Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU820897.3|Zika virus isolate FLR polyprotein gene, complete cds11781178100%0.0100%KU820897.3Select seq gb|KU758877.1|Zika virus isolate 17271 polyprotein gene, complete cds11781178100%0.0100%KU758877.1Select seq gb|KX262887.1|Zika virus isolate 103451, complete genome11781178100%0.0100%KX262887.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome11781178100%0.0100%KX247646.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds11781178100%0.0100%KX247632.1Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome11781178100%0.0100%KX087101.2Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds11781178100%0.0100%KU937936.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome11781178100%0.0100%KX156776.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome11781178100%0.0100%KX156775.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome11781178100%0.0100%KX156774.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome11781178100%0.0100%KX087102.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome11781178100%0.0100%KU870645.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome11781178100%0.0100%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome11781178100%0.0100%KU922923.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome11781178100%0.0100%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome11781178100%0.0100%KU853012.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome11781178100%0.0100%KU497555.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds11781178100%0.0100%KU647676.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome11781178100%0.0100%KU501215.1Select seq gb|KX280026.1|Zika virus isolate Paraiba_01, complete genome11731173100%0.099%KX280026.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome11731173100%0.099%KX198135.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome11731173100%0.099%KX197192.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds11731173100%0.099%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds11731173100%0.099%KX059013.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome11731173100%0.099%KX051563.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds11731173100%0.099%KX056898.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome11731173100%0.099%KU509998.3Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds11731173100%0.099%KU991811.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds11731173100%0.099%KU955590.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome11731173100%0.099%KU926310.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome11731173100%0.099%KU926309.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds11731173100%0.099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds11731173100%0.099%KU740184.2Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds11731173100%0.099%KU729217.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds11731173100%0.099%KU761564.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome11731173100%0.099%KU707826.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome11731173100%0.099%KU527068.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds11731173100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds11731173100%0.099%KU501216.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds11731173100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds11731173100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds11731173100%0.099%KU365777.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds11731173100%0.099%KU312312.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome11731173100%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds11731173100%0.099%KM078936.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds11731173100%0.099%KJ873161.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds11731173100%0.099%KJ873160.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds11731173100%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds11711171100%0.099%KM078961.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome11691169100%0.099%KU940228.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome11691169100%0.099%KU940224.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds11691169100%0.099%KU365778.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds11691169100%0.099%KM078971.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds11691169100%0.099%KM078930.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds11661166100%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds11661166100%0.099%KM078933.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds11641164100%0.099%KU729218.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds11641164100%0.099%KM078929.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome11551155100%0.099%KX117076.1Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome11511151100%0.099%KX253996.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds11511151100%0.099%KX185891.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds11511151100%0.099%KU963796.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds11511151100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome11511151100%0.099%KU820899.2Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome11511151100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome11461146100%0.099%KU681081.3Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds11461146100%0.099%KU179098.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds11461146100%0.099%KM851039.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds11461146100%0.099%KF993678.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds11331133100%0.098%KU866423.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome11241124100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds11241124100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds11241124100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome11101110100%0.098%KU681082.3Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds11101110100%0.098%KM851038.1Select seq gb|KU985087.1|Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds1018101886%0.0100%KU985087.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds10111011100%0.094%HQ234499.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds1002100284%0.0100%KU556802.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds89989976%0.099%KU232300.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds89789776%0.099%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds88888876%0.099%KU232297.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds88388375%0.099%KU232298.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds88388375%0.099%KU232296.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds88388374%0.0100%KU232295.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds88388374%0.0100%KU232294.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds87987975%0.099%KU232293.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds87987974%0.0100%KU232288.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds87787774%0.099%KU232292.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds87587574%0.099%KU232291.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds87587574%0.0100%KU232289.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds87487474%0.0100%KU232299.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds854854100%0.089%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome854854100%0.089%KU955594.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds854854100%0.089%KU720415.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID854854100%0.089%LC002520.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds854854100%0.089%KF383118.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds85485498%0.089%KF268949.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds854854100%0.089%HQ234498.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome854854100%0.089%AY632535.2Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds854854100%0.089%AF013415.1
  2. LOCUS KU724097 653 bp RNA linear VRL 11-JUN-2016 DEFINITION Zika virus isolate 259250_2015_Panama NS5B gene, partial cds. ACCESSION KU724097 VERSION KU724097.1 GI:998178888 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 653) AUTHORS Arauz,D., De Urriola,L., Jones,J., Castillo,M., Martinez,A., Murillo,E., Troncoso,L., Chen,M., Abrego,L., Armien,B., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Febrile or Exanthematous Illness Associated with Zika, Dengue, and Chikungunya Viruses, Panama JOURNAL Emerging Infect. Dis. 22 (8) (2016) In press PUBMED 27139219 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 653) AUTHORS Arauz,D. Sr., De Urriola,L., Castillo,M., Martinez,A.A., Murillo,E., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Direct Submission JOURNAL Submitted (17-FEB-2016) Departament of Research in Virology and Biotechnology, Gorgas Institute For Health Studies Memorial Institute, Ave. Justo Arosemena 35th Street, Panama, Panama 0816-02593, Panama COMMENT ##Assembly-Data-START## Assembly Method :: Sequencher v. 4.5 Coverage :: partial Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..653 /organism="Zika virus" /mol_type="genomic RNA" /isolate="259250_2015_Panama" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Panama" /collection_date="11-Dec-2015" CDS <1..>653 /codon_start=2 /product="NS5B" /protein_id="AMK26953.1" /db_xref="GI:998178889" /translation="ALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDII SRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNG WDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFC SHHFNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLY" ORIGIN 1 agctctaatc accaaccaaa tggagaaagg gcacagggcc ttggcattgg ccataatcaa 61 gtacacatac caaaacaaag tggtaaaggt ccttagacca gctgaaaaag ggaaaacagt 121 tatggacatt atttcgagac aagaccaaag ggggagcgga caagttgtca cttacgctct 181 taacacattt accaacctag tggtgcaact cattcggaat atggaggctg aggaagttct 241 agagatgcaa gacttgtggc tgctgcggag gtcagagaaa gtgaccaact ggttgcagag 301 caacggatgg gataggctca aacgaatggc agtcagtgga gatgattgcg ttgtgaagcc 361 aattgatgat aggtttgcac atgccctcag gttcttgaat gatatgggaa aagttaggaa 421 ggacacacaa gagtggaaac cctcaactgg atgggacaac tgggaagaag ttccgttttg 481 ctcccaccac ttcaacaagc tccatctcaa ggacgggagg tccattgtgg ttccctgccg 541 ccaccaagat gaactgattg gccgggcccg cgtctctcca ggggcgggat ggagcatccg 601 ggagactgct tgcctagcaa aatcatatgc gcaaatgtgg cagctccttt att
  3. Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU820897.3|Zika virus isolate FLR polyprotein gene, complete cds13101310100%0.0100%KU820897.3Select seq gb|KU758877.1|Zika virus isolate 17271 polyprotein gene, complete cds13101310100%0.0100%KU758877.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome13101310100%0.0100%KX247646.1Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome13101310100%0.0100%KX087101.2Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds13101310100%0.0100%KU937936.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome13101310100%0.0100%KX156776.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome13101310100%0.0100%KX156775.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome13101310100%0.0100%KX156774.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome13101310100%0.0100%KX087102.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome13101310100%0.0100%KU501215.1Select seq gb|KX262887.1|Zika virus isolate 103451, complete genome13051305100%0.099%KX262887.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds13051305100%0.099%KX247632.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome13051305100%0.099%KX198135.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds13051305100%0.099%KX056898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds13051305100%0.099%KU955590.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome13051305100%0.099%KU870645.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome13051305100%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome13051305100%0.099%KU922923.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds13051305100%0.099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds13051305100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds13051305100%0.099%KU761564.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome13051305100%0.099%KU497555.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds13051305100%0.099%KU647676.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds13051305100%0.099%KU312312.1Select seq gb|KX280026.1|Zika virus isolate Paraiba_01, complete genome13011301100%0.099%KX280026.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome13011301100%0.099%KX197192.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds13011301100%0.099%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds13011301100%0.099%KX059013.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome13011301100%0.099%KX051563.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome13011301100%0.099%KU509998.3Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds13011301100%0.099%KU991811.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome13011301100%0.099%KU926310.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome13011301100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome13011301100%0.099%KU853012.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds13011301100%0.099%KU729217.2Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome13011301100%0.099%KU707826.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds13011301100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds13011301100%0.099%KU501216.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds13011301100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds13011301100%0.099%KU365779.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds13011301100%0.099%KU365778.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds13011301100%0.099%KU365777.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome13011301100%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds13011301100%0.099%KM078936.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds13011301100%0.099%KJ873160.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds13011301100%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds12971297100%0.099%KM078961.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome12961296100%0.099%KU926309.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome12961296100%0.099%KU527068.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds12961296100%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds12941294100%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds12941294100%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds12941294100%0.099%KM078933.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome12921292100%0.099%KU940228.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome12921292100%0.099%KU940224.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds12921292100%0.099%KU729218.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds12921292100%0.099%KM078929.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome12831283100%0.099%KX117076.1Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome12781278100%0.099%KX253996.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds12781278100%0.099%KX185891.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds12781278100%0.099%KU963796.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds12781278100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome12781278100%0.099%KU820899.2Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome12781278100%0.099%KU744693.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds12741274100%0.099%KU179098.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds12741274100%0.099%KF993678.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome12691269100%0.099%KU681081.3Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds12691269100%0.099%KM851039.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds12601260100%0.098%KU866423.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome12511251100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds12511251100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds12511251100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome12381238100%0.098%KU681082.3Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds12381238100%0.098%KM851038.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1227122794%0.099%KJ873161.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds11301130100%0.094%HQ234499.1Select seq gb|KU985087.1|Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds1059105981%0.099%KU985087.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds1043104380%0.099%KU556802.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds95595599%0.089%KF268949.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds95195199%0.089%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome95195199%0.089%KU955594.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds95195199%0.089%KU720415.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID95195199%0.089%LC002520.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds95195199%0.089%KF383118.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds95195199%0.089%HQ234498.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome95195199%0.089%AY632535.2Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds95195199%0.089%AF013415.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds94694699%0.089%KU963574.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds94694699%0.089%KF383121.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds94694699%0.089%KF383119.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds94694699%0.089%HQ234500.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds94294272%0.099%KU232300.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds94094072%0.099%KU232290.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome93793799%0.089%KX198134.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome93393399%0.089%KU955595.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome93393399%0.089%KU955592.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome93393399%0.089%KU955591.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds93393399%0.089%DQ859059.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds93193172%0.099%KU232297.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds92692671%0.099%KU232298.1
  4. LOCUS KU724096 726 bp RNA linear VRL 11-JUN-2016 DEFINITION Zika virus isolate 259249_2015_Panama NS5B gene, partial cds. ACCESSION KU724096 VERSION KU724096.1 GI:998178886 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 726) AUTHORS Arauz,D., De Urriola,L., Jones,J., Castillo,M., Martinez,A., Murillo,E., Troncoso,L., Chen,M., Abrego,L., Armien,B., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Febrile or Exanthematous Illness Associated with Zika, Dengue, and Chikungunya Viruses, Panama JOURNAL Emerging Infect. Dis. 22 (8) (2016) In press PUBMED 27139219 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 726) AUTHORS Arauz,D. Sr., De Urriola,L., Castillo,M., Martinez,A.A., Murillo,E., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Direct Submission JOURNAL Submitted (17-FEB-2016) Departament of Research in Virology and Biotechnology, Gorgas Institute For Health Studies Memorial Institute, Ave. Justo Arosemena 35th Street, Panama, Panama 0816-02593, Panama COMMENT ##Assembly-Data-START## Assembly Method :: Sequencher v. 4.5 Coverage :: partial Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..726 /organism="Zika virus" /mol_type="genomic RNA" /isolate="259249_2015_Panama" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Panama" /collection_date="11-Dec-2015" CDS <1..>726 /codon_start=1 /product="NS5B" /protein_id="AMK26952.1" /db_xref="GI:998178887" /translation="ISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAE KGKTVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEK VTNWLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGW DNWEEVPFCSHHFNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSY AQMWQLLYFHRRDLRLMANAICSS" ORIGIN 1 attagcaggt ttgatctgga gaatgaagct ctaatcacca accaaatgga gaaagggcac 61 agggccttgg cattggccat aatcaagtac acataccaaa acaaagtggt aaaggtcctt 121 agaccagctg aaaaagggaa aacagttatg gacattattt cgagacaaga ccaaaggggg 181 agcggacaag ttgtcactta cgctcttaac acatttacca acctagtggt gcaactcatt 241 cggaatatgg aggctgagga agttctagag atgcaagact tgtggctgct gcggaggtca 301 gagaaagtga ccaactggtt gcagagcaac ggatgggata ggctcaaacg aatggcagtc 361 agtggagatg attgcgttgt gaagccaatt gatgataggt ttgcacatgc cctcaggttc 421 ttgaatgata tgggaaaagt taggaaggac acacaagagt ggaaaccctc aactggatgg 481 gacaactggg aagaagttcc gttttgctcc caccacttca acaagctcca tctcaaggac 541 gggaggtcca ttgtggttcc ctgccgccac caagatgaac tgattggccg ggcccgcgtc 601 tctccagggg cgggatggag catccgggag actgcttgcc tagcaaaatc atatgcgcaa 661 atgtggcagc tcctttattt ccacagaagg gacctccgac tgatggccaa tgccatttgt 721 tcatct
  5. Gorgas Institute For Health Studies Memorial Institute in Panama has released 5 partial 2015 Panama sequences.
  6. 1.Zika virus isolate 259249_2015_Panama NS5B gene, partial cds 726 bp linear RNA Accession: KU724096.1 GI: 998178886GenBankFASTAGraphics Select item 9981788882.Zika virus isolate 259250_2015_Panama NS5B gene, partial cds 653 bp linear RNA Accession: KU724097.1 GI: 998178888GenBankFASTAGraphics Select item 9981788903.Zika virus isolate 259060_2015_Panama NS5B gene, partial cds 648 bp linear RNA Accession: KU724098.1 GI: 998178890GenBankFASTAGraphics Select item 9981788924.Zika virus isolate 259032_2015_Panama NS5B gene, partial cds 612 bp linear RNA Accession: KU724099.1 GI: 998178892GenBankFASTAGraphics Select item 9981788945.Zika virus isolate 259043_2015_Panama NS5B gene, partial cds 528 bp linear RNA Accession: KU724100.1 GI: 998178894GenBankFASTAGraphics
  7. http://www.ncbi.nlm.nih.gov/nuccore/KX253994 GenBank: 1029979489 This record has not yet been released. Please contact [email protected] with the publication details if the accession has been published.
  8. GenBank accession numbers KX253994 and KX253995
  9. References Dirlikov E, Ryff KR, Torres-Aponte J, Thomas DL, Perez-Padilla J, Munoz-Jordan J, et al. Update: Ongoing Zika Virus Transmission - Puerto Rico, November 1, 2015-April 14, 2016. MMWR Morb Mortal Wkly Rep.2016;65(17):451-5. DOI: 10.15585/mmwr.mm6517e2 PMID: 27149205Huzly D, Hanselmann I, Schmidt-Chanasit J, Panning M. High specificity of a novel Zika virus ELISA in European patients after exposure to different flaviviruses. Euro Surveill. 2016;21(16):30203. DOI: 10.2807/1560-7917.ES.2016.21.16.30203 PMID: 27126052Ginier M, Neumayr A, Günther S, Schmidt-Chanasit J, Blum J. Zika without symptoms in returning travellers: What are the implications? Travel Med Infect Dis. 2016;14(1):16-20. DOI: 10.1016/j.tmaid.2016.01.012 PMID: 26876061European Centre for Disease Prevention and Control (ECDC). Rapid risk assessment: Zika virus disease epidemic: potential association with microcephaly and Guillain–Barré syndrome, sixth update – 20 May 2016. Stockholm: ECDC. Available from:http://ecdc.europa.eu/en/publications/Publications/zika%20virus%20rapid%20risk%20assessment%2010-05-2016.pdf Driggers RW, Ho CY, Korhonen EM, Kuivanen S, Jääskeläinen AJ, Smura T, et al. Zika Virus Infection with Prolonged Maternal Viremia and Fetal Brain Abnormalities. N Engl J Med. 2016;374(22):2142-51. DOI: 10.1056/NEJMoa1601824 PMID: 27028667Cao-Lormeau VM, Blake A, Mons S, Lastère S, Roche C, Vanhomwegen J, et al. Guillain-Barré Syndrome outbreak associated with Zika virus infection in French Polynesia: a case-control study. Lancet.2016;387(10027):1531-9. DOI: 10.1016/S0140-6736(16)00562-6 PMID: 26948433de M Campos R, Cirne-Santos C, Meira GL, Santos LL, de Meneses MD, Friedrich J, et al. Prolonged detection of Zika virus RNA in urine samples during the ongoing Zika virus epidemic in Brazil. J Clin Virol. 2016;77:69-70.DOI: 10.1016/j.jcv.2016.02.009 PMID: 26921737Tappe D, Rissland J, Gabriel M, Emmerich P, Gunther S, Held G, et al. First case of laboratory-confirmed Zika virus infection imported into Europe, November 2013. Euro Surveill. 2014;19(4):20685. DOI: 10.2807/1560-7917.ES2014.19.4.20685 PMID: 24507467Zammarchi L, Tappe D, Fortuna C, Remoli ME, Günther S, Venturi G, et al. Zika virus infection in a traveller returning to Europe from Brazil, March 2015. Euro Surveill. 2015;20(23):21153. DOI: 10.2807/1560-7917.ES2015.20.23.21153 PMID: 26084316Chouin-Carneiro T, Vega-Rua A, Vazeille M, Yebakima A, Girod R, Goindin D, et al. Differential Susceptibilities of Aedes aegypti and Aedes albopictus from the Americas to Zika Virus. PLoS Negl Trop Dis. 2016;10(3):e0004543. doi: DOI: 10.1371/journal.pntd.0004543 . eCollection 2016 Mar. Guzzetta G, Poletti P, Montarsi F, Baldacchino F, Capelli G, Rizzoli A, et al. Assessing the potential risk of Zika virus epidemics in temperate areas with established Aedes albopictus populations. Euro Surveill.2016;21(15):30199. DOI: 10.2807/1560-7917.ES.2016.21.15.30199 PMID: 27104366Foy BD, Kobylinski KC, Chilson Foy JL, Blitvich BJ, Travassos da Rosa A, Haddow AD, et al. Probable non-vector-borne transmission of Zika virus, Colorado, USA. Emerg Infect Dis. 2011;17(5):880-2. DOI: 10.3201/eid1705.101939 PMID: 21529401Musso D, Roche C, Robin E, Nhan T, Teissier A, Cao-Lormeau VM. Potential sexual transmission of Zika virus. Emerg Infect Dis. 2015;21(2):359-61. DOI: 10.3201/eid2102.141363 PMID: 25625872Atkinson B, Hearn P, Afrough B, Lumley S, Carter D, Aarons EJ, et al. Detection of Zika Virus in Semen. Emerg Infect Dis. 2016;22(5):940. DOI: 10.3201/eid2205.160107 PMID: 27088817Deckard DT, Chung WM, Brooks JT, Smith JC, Woldai S, Hennessey M, et al. Male-to-Male Sexual Transmission of Zika Virus - Texas, January 2016. MMWR Morb Mortal Wkly Rep. 2016;65(14):372-4. DOI: 10.15585/mmwr.mm6514a3 PMID: 27078057Venturi G, Zammarchi L, Fortuna C, Remoli ME, Benedetti E, Fiorentini C, et al. An autochthonous case of Zika due to possible sexual transmission, Florence, Italy, 2014. Euro Surveill. 2016;21(8):30148. DOI: 10.2807/1560-7917.ES.2016.21.8.30148 PMID: 26939607Hills SL, Russell K, Hennessey M, Williams C, Oster AM, Fischer M, et al. Transmission of Zika Virus Through Sexual Contact with Travelers to Areas of Ongoing Transmission - Continental United States, 2016. MMWR Morb Mortal Wkly Rep. 2016;65(8):215-6. DOI: 10.15585/mmwr.mm6508e2 PMID: 26937739D’Ortenzio E, Matheron S, Yazdanpanah Y, de Lamballerie X, Hubert B, Piorkowski G, et al. Evidence of Sexual Transmission of Zika Virus. N Engl J Med. 2016;374(22):2195-8. DOI: 10.1056/NEJMc1604449 PMID: 27074370Mansuy JM, Dutertre M, Mengelle C, Fourcade C, Marchou B, Delobel P, et al. Zika virus: high infectious viral load in semen, a new sexually transmitted pathogen? Lancet Infect Dis. 2016;16(4):405. DOI: 10.1016/S1473-3099(16)00138-9 PMID: 26949027World Health Organization (WHO). Prevention of sexual transmission of Zika virus. Geneva: WHO. 7 Jun 2016. Available from: http://apps.who.int/iris/bitstream/10665/204421/1/WHO_ZIKV_MOC_16.1_eng.pdf?ua=1
  10. ConclusionsHere we describe a sexually transmitted ZIKV infection in Germany. The ZIKV RNA load in semen on day 45 post symptom onset was significantly lower than in previous reports [13,18,19]. Sexual transmission of ZIKV is of special concern during pregnancy and specific guidelines for prevention have been published [4,20]. In order to protect the fetus, the European Centre for Disease Prevention and Control (ECDC) notes that male travellers returning from affected areas should consider using a condom with a pregnant partner until the end of pregnancy [4]. In addition, the World Health Organization (WHO) now advises male travellers returning from areas with ongoing ZIKV transmission to practice safer sex or consider abstinence for at least eight weeks after their return in order to reduce the potential risk of onward sexual transmission. This period extends to at least six months if symptoms of ZIKV infection occur, during or after travel [20]. In contrast to previously described index cases involved in sexual transmission, our case did not notice haematospermia. It will be important to elucidate if haematospermia is associated with a higher ZIKV load in semen and if there is a correlation with the risk of sexual transmission of ZIKV. In addition, experimental data on ZIKV infection of semen are needed to substantiate the epidemiological findings.
  11. BackgroundZIKV is an emerging mosquito-borne flavivirus that causes a mild, dengue fever-like illness termed ZVD [3]. The most common symptoms are rash, arthralgia, and conjunctivitis. ZIKV infection has recently been associated with neurological disease and severe birth defects [4-6]. The Asian genotype of ZIKV is currently causing a large epidemic in the Americas [7]. ZIKV infection has also been detected in returning travellers from endemic and epidemic regions [8,9]. The virus is most likely transmitted through bites of infected Ae. aegypti and Ae. albopictus mosquitoes [10,11]. Sexual transmission, which had first been assumed in 2008 in the United States (US) in the wife of a man who had previously been to Senegal [12]. Circumstantial evidence suggested possible sexual transmission by vaginal intercourse in the days after the return of the male patient and before onset of symptoms of ZIKV infection and concomitant prostatitis. He had developed haematospermia four days after disease onset. Further potential evidence for sexual transmissibility was seen in 2013 by detection of ZIKV RNA in semen (2.9x107 and 1.1x107 copies/mL) and urine of a patient from Tahiti with haematospermia some weeks after symptoms compatible with ZVD. ZIKV was successfully cultured from semen and urine [13]. Additional evidence was reported from the United Kingdom by detection of ZIKV RNA from semen 27 and 62 days after onset of febrile illness in a man who had returned from the Cook Islands in 2014, and a prolonged potential for sexual transmission was discussed [14]. A male-to-male sexual transmission after anal sex was reported from the US in January 2016, after travel to Venezuela of the index patient, as shown by positive anti-ZIKV IgM and IgG detection in both patients. Haematospermia and symptoms of prostatitis were absent [15]. Retrospective analyses showing serological evidence of ZIKV infection suggested sexual transmission in an Italian couple after return of the male partner from Thailand [16]. A case series with incomplete results has been published from the US [17], describing infections in women following sexual contacts with their male partners after these had travelled in Central America and the Caribbean. Recently, sexual transmission was shown in a French woman after unprotected vaginal and oral intercourse with her male partner who had previously travelled to Brazil. ZIKV was detected by PCR and culture in his urine and semen on days 18 and 24 (2.9x108 and 3.5 x107 copies/mL in semen) following a period of symptomatic ZIKV infection. He did not report haematospermia [18]. A roughly 100,000 times higher ZIKV load in semen (8.6x1010 copies/mL) than in blood was recently demonstrated in a traveller returning to France from Brazil and French Guyana [19].
  12. Sequence analysis from urine samplesA fragment of the ZIKV NS5 gene (ca 400 bp, excluding primers) could be amplified from the urine of both patients (GenBank accession numbers KX253994 and KX253995). Sequence analysis showed 100% identity of the samples from both patients (exhibiting only one synonymous substitution in comparison to the closely related ZIKV strains from GenBank). Based on the phylogeny the two sequences clustered together with the recently detected ZIKV strains from Puerto Rico and other Central and South American countries into the same ZIKV outbreak clade from the Asian ZIKV lineage (Figure 2). Figure 2Maximum likelihood phylogenetic tree, sexually transmitted Zika virus infection from male traveller returning from Puerto Rico, to his female partner, Germany, April 2016 In the entries in red, P represent the two patients described here. The tree is based on nt sequences of the partial NS5 gene (ca 380 bp). It shows the placement of the ZIKV virus strains that were characterised directly from the urine (obtained from both patients, P1 and P2) in comparison to all available Zika virus (ZIKV) sequences in GenBank. The analysis was performed under the best fit nt substitution model identified as the Tamura-Nei (TN93 + Γ) model using jModelTest v2. To assess the robustness of each node, a bootstrap resampling process was performed (1,000 replicates) using the nearest neighbour interchange (NNI) branch-swapping method available in PhyML v3.0. For better visualisation of the position of the ZIKV strains identified in both patients we magnified the area of the American ZIKV outbreak clade which indicates the location of ZIKV from this study (red). The taxon information includes the GenBank accession number, isolation/detection year and country where the virus was isolated/detected. Scale bar indicates mean number of nt substitutions per site. The female patient did not recall any mosquito bites during the previous few weeks, when it was spring. In addition, ZIKV vector mosquito species Aedes aegypti or Ae. albopictus have not been described anywhere in northern Germany, thus a mosquito-borne transmission was regarded as highly unlikely. She had last been in an area at risk for ZIKV infection between Christmas 2015 and mid-January 2016, when the couple had visited a later ZIKV-affected country together. A male-to-female sexual ZIKV transmission was assumed given the sequence of clinical symptoms in the two patients and subsequent demonstration of seroconversion in the female patient. The molecular analyses and prolonged detection of ZIKV RNA in semen support the assumption. The couple reported multiple sexual contacts (vaginal intercourse without condoms) from the day of his return from travel (5 April) to onset of her rash (21 April), i.e. slightly before and up to 12 days after his onset of ZVD-like symptoms (Figure 1). She is taking oral contraceptives and was not pregnant at the time of infection. He did not report haematospermia or symptoms of prostatitis.
  13. Case descriptionsOn 13 April 2016, the index patient, a 35-year old male German citizen, presented at his general practitioner with signs and symptoms of a common cold. He had returned to northern Germany on 5 April after a one-week stay in Puerto Rico. At the time, a Zika virus (ZIKV) outbreak was ongoing in Puerto Rico [1]. On 6 April, the patient felt weak, but attributed his symptoms to travel-associated exhaustion. One day later, he noticed swollen nuchal lymph nodes. From 8 to 10 April his joints (fingers, knees and ankles) were swollen and painful, such that he could barely walk, and he had a hardly visible but very itchy rash. Neither conjunctivitis nor fever were present. After cessation of these symptoms, the patient developed symptoms of an upper respiratory tract infection lasting for about one week, dominated by a runny nose and persistent sinus headaches. A serum sample of 13 April was negative for Dengue virus (DENV) NS1 antigen, but showed an ZIKV antibody IgM titre of 1:1,280 and an IgG titre of 1:20,480 by indirect immunofluorescence test (IIFT, reference: < 1:20) [2]. Results were also positive for anti-ZIKV IgM and IgG in a commercial ELISA (Anti-Zika Virus ELISA, EUROIMMUN, Lübeck, Germany) [2]. Consequently, Zika virus disease (ZVD) was diagnosed (Figure 1). Figure 1Sequence of events in sexually transmitted Zika virus infection from male traveller returning from Puerto Rico, to his female partner, Germany, April 2016 ZIKV: Zika virus; ZVD: Zika virus disease. On 17 April, his 29-year-old female partner who had not been travelling, also developed upper respiratory tract infection. On 20 April, she additionally noted swollen lymph nodes in the neck. The following morning she noticed having unusually red cheeks and a non-itchy rash which spread within one to two hours to her entire body, except the palms of her hands. Fever and conjunctivitis were not noted. On the same day, 21 April, the index patient was informed about his ZIKV infection and his partner was tested for ZIKV infection, too. She was negative for anti-ZIKV IgG and IgM in IIFT and ELISA, as well as DENV NS1-Antigen, however, ZIKV RNA was detected in serum and urine by real time RT-PCR (RealStar Zika Virus RT-PCR Kit 1.0, altona Diagnostics, Hamburg, Germany) and she was diagnosed with ZVD (Figure 1). ZIKV RNA was not detected in saliva. During the next days she developed swollen and painful joints affecting some fingers and the ankles. Symptoms resolved by 25 April. The male patient had ZIKV RNA in urine, but not in saliva and serum 13 days after onset of symptoms. One semen sample taken 45 days after onset of symptoms tested positive for ZIKV RNA and the RNA load was 6x104 copies/mL. In contrast, urine and serum samples were then both negative for ZIKV RNA. ZIKV could not be isolated in cell culture from semen. The female patient tested positive for anti-ZIKV-IgM and IgG in the IIFT and ELISA 34 days after onset of symptoms demonstrating ZIKV seroconversion. Her urine and serum samples then tested negative for ZIKV RNA.
  14. Zika virus (ZIKV), an emerging mosquito-borne flavivirus, causes a mild dengue fever-like illness but has recently been associated with neurological disease and severe birth defects. The virus is currently causing a large epidemic in the Americas. Here, we report a male-to-female sexual transmission of ZIKV in Germany in April 2016, following travel to Puerto Rico of the male patient, demonstrated by subsequent seroconversions and molecular identification of identical virus sequences from both patients.
  15. C Frank 1 , D Cadar 2 , A Schlaphof 2 , N Neddersen 2 , S Günther 2 , J Schmidt-Chanasit 2 3 4 , D Tappe 2 3 4+ Author affiliations 1. Robert Koch Institute, Department for Infectious Disease Epidemiology, Division of Gastrointestinal Infections, Zoonoses and Tropical Infections, Berlin, Germany 2. Bernhard Nocht Institute for Tropical Medicine, WHO Collaborating Centre for Arbovirus and Haemorrhagic Fever Reference and Research, Hamburg, Germany 3. German Centre for Infection Research (DZIF), partner site Hamburg-Luebeck-Borstel, Hamburg, Germany 4. These authors contributed equally to this work Correspondence: Jonas Schmidt-Chanasit ([email protected])
  16. Eurosurveillance, Volume 21, Issue 23, 09 June 2016Rapid communication SEXUAL TRANSMISSION OF ZIKA VIRUS IN GERMANY, APRIL 2016 http://www.eurosurveillance.org/ViewArticle.aspx?ArticleId=22498
  17. Sequence Map Update https://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU
  18. LOCUS KU724100 528 bp RNA linear VRL 11-JUN-2016 DEFINITION Zika virus isolate 259043_2015_Panama NS5B gene, partial cds. ACCESSION KU724100 VERSION KU724100.1 GI:998178894 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 528) AUTHORS Arauz,D., De Urriola,L., Jones,J., Castillo,M., Martinez,A., Murillo,E., Troncoso,L., Chen,M., Abrego,L., Armien,B., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Febrile or Exanthematous Illness Associated with Zika, Dengue, and Chikungunya Viruses, Panama JOURNAL Emerging Infect. Dis. 22 (8) (2016) In press PUBMED 27139219 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 528) AUTHORS Arauz,D. Sr., De Urriola,L., Castillo,M., Martinez,A.A., Murillo,E., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Direct Submission JOURNAL Submitted (17-FEB-2016) Departament of Research in Virology and Biotechnology, Gorgas Institute For Health Studies Memorial Institute, Ave. Justo Arosemena 35th Street, Panama, Panama 0816-02593, Panama COMMENT ##Assembly-Data-START## Assembly Method :: Sequencher v. 4.5 Coverage :: partial Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..528 /organism="Zika virus" /mol_type="genomic RNA" /isolate="259043_2015_Panama" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Panama" /collection_date="29-Nov-2015"
  19. Sequence Map Update https://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU
  20. LOCUS KU724099 612 bp RNA linear VRL 11-JUN-2016 DEFINITION Zika virus isolate 259032_2015_Panama NS5B gene, partial cds. ACCESSION KU724099 VERSION KU724099.1 GI:998178892 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 612) AUTHORS Arauz,D., De Urriola,L., Jones,J., Castillo,M., Martinez,A., Murillo,E., Troncoso,L., Chen,M., Abrego,L., Armien,B., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Febrile or Exanthematous Illness Associated with Zika, Dengue, and Chikungunya Viruses, Panama JOURNAL Emerging Infect. Dis. 22 (8) (2016) In press PUBMED 27139219 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 612) AUTHORS Arauz,D. Sr., De Urriola,L., Castillo,M., Martinez,A.A., Murillo,E., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Direct Submission JOURNAL Submitted (17-FEB-2016) Departament of Research in Virology and Biotechnology, Gorgas Institute For Health Studies Memorial Institute, Ave. Justo Arosemena 35th Street, Panama, Panama 0816-02593, Panama COMMENT ##Assembly-Data-START## Assembly Method :: Sequencher v. 4.5 Coverage :: partial Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..612 /organism="Zika virus" /mol_type="genomic RNA" /isolate="259032_2015_Panama" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Panama" /collection_date="29-Nov-2015"
  21. Sequence Map Update https://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU
  22. LOCUS KU724098 648 bp RNA linear VRL 11-JUN-2016 DEFINITION Zika virus isolate 259060_2015_Panama NS5B gene, partial cds. ACCESSION KU724098 VERSION KU724098.1 GI:998178890 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 648) AUTHORS Arauz,D., De Urriola,L., Jones,J., Castillo,M., Martinez,A., Murillo,E., Troncoso,L., Chen,M., Abrego,L., Armien,B., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Febrile or Exanthematous Illness Associated with Zika, Dengue, and Chikungunya Viruses, Panama JOURNAL Emerging Infect. Dis. 22 (8) (2016) In press PUBMED 27139219 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 648) AUTHORS Arauz,D. Sr., De Urriola,L., Castillo,M., Martinez,A.A., Murillo,E., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Direct Submission JOURNAL Submitted (17-FEB-2016) Departament of Research in Virology and Biotechnology, Gorgas Institute For Health Studies Memorial Institute, Ave. Justo Arosemena 35th Street, Panama, Panama 0816-02593, Panama COMMENT ##Assembly-Data-START## Assembly Method :: Sequencher v. 4.5 Coverage :: partial Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..648 /organism="Zika virus" /mol_type="genomic RNA" /isolate="259060_2015_Panama" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Panama" /collection_date="29-Nov-2015"
  23. Sequence Map Update https://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU
  24. LOCUS KU724097 653 bp RNA linear VRL 11-JUN-2016 DEFINITION Zika virus isolate 259250_2015_Panama NS5B gene, partial cds. ACCESSION KU724097 VERSION KU724097.1 GI:998178888 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 653) AUTHORS Arauz,D., De Urriola,L., Jones,J., Castillo,M., Martinez,A., Murillo,E., Troncoso,L., Chen,M., Abrego,L., Armien,B., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Febrile or Exanthematous Illness Associated with Zika, Dengue, and Chikungunya Viruses, Panama JOURNAL Emerging Infect. Dis. 22 (8) (2016) In press PUBMED 27139219 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 653) AUTHORS Arauz,D. Sr., De Urriola,L., Castillo,M., Martinez,A.A., Murillo,E., Pascale,J.M., Sosa,N., Lopez-Verges,S. and Moreno,B. TITLE Direct Submission JOURNAL Submitted (17-FEB-2016) Departament of Research in Virology and Biotechnology, Gorgas Institute For Health Studies Memorial Institute, Ave. Justo Arosemena 35th Street, Panama, Panama 0816-02593, Panama COMMENT ##Assembly-Data-START## Assembly Method :: Sequencher v. 4.5 Coverage :: partial Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..653 /organism="Zika virus" /mol_type="genomic RNA" /isolate="259250_2015_Panama" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Panama" /collection_date="11-Dec-2015"
  25. Sequence Map update https://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.