgac gctgggaaag accagagact ccatgagttt ccaccacgct 10741 ggccgccagg cacagatcgc cgaatagcgg cggccggtgt gggga

CAS Key Laboratory of Pathogenic Microbiology and Immunology has release a full 2016 sequence, SMGC-1, from Shenzhen ex-Samoa.

The Wynwood Yard Founder Talks Closing, Reopening And Positive Zika Tests By SAMMY MACK • AUG 10, 2016 SHARETwitter Facebook Google+ Email Della Heiman talks with The Wynwood Yard team members at a meeting ahead of the venue's reopening. CREDIT TRINA SARGALSKI / THE WYNWOOD YARD It’s been a little over a week since it was confirmed that the Zika virus has spread locally in Miami’s Wynwood neighborhood. In the heart of that neighborhood is The Wynwood Yard—an all-outdoor food and culture venue. Within hours of the Zika announcement, Della Heiman—founder of the Wynwood Yard and owner of Della Test Kitchen—temporarily closed the space. She decided not to charge rent to the six other businesses at the Yard for the week they’ve been closed. She says part of her decision was based on the concern that, in hindsight, several people who work at the Yard had experienced symptoms similar to Zika infection. Since her decision to close, the health department has offered testing to 85 of the people who work at the Yard—at least 65 of them volunteered to get screened. The results aren’t all in yet, but Heiman says one of the employees has already told her the test came back positive. UPDATE 8/11/16: Two employees now say they've tested positive, others are still waiting for results. The Wynwood Yard has released a FAQ about it. The Wynwood Yard is scheduled to reopen on Wednesday. Heiman spoke with WLRN just before the results started to come in: Listen Listening... 3:54 Listen: Della Heiman talks about the rough business decisions to close and reopen The Wynwood Yard. What are some of the things that, with hindsight, you were looking at and saying, “oh, maybe some of these employees had had Zika”? We had a couple of employees who were complaining about things like rashes, fever, headaches, joint pain. But at that time there had been no reported cases of Zika in the continental US. We had a couple of employees who were admitted to local hospitals. So then we really started to get concerned. You actually called the department of health, what did they initially tell you? My first conversation with them, they told me to follow mosquito control protocol. They told me to drain cover. They sent me a report that they had taken notes on our space a couple of days before. And they told us to make sure that we didn't have tarps or anything laying around that could collect water—which we had already taken care of once. They told me that they would have to do some further investigation before they could consider testing any members of my team. What were some of the things that were weighing on your mind while you were trying to decide whether or not to close, and how to approach it? It's funny because I kept thinking about a lot of my ethics classes in business school. In our ethics class, we would talk a lot about three lenses to think about any kind of business dilemma: one of them was the economic lens; one of them was the legal lens; and one of them was that ethical or moral lens. For me, the ethical lens always takes precedent. And that was really stressful for me because I felt like I would be letting a lot of people down by closing. But ultimately, it just didn't feel like the right thing to do to operate business as normal when I had suspected cases. What was the reaction that you got from the people who work there? My team has been amazing. We’re part of a really tight-knit community. And people are just extremely dedicated, hardworking and they care a lot about one another. There was a unanimous response from my team of gratitude for looking out for their safety and their wellbeing. We did our best to put as many people as possible on paid leave. Have you gotten any pushback from people who would rather that you stay open? I think that in the beginning there definitely was some pushback and some questioning about why I had made that decision—especially when I wasn't getting any official recommendations from the DOH or the CDC to close. But once, behind closed doors, people understood that we did have some suspected cases and that we were trying to approach it as responsibly as we could, it was really just a lot of support. How much is it costing you to stay closed? In addition to the loss of revenue for this week, we've put a lot of people on paid leave. And then there's also just a lot of fixed costs associated with the venue. Has anybody offered you any kind of emergency financial help with all of this? My landlord sponsored a new mosquito prevention system, which was very much appreciated. But nobody from any public authority has come to me and offered me financial incentives to close or financial support. Now you've got the health department offering tests to anybody who works there. How did that happen? I tried to get in touch with the health department earlier in the day on Tuesday and the response just wasn't urgent. And I felt that the situation required urgency. We have multiple members of our team that are either pregnant or they have partners who are pregnant. Basically throughout that afternoon I just started to escalate it up. I pushed pretty adamantly for testing our entire team. The testing was completely voluntary. But I thought that it would be important from an epidemiological perspective to understand what was happening with a population that had been standing in the middle of this suspected zone for the past two months, getting eaten alive by mosquitoes. And if the answer turned out that nobody had it, then that would be great, too. What happens if there are people who work at the Yard who come back with positive confirmation that they have, or have had, Zika? We're just going to be completely honest with our community about that. And we're going to take every single precaution to make sure that there's no transmission at the Yard. We’re putting a lot of measures in place. Some of those measures are: training amongst our team members; we’re putting in a MosquitoNix system that basically emits a mist every couple of hours that is deadly to mosquitoes and other insects; we’re offering bug spray to all of our guests. Ultimately we're going to reopen in any case. But I need to be able to communicate an honest message with the public. And I can't do that until I have information http://wlrn.org/post/wynwood-yard-founder-talks-closing-reopening-and-positive-zika-tests.

THE WYNWOOD YARD RE-OPENING FAQ The Wynwood Yard is open again as of Wednesday, August 10th. Thank you to our team members, guests and community for your patience and support during a challenging week. We are eager to welcome Miami back home to The Yard. The Wynwood Yard CEO and founder Della Heiman recently spoke with WLRN-Miami Herald News about the team’s decision making process and the rationale for closing. You can listen here. 1. WHAT’S NEW? (THURSDAY, 8/11/16) Last night, The Wynwood Yard management received news of an additional positive Zika confirmation from the pool of voluntary employee tests that were arranged with the Department of Health last Thursday. This brings the total confirmed Zika cases among The Wynwood Yard employees to two. Please note that this second person is part of the same group of more than 65 employees that was tested at the Department of Health last Thursday---the results were just not received all at once. Because The Wynwood Yard has not been provided with an aggregate number of positive results among employees by the Florida Department of Health after last Thursday’s voluntary test, the management team is relying on voluntary reports by employees to the leadership team. The data we are sharing is just the internal count based on information that has been disclosed to management by our team members. This does not necessarily mean that there is a “new case of Zika in Miami”, as our number is likely already reflected in the DOH and CDC’s count for Miami. To reiterate, this is not a new report of someone who is sick or a new suspicion of Zika illness. This is a result that has just come to the management’s attention, from the same pool that was tested last Thursday. We are simply reporting information as we receive it relative to that group testing last Thursday. 2. IS EVERYONE OK? Yes. Thankfully all employees of The Wynwood Yard are doing well now. We have no new suspected cases of illness. 3. IS THE WYNWOOD YARD “GROUND ZERO” FOR ZIKA IN MIAMI? We have not received information from the CDC or DOH on this, but based on all of the information that we have obtained as an organization, the answer is no. The first cases of Zika infection in Miami have been linked to mid-June, more than a month before any of our team members reported experiencing symptoms. 4. IS THE WYNWOOD YARD THE 500-SQUARE-FOOT-AREA THAT IS MENTIONED BY THE CDC? We understand that some people are curious about this and so we wanted to address the question directly. We don’t know. We have not been informed by the CDC or the DOH that this is the case. The Wall Street Journal recently reported on what is known about how Zika may have started in Wynwood. However, we want to reiterate that The Wynwood Yard is a safe place to visit and we encourage you to read more about why we decided to re-open and the safety measures we have implemented (below). 5. WHY DID THE WYNWOOD YARD MANAGEMENT DECIDE TO CLOSE? Because of its unique nature as a 100% outdoor venue and in response to management and employee concerns and suspicions of Zika infection, The Wynwood Yard closed Tuesday, August 2nd, 2016, in order to make sure it is providing the most prepared, comfortable and secure environment possible to its team and guests. Upon notification of possible Zika infection in the area, The Wynwood Yard immediately closed and has been in contact with the Department of Health in order to offer voluntary Zika testing for all team members. The management of The Wynwood Yard has since learned that two team members were confirmed positive for Zika. The Wynwood Yard team continues to work closely with the City of Miami and Department of Health in order to follow CDC recommendations on Zika and to assure the well-being of all who work and play at The Yard. 6. IS IT SAFE FOR US TO VISIT THE WYNWOOD YARD? Yes. The Wynwood Yard decided to close on Tuesday, August 3rd in order to assure the well-being of guests, team members and the community based on concerns about potential Zika symptoms amongst our employees that came to light on Monday August 1st just as the CDC issued its travel advisory about the neighborhood. Since then, The Wynwood Yard arranged with the Department of Health to offer voluntary Zika testing for all its employees. The Department of Health has declared that the decision of The Wynwood Yard to re-open is a business decision, just as the decision to close was left up to our team. The Department of Health has not issued any instructions to The Wynwood Yard to close at this time. In addition, once the CDC restrictions to Wynwood were announced, The Wynwood Yard took further steps to ensure the safety and comfort of guests and team members: · We’ve stocked up on even more bug spray to have available for anyone on site who wishes to use them. As of Thursday, August 11th, we also have free mosquito repellent towelettes available. · Mosquito Nix is installing a state-of-the-art mitigation system, using natural botanical insecticides, in order to supplement the mosquito control measures that were in place before we made the choice to close. · We are continuing training with our team to ensure that everyone is knowledgeable about CDC guidelines, as well as our new mosquito mitigation measures. The Wynwood Yard has taken every measure possible in order to ensure the greater well-being, health and comfort of our guests, community and team members. Most importantly, we are deeply committed to being forthright with our team members, guests and community. This is a 100% outdoor venue and we advise everyone to follow current CDC guidelines, including restrictions on women who are pregnant or plan on getting pregnant, as well as their partners. 7. WHAT PREVENTATIVE MEASURES IS THE WYNWOOD YARD TAKING AGAINST MOSQUITOS AND ZIKA? Before The Wynwood Yard made the difficult choice to close on Tuesday August 2nd, team members were following CDC recommendations for drainage, wearing insect repellent and mosquito control on site. Since we closed, we’ve also added the following mitigation techniques: · We’ve stocked up on even more bug spray to have available for anyone on site who wishes to use them. As of Thursday, August 11th, we also have free mosquito repellent towelettes available. · Mosquito Nix is installing a state-of-the-art mitigation system, using natural botanical insecticides, in order to supplement the mosquito control measures that were in place before we made the choice to close. · We are continuing the training with our team to ensure that everyone is knowledgeable about CDC guidelines, as well as our new mosquito mitigation measures. 8. IS THE NEW MOSQUITONIX MISTING SYSTEM SAFE? Yes. The new state-of-the-art mosquito MosquitoNix misting symptom is being installed at The Wynwood Yard today, Thurday August 11th. It has nozzles set up in unobtrusive places that release three or four mists a day of pyrethrum and other natural botanical insecticides, each a few seconds long. We are deeply grateful to MosquitoNix and David Lombardi of Lombardi Properties for generously assisting with sponsorship of the purchase and installation of this system. More information here:http://www.mosquitonix.com/mosquitonix 9. WHAT NOW? We’ll continue to update this page with more information as receive it. We’d like to thank our guests and the community for their support and patience. The Wynwood Yard is welcoming back the public with a full calendar of events including two key welcome back celebrations: della test kitchen Customer Appreciation Day | Saturday, August 13 |4 P.M. - 6 P.M. | Free As a token of appreciation for the amazing community support it has received, della test kitchen invites you and your family to a fun and tasty afternoon in the sun. della test kitchen will celebrate its loyal customers with complimentary samples of the newest additions to the menu including the Dalé bowl, a bright and beautiful chilled mamey custard and spiced cacao frappé. In addition, all bowls will be 20% off that day. Fun activities for all include a garden tour and garden salad demo with Chef Julie Frans, drum circle and African movement session, hula hooping and Kids Princess sing-along with Christina. Register for the free event here. The Raddest Craft Fair by The Prism Group| Saturday, August 27th | 6 P.M. – 9 P.M. | Free Come back for round two of the Raddest Craft Fair at The Wynwood Yard. Get ready to roll up your sleeves and dig into every type of craft under the sun from watercolor, to calligraphy, macramé and more. Full lineup of workshops to be announced soon! You’ll find inspiration in charming live sets by local songwriters, local culinary pop-ups along with scrumptious offerings by The Yard’s resident food concepts, not to mention the otherworldly craft cocktails from Mortar & Pistil. In addition, there will be some special treats to welcome Miami back home to The Yard! To see an ongoing list of workshops and to register, click here. http://www.thewynwoodyard.com/faq-1/

Zika virus infects two Wynwood restaurant employees 3:08 p.m. Thursday, Aug. 11, 2016 | Filed in: News COMMENTS 0  Autoplay: On | Off MIAMI — Two employees of a business in Miami’s Wynwood neighborhood have tested positive for the Zika virus, a spokeswoman said Thursday. The people infected by the mosquito-born disease are employed by The Wynwood Yard, a food and entertainment venue with all-outdoor seating. The establishment closed Aug. 2 after health officials announced that Zika had been spread in the area by a mosquito. The aedes aegypti mosquito carries both transmitting dengue and Zika. (AP Photo/Felipe Dana, File) Prior to that announcement, virtually all Zika cases in the United States had been acquired by people traveling to other countries — especially in the Caribbean and South America — where the virus is widespread. ADVERTISING Sixty-five Wynwood Yard employees voluntarily submitted to testing from the Department of Health. The spokesperson said that management was relying on employees reporting their test results and that it’s unknown whether other workers might have been infected. Gov. Rick Scott said Thursday that 25 people in South Florida — including one Palm Beach County resident — have acquired Zika locally. Most of those cases have been traced back to a 10-block area in Wynwood, a popular arts district known for trendy bars, galleries and restaurants north of downtown Miami Alan Diaz A view of the outdoor business The Wynwood Yard that had been closed since last Aug. 2 because of to the cases of Zika in the Wynwood area of Miami. On Wednesday, it reopened. (AP Photo/Alan Diaz) Wynwood Yard re-opened for business Wednesday after being closed for more than a week. The federal Centers for Disease Control and Prevention has warned pregnant women not to travel to the Wynwood area. Zika has been shown to result in microcephaly, a birth defect that results in abnormally small heads and brains in newborns. A view of the outdoor business The Wynwood Yard that has been closed since last Aug. 2, due to the cases of Zika in the area, Friday, Aug. 5, 2016, in the Wynwood area of Miami. Thank goodness it’s the slow season in Florida. At least that’s what officials and representatives of the state’s $82 billion tourism industry are thinking in the wake of news that 15 people were infected with Zika in one small, trendy neighborhood in Miami. (AP Photo/Alan Diaz) http://www.palmbeachpost.com/news/news/local/zika-virus-infects-two-wynwood-restaurant-employee/nsDpr/

Number of cases reported County/Area Today Year to Date (8/9-11/16) Albany 0 3 Broome 0 1 Clinton 0 1 Columbia 0 1 Dutchess 0 5 Erie 0 4 Lewis 0 1 Monroe 0 7 Nassau 2 36 Niagara 0 1 Oneida 0 3 Onondaga 0 5 Ontario 0 3 Orange 0 4 Otsego 0 1 Putnam 0 1 Rockland 0 7 St Lawrence 0 1 Schenectady 0 1 Suffolk 1 33 Tompkins 0 2 Wayne 2 2 Westchester 3 17 NYS (ex NYC) 8 140 NYC 26 475 NYS Total Confirmed 34 615 NYS Pregnant Registry 0 25 NYS Total 34 640

As of August 10, 2016 (5 am EST) Zika virus disease and Zika virus congenital infection are nationally notifiable conditions. This update from the CDC Arboviral Disease Branch includes provisional data reported to ArboNET for January 01, 2015 – August 10, 2016. US States Locally acquired mosquito-borne cases reported: 6 Travel-associated cases reported: 1,955 Laboratory acquired cases reported: 1 Total: 1,962 Sexually transmitted: 22 Guillain-Barré syndrome: 6 MAPS OF ZIKA IN THE US More US Territories Locally acquired cases reported: 6,587 Travel-associated cases reported: 31 Total: 6,618* Guillain-Barré syndrome: 20 *Sexually transmitted cases are not reported for areas with local mosquito-borne transmission of Zika virus because it is not possible to determine whether infection occurred due to mosquito-borne or sexual transmission. Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of August 10, 2016)§ States Travel-associated cases* No. (% of cases in states) (N=1,956) Locally acquired cases† No. (% of cases in states) (N=6) Alabama 11 (1) 0 (0) Arizona 10 (1) 0 (0) Arkansas 5 (<1) 0 (0) California 87 (4) 0 (0) Colorado 20 (1) 0 (0) Connecticut 49 (3) 0 (0) Delaware 10 (1) 0 (0) District of Columbia 11 (1) 0 (0) Florida 322 (16) 6 (100) Georgia 46 (2) 0 (0) Hawaii 10 (1) 0 (0) Idaho 1 (<1) 0 (0) Illinois 44 (2) 0 (0) Indiana 22 (1) 0 (0) Iowa 9 (<1) 0 (0) Kansas 8 (<1) 0 (0) Kentucky 10 (1) 0 (0) Louisiana 22 (1) 0 (0) Maine 9 (<1) 0 (0) Maryland 57 (3) 0 (0) Massachusetts 58 (3) 0 (0) Michigan 20 (1) 0 (0) Minnesota 29 (2) 0 (0) Mississippi 14 (1) 0 (0) Missouri 14 (1) 0 (0) Montana 4 (<1) 0 (0) Nebraska 6 (<1) 0 (0) Nevada 12 (1) 0 (0) New Hampshire 8 (<1) 0 (0) New Jersey 54 (3) 0 (0) New Mexico 3 (<1) 0 (0) New York 530 (27) 0 (0) North Carolina 33 (2) 0 (0) North Dakota 1 (<1) 0 (0) Ohio 26 (1) 0 (0) Oklahoma 17 (1) 0 (0) Oregon 14 (1) 0 (0) Pennsylvania†† 63 (3) 0 (0) Rhode Island 18 (1) 0 (0) South Carolina 31 (2) 0 (0) Tennessee 27 (1) 0 (0) Texas 99 (5) 0 (0) Utah 6 (<1) 0 (0) Vermont 6 (<1) 0 (0) Virginia 58 (3) 0 (0) Washington 16 (1) 0 (0) West Virginia 9 (<1) 0 (0) Wisconsin 17 (1) 0 (0) Territories Travel-associated cases* No. (% of cases in territories) (N=31) Locally acquired cases† No. (% of cases in territories) (N=6,587) American Samoa 0 (0) 44 (1) Puerto Rico 30 (97) 6,475 (98) US Virgin Islands 1 (3) 68 (1) §Only includes cases meeting the probable or confirmed CSTE case definition and does not include asymptomatic infections unless the case is a pregnant women with a complication of pregnancy *Travelers returning from affected areas, their sexual contacts, or infants infected in utero †Presumed local mosquito-borne transmission †† One additional case acquired through laboratory transmission

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Aug. 11, 2016 DEPARTMENT OF HEALTH DAILY ZIKA UPDATE http://www.floridahealth.gov/newsroom/2016/08/081116-zika-update.html Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will continue to issue a Zika virus update each week day. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. The department has conducted testing for the Zika virus for more than 2,725 people statewide. Florida currently has the capacity to test 5,805 people for active Zika virus and 1,527 for Zika antibodies. Per the Governor’s direction on August 3, all county health departments are now offering free Zika risk assessment and testing to any pregnant woman who would like to be tested. There are 21 new travel-related cases today with 17 in Broward, two in Hernando, one in Miami-Dade and one in Seminole counties. Please visit our website to see the full list of travel-related cases. There are three new non-travel related cases today in Miami-Dade County. The individuals were exposed in the same area in Miami-Dade County. The department still believes active transmissions are only taking place within the identified area that is less than one-square mile in Miami-Dade County. The department has completed testing in a four block area of the southwest quadrant of the one-square mile area and no people within the four block radius tested positive. The department has cleared that area and is continuing to test people within the one-square mile radius. For a complete breakdown of non-travel and travel-related Zika infections to-date, please see below. Infection Type Infection Count Travel-Related Infections of Zika 404 Non-Travel Related Infections of Zika 25 Infections Involving Pregnant Women 57 ACTIVE INVESTIGATIONS The department is currently conducting three active investigations. Under each section below, the department outlines the original cases that spurred these investigations, the number of samples collected and results in connection with each investigation to-date. 1) Identified one-square mile in Miami-Dade – Two (2) original cases Total # of Samples Collected Negative Samples Positive Samples Pending Results 511 480 19 12 Door to door outreach and sampling continue. Mosquito abatement and reduction activities are on-going. 2) Miami-Dade investigation outside the one-square mile: One (1) case Total # of Samples Collected Negative Samples Positive Samples Pending Results 19 18 0 1 Sample collection and door-to-door outreach continues. Mosquito abatement and reduction activities are on-going. 3) One (1) case in Palm Beach County: Total # of Samples Collected Negative Samples Positive Samples Pending Results 3 2 0 1 Door to door outreach and sample collection in areas of interest around the case are underway. Mosquito abatement and reduction activities will take place around the area of interest. CLOSED INVESTIGATIONS The department has closed out the investigations into the first cases in Miami-Dade and Broward County (two cases). The department tested 124 close contacts and individuals from the community and found no additional positives. The department still believes active transmissions are only taking place within the identified one-square mile area in Miami-Dade County. There are no active investigations in Broward County and no areas of active transmission in Broward County. One case does not mean active transmission is taking place and that’s why the department conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. The department has not yet determined where the individual in Palm Beach County or the individual outside the one-square mile in Miami-Dade County likely contracted Zika and will share more details as the investigations progress. If the department finds evidence that active transmission is occurring in an area, we will notify the media and the public. The department still believes active transmissions of the Zika virus are occurring in one small area in Miami-Dade County, just north of downtown. The exact location is within the boundaries of the following area: NW 5th Avenue to the west, US 1 to the east, NW/NE 38th Street to the north and NW/NE 20thStreet to the south. This area is about one square mile and a map is below to detail the area. This remains the only area of the state where the department has confirmed there are local transmissions of Zika. If investigations reveal additional areas of likely active transmission, the department will announce a defined area of concern. CDC recommends that women who are pregnant or thinking of becoming pregnant postpone travel to areas with widespread Zika infection. Florida’s small case cluster is not considered widespread transmission, however, pregnant women are advised to avoid non-essential travel to the impacted area in Miami-Dade County (see map below). If you are pregnant and must travel or if you live or work in the impacted area, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. It is also recommended that all pregnant women who reside in or travel frequently to the area where active transmission is likely occurring be tested for Zika in the first and second trimester. Pregnant women in the identified area can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in the one square mile area to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms since January. The total number of pregnant women who have been or are being monitored is 57. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 3,863 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.

Infection Type Infection Count Travel-Related Infections of Zika 404 Non-Travel Related Infections of Zika 25 Infections Involving Pregnant Women 57

Map update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

According to Wynwood Yard’s CEO and founder Della Heiman, the spread of Zika was a major concern for them due to the unique nature of their setup. It is a completely outdoor venue, meaning all employees and guests are exposed to all natural elements, including mosquitoes. Upon closing down, business owners contacted the Department of Health (DOH) in order to offer voluntary Zika testing for all members of their team. “We love this community so much, and it was a really heart-wrenching decision to close,” said Heiman. The testing revealed that, in fact, one of their team members tested positive for the Zika virus. “We had several employees that were ill. We had one case that was confirmed,” Heiman said. http://wsvn.com/news/local/the-wynwood-yard-reopens-despite-zika-concerns-in-the-area/

Gov. Scott: DOH Clears Additional Portion of Impacted Area in Wynwood On August 11, 2016, in News Releases, by Staff http://www.flgov.com/2016/08/11/gov-scott-doh-clears-additional-portion-of-impacted-area-in-wynwood/ Area with local transmissions of Zika is less than one square mile ORLANDO, Fla. – Today, Governor Rick Scott announced that the Florida Department of Health (DOH) has cleared an additional four blocks in the Southwest corner of the impacted zone in Wynwood. DOH has concluded that no local transmissions of Zika are occurring in the newly cleared area (see map below- shaded area denotes cleared areas). The Centers for Disease Control and Prevention (CDC), pursuant to their guidance, will continue to monitor the entire one square mile area in Miami, north of downtown. Governor Scott also announced that DOH has identified three additional people in the impacted area with the Zika virus who likely contracted it through a mosquito bite. This brings the total number of people with locally transmitted Zika to 25. DOH still believes active transmissions are only taking place within the identified area that is less than one-square mile in Miami-Dade County. Governor Scott said, “We believe active transmissions of Zika are still only occurring in an area in Miami that is less than one square mile. Last week, we were able to clear a 10 block portion of the area and today, it’s great to announce that we are able to clear an additional four blocks. This means the area where we believe active transmissions are occurring in the state is significantly reducing. “Although three additional individuals in Wynwood have been identified with the Zika virus today, we are confident that our mosquito education, prevention and control efforts are working and hopeful that the impacted area will continue to be reduced as the DOH investigation continues. Earlier this summer, I authorized more than $26 million in state funds to fight Zika and as of today, more than $18 million has been allocated to local and state entities for mosquito prevention and control. We will continue to work closely with local officials to ensure their needs are met and we are prepared to allocate more if needed. “I still have outstanding requests that I put into the Obama Administration that I am waiting on and I am disappointed that Congress has not come back to work to deal with this national issue. The president and Congress must work together to get to a solution for all the families across our nation.” ###

“Although three additional individuals in Wynwood have been identified with the Zika virus today, http://www.flgov.com/2016/08/11/gov-scott-doh-clears-additional-portion-of-impacted-area-in-wynwood/

Reported Cases of Zika in New York City as of 8/5/2016 [Español (PDF)] Positive NYC Residents Case Type Number of Cases Locally acquired mosquito-borne reported† 0 Travel-associated* 422 Sexually transmitted: 4 Guillain-Barre syndrome: 3 Infants with birth defects: 1 Laboratory acquired 0 Pending Verification of Travel 22 Total 444 Gender Number of Cases Female 315 Pregnant: 48 Male 129 Age Average Age (Range) 39 (1-74) Positive NYC Resident by Borough Number of Cases Bronx 168 Manhattan 95 Brooklyn 93 Queens 84 Staten Island 3 Unknown 1 Most Common Countries Visited Number of Cases Dominican Republic 256 Puerto Rico 35 Jamaica 34 Guyana 16 Colombia 10 Saint Lucia 10 Trinidad and Tobago 8 Saint Vincent and the Grenadines 8 Grenada 6 †Presumed local mosquito-borne transmission *Travelers returning from affected areas, their sexual contacts, or infants infected in utero

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Video at above link showing residents and street marker of NW 30th & 1st Avenue

Jul 29, 2016 Workers with the Florida Dept. of Health and Miami-Dade County Mosquito Control distribute mosquito repellent and collect urine samples from residents in the vicinity of NW 30th street and First Avenue. Read more here: http://www.miamiherald.com/news/health-care/article92649717.html#storylink=cpy

A AUGUST 11, 2016 6:54 AM Zika count, and frustration, rise in Miami-Dade Fighting Zika on the streets 1:15 FACEBOOK TWITTER EMAIL SHARE FACEBOOK TWITTER EMAIL SHARE 1 of 2 As Miami-Dade mosquito inspectors continue to spray the Zika infested areas of Wynwood, Miami Police also lent a hand on Tuesday, passing out mosquito spray to homeless people in the area. Emily Michot [email protected] BY JENNY STALETOVICH [email protected] LINKEDIN GOOGLE+ PINTEREST REDDIT PRINT ORDER REPRINT OF THIS STORY The Zika toll, and frustration, rose another notch in Miami-Dade County with the latest local case confirmed by state health officials on Wednesday. Interactive feature: Daily Florida Zika virus tracker The new case brings the total number of local cases in South Florida to 22. State health officials also reported 14 new travel-related cases, for a total of 439 across the state including the first cases in Bay County. Health officials do not provide details about patients but said the latest Miami-Dade case is in the same area as previous infections. They remain convinced that active Zika transmissions are occurring only in a one-square-mile area of Miami near the Wynwood arts district and Midtown Miami. As the number of local cases has surged, so have complaints from a public increasingly tense over global media coverage and the trickle of information from federal, state and local officials. In a standing-room-only meeting in Wynwood with state health officials, business owners and residents complained that too few details had ignited panic even as officials continue to refer people to the state’s hot line: 1-855-622-6735. Meanwhile, one Zika-infected patient, a Miami Beach resident who agreed to speak to the Miami Herald only if his name was withheld, said that with so little information available about where to get tested, he turned to Google to find the name of a local doctor who could provide it. “I’ll be happy when the [the Centers for Disease Control and Prevention], the state, and the locals can get on the same sheet of music about what they put out,” the patient said. FACEBOOK TWITTER EMAIL SHARE How to stay safe from Zika virus What you should and shouldn't do to avoid the Zika virus. Justin Azpiazu [email protected] The circumstances of the 35-year-old patient offer a glimpse into how health officials are handling the cases, which are not public by law. It’s unclear whether his case has been counted in official numbers reported Wednesday. He lives in Miami Beach, works at home and has not traveled to Wynwood in at least six months. He suspects he got the virus from his wife, who travels throughout the county for work but has not shown any symptoms. She has not yet been tested. The couple last traveled abroad in March or April, to a region with no cases. The patient said he started feeling achy and had sore eyes on Aug. 1 while out of town in an area with fewer than seven travel-related Zika cases and no local transmissions, making it unlikely he picked up the virus there. He returned home thinking he had the flu, then woke up Aug. 4 with a rash and decided to be tested, fearing that he might spread the virus to neighbors and friends. I THOUGHT THE MOST RESPONSIBLE THING WAS TO GET TESTED TO LIMIT THE ABILITY TO SPREAD IT. Miami-Dade County Zika patient “I thought the most responsible thing was to get tested to limit the ability to spread it,” he said. But he wasn’t sure where. He looked online for a doctor doing Zika testing, found an urgent-care center and made an appointment. The office sent him to a Coral Gables lab for testing. This week, on Tuesday, the office called to confirm the results and on Wednesday, just before 5 p.m., a state health worker called to question him, he said. Throughout, he said he never had any sense that any health officials were alarmed. When he raised concerns about being bitten by mosquitoes that might infect others, he said the health workers seemed unconcerned. “Honestly, throughout this whole process I’ve never felt a sense of urgency or panic from anyone involved,” he said in a text. “Maybe that’s by training/design, or maybe it’s just Miami.” That perception has also annoyed business owners in the Wynwood neighborhood who say government officials are not providing enough accurate, up-to-date information. On Wednesday, the state health department sent Isabel Griffin, a 25-year-old epidemiologist who is investigating the Wynwood outbreak, to the meeting. County mosquito-control manager Chalmers Vasquez and senior division director Lee Casey also attended but refused to answer questions afterward. Since the outbreak, the county has increased efforts to tamp down the Aedes aegyptimosquito that carries the virus, bringing on about 128 additional inspectors to help out a full-time staff of 12. On Wednesday, a low-flying plane misted the area with a nontoxic larvicide intended to kill mosquito eggs, Casey said. But a flight that was scheduled to fly at 6:30 a.m. was still flying overhead at 10 a.m., angering business owners already on edge about scaring away customers. “For you to fly over Wynwood at 10 a.m. is irresponsible,” Wynwood Business Improvement District board chair Joe Furst told Casey. During the packed meeting, business owners and residents complained that health officials and mosquito inspectors had not contacted them and had too little presence in the neighborhood. OUR POLITICIANS SHOULD BE HERE EVERY DAY TO SHOW US THE SITUATION IS UNDER CONTROL. Wynwood Business Improvement District board member David Polinsky “Our politicians should be here every day to show us the situation is under control,” said board member David Polinsky. They also complained that while health officials believe active transmission is limited to a small area with a 500-foot radius from the initial cluster, the warning zone is five times larger, encompassing a one-square-mile area. “Why can’t you tell us the exact location of where this happened?” asked Robert De Los Rios, co-founder of WynwoodMap.com. “It’s affecting all of us.” Since the beginning of August, federal health officials have warned pregnant women to steer clear of the area, the first such warning issued in the nation. The virus, which raced across Latin America and the Caribbean, is linked to birth defects in babies, including microcephaly, that has caused alarm among expectant mothers and women trying to become pregnant. The virus, Griffin said, is “entirely preventable” with simple steps like using repellent and emptying containers where mosquitoes breed. Once they’ve had the illness, patients will have antibodies that will prevent them from getting sick again, she said. “Eventually, the number of infected people in this area will decline. Think about it like a vaccine. Diseases spread as long as there are susceptible people,” she said. “Eventually, the virus will run out of hosts.” Vasquez, of the county’s mosquito-control unit, also said that while initial spraying had reduced mosquitoes, the number had started to rise again with recent heavy rain. The county plans to conduct eight aerial treatments altogether, four with an insecticide called Naled and four with BTI, an organic larvicide to attack eggs. The area has been divided into sectors, with nine teams doing door-to-door inspections in search of breeding mosquitoes, he said. Even with those efforts, Casey said business owners and residents need to do their part. YOU REPRESENT A LOT OF OUR BOOTS ON THE GROUND. Miami-Dade County senior division director Lee Casey “You represent a lot of our boots on the ground,” he said. “It’s incredible to expect we would have enough people to inspect every house.” In addition to the local case, health officials also reported seven additional travel-related cases in Miami-Dade on Wednesday. Other travel cases around the state include two in Bay County, two in Palm Beach County, and one each in Lake, Seminole and St. Lucie counties. ZIKA CASES IN FLORIDA BY COUNTY SINCE AUG. 10 County Number of Cases (all travel related) Alachua 5 Bay 2 Brevard 10 Broward** 56 Charlotte 1 Citrus 2 Clay 3 Collier 4 Duval 6 Escambia 2 Hernando 2 Highlands 1 Hillsborough 12 Lake 2 Lee 7 Leon 1 Manatee 2 Martin 1 Miami-Dade** 117 Monroe 1 Okaloosa 2 Okeechobee 1 Orange 48 Osceola 18 Palm Beach** 22 Pasco 6 Pinellas 7 Polk 13 Santa Rosa 1 Seminole 16 St. Johns 3 St. Lucie 4 Volusia 5 Total cases not involving pregnant women 383 . . . . . . Cases involving pregnant women regardless of symptoms 57 * Counties of pregnant women not disclosed. ** Does not included suspected cases of local transmission. Source: Florida Department of Health Read more here: http://www.bradenton.com/news/state/florida/article94991502.html#storylink=cpy

The circumstances of the 35-year-old patient offer a glimpse into how health officials are handling the cases, which are not public by law. It’s unclear whether his case has been counted in official numbers reported Wednesday. He lives in Miami Beach, works at home and has not traveled to Wynwood in at least six months. He suspects he got the virus from his wife, who travels throughout the county for work but has not shown any symptoms. She has not yet been tested. The couple last traveled abroad in March or April, to a region with no cases. The patient said he started feeling achy and had sore eyes on Aug. 1 while out of town in an area with fewer than seven travel-related Zika cases and no local transmissions, making it unlikely he picked up the virus there. He returned home thinking he had the flu, then woke up Aug. 4 with a rash and decided to be tested, fearing that he might spread the virus to neighbors and friends. “I thought the most responsible thing was to get tested to limit the ability to spread it,” he said. But he wasn’t sure where. He looked online for a doctor doing Zika testing, found an urgent-care center and made an appointment. The office sent him to a Coral Gables lab for testing. This week, on Tuesday, the office called to confirm the results and on Wednesday, just before 5 p.m., a state health worker called to question him, he said. Throughout, he said he never had any sense that any health officials were alarmed. When he raised concerns about being bitten by mosquitoes that might infect others, he said the health workers seemed unconcerned. Read more here: http://www.bradenton.com/news/state/florida/article94991502.html#storylink=cpy http://www.bradenton.com/news/state/florida/article94991502.html