Everything posted by niman
-
Illinois Zika Tally Page
The Illinois Department of Public Health is reporting 13 cases of Zika virus disease statewide.
-
Zika Confirmed Travelers In Georgia Increase To 13
Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
-
Zika Confirmed Travelers In Georgia Increase To 13
As of April 15, 201613 confirmed travel-related Zika cases in Georgia (all non-pregnant)http://dph.georgia.gov/
-
Georgia Zika Tally Page
As of April 15, 201613 confirmed travel-related Zika cases in Georgia (all non-pregnant)
-
Alabama Zika Tally Sheet
Alabama Residents Tested for Zika Virus as of April 18, 2016 Number Tested PositiveNumber of SubmissionsNumber with Results Pending3 51 11
-
2014 Haiti Zika Envelope Sequences Address Americas Origin - Haiti/1227/2014
Sequence map update https://www.google.com/maps/d/u/1/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en
-
2014 Haiti Zika Envelope Sequences Address Americas Origin - Haiti/1230/2014
Sequence map update https://www.google.com/maps/d/u/1/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en
-
Two Zika Confirmed Microcephaly Cases In Colombia
Microcephaly, the most terrible aftermath of the Zika virus The MoH confirmed 2 cases and projects up to 300 more children will be born between May and September this anomaly derived Zika in Colombia By: Las2orillas | April 15, 2016 Microcephaly, the most terrible aftermath of the Zika virus Scientific authorities have confirmed a feared effect. In the departments of Norte de Santander and Cundinamarca first two babies were born with microcephaly, caused because their mothers at the time of gestation were infected with the virus Zika. The epidemic, which has spread for three months across the country, is transmitted by the bite of Aedes mosquito and to date no record of 70,000 reported clinical cases. Now scientific authorities establish the association of the virus with the abnormal development of the skull in babies: the head of those born with this involvement is lower than normal. Deputy Health Minister Fernando Ruiz Gómez, explained that his office and the National Institute of Health (INS) worked hand the Center for Disease Control in Atlanta, USA, to monitor cases analysis from where the discovery of the two confirmed, and there are 15 other cases still under study. "However, the new estimates we project with the National Institute of Health realize that may occur between 95 and 300 cases of microcephaly, up to 380 cases of Guillain-Barre syndrome and a maximum of 200,000 clinical cases of the disease (Zika ) throughout the national territory, "Ruiz said. Zika association with microcephaly was something that was speculation fear of the outbreak of the virus, but there was no scientific support that support it. The Deputy Minister explained Ruiz complex scientific protocol followed to prove or rule out a case of microcephaly originates Zika virus. "In each case, the INS conducted a strict protocol consisting of three laboratory tests for infections by molecular technique and genetic testing of more than 500 bands, plus brain scan, ophthalmologic evaluation, hearing, consultation genetics neuropediatrics, as it requires, "he said. The news was given in Colombia just one day after the Center for Disease Control of the United States announced to the world that effectively Zika causes serious defects in newborns, including microcephaly. Colombia now realizes the first two confirmed cases, but it is a matter of time that -according to projections begin to be international- cases throughout Latin America as the Pan American Health Organization realizes twenty countries suffer the epidemic the Zika. http://noticucuta.sharedby.co/share/6yFXz7
-
2014 Haiti Zika Envelope Sequences Address Americas Origin - Haiti/1227/2014
Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome645645100%0.0100%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome645645100%0.0100%KU922923.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds645645100%0.0100%KU647676.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds640640100%8e-18099%KU963796.1Select seq gb|KU509998.2|Zika virus strain Haiti/1225/2014, complete genome640640100%8e-18099%KU509998.2Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds640640100%8e-18099%KU991811.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds640640100%8e-18099%KU955589.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome640640100%8e-18099%KU926309.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds640640100%8e-18099%KU866423.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome640640100%8e-18099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome640640100%8e-18099%KU853012.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome640640100%8e-18099%KU820899.2Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds640640100%8e-18099%KU820897.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome640640100%8e-18099%KU681081.3Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome640640100%8e-18099%KU527068.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds640640100%8e-18099%KU646828.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome640640100%8e-18099%KU321639.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds640640100%8e-18099%KJ776791.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome634634100%4e-17899%KU870645.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds634634100%4e-17899%KU729217.2Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds634634100%4e-17899%KU729218.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome634634100%4e-17899%KU497555.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome634634100%4e-17899%KU707826.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds634634100%4e-17899%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds634634100%4e-17899%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome634634100%4e-17899%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds634634100%4e-17899%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds634634100%4e-17899%KU365779.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds634634100%4e-17899%KU365778.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds634634100%4e-17899%KU365777.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds634634100%4e-17899%KU312315.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds634634100%4e-17899%KU312312.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds634634100%4e-17899%KJ634273.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome628628100%2e-17699%KU940228.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome628628100%2e-17699%KU940224.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome628628100%2e-17699%KU955593.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds628628100%2e-17699%KU955590.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome628628100%2e-17699%KU926310.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds628628100%2e-17699%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds628628100%2e-17699%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds628628100%2e-17699%KU761564.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds628628100%2e-17699%KU646827.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds628628100%2e-17699%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds628628100%2e-17699%KU312313.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds628628100%2e-17699%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds628628100%2e-17699%EU545988.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome612612100%2e-17198%KU744693.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds612612100%2e-17198%KF993678.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome606606100%8e-17098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds568568100%4e-15896%HQ234499.1Select seq gb|KR816334.1|Zika virus isolate BR/UFBA/LabViro/Ex1 envelope protein gene, partial cds56256287%2e-15699%KR816334.1Select seq gb|KR816333.1|Zika virus isolate BR/UFBA/LabViro/23 envelope protein gene, partial cds56056087%6e-15699%KR816333.1Select seq gb|KR815989.1|Zika virus isolate 15095 envelope protein gene, partial cds56056086%6e-156100%KR815989.1Select seq gb|KR816335.1|Zika virus isolate BR/UFBA/LabViro/18 envelope protein gene, partial cds55655687%8e-15599%KR816335.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome53453486%4e-14899%KU940227.1
-
2014 Haiti Zika Envelope Sequences Address Americas Origin - Haiti/1227/2014
LOCUS KX062044 349 bp ss-RNA linear VRL 14-APR-2016 DEFINITION Zika virus isolate Haiti/1227/2014 envelope protein gene, partial cds. ACCESSION KX062044 VERSION KX062044.1 GI:1018266330 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 349) AUTHORS Lednicky,J.A., Morris,J.G. Jr., Beau De Rochars,V.M., Elbadry,M.A., Okech,B.A. and Loeb,J.C. TITLE Envelope protein gene sequences of two different Zika virus isolates from blood drawn in 2014 from Haitian children JOURNAL Unpublished REFERENCE 2 (bases 1 to 349) AUTHORS Lednicky,J.A., Morris,J.G. Jr., Beau De Rochars,V.M., Elbadry,M.A., Okech,B.A. and Loeb,J.C. TITLE Direct Submission JOURNAL Submitted (12-APR-2016) Environmental and Global Health, University of Florida - Gainesville, 1225 Center Drive, Room 4155, Gainesville, FL 32610, USA COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..349 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Haiti/1227/2014" /isolation_source="plasma" /host="Homo sapiens" /db_xref="taxon:64320" /country="Haiti" /collection_date="15-Dec-2014" /identified_by="John Lednicky" CDS <1..>349 /codon_start=1 /product="envelope protein" /protein_id="AMY50629.1" /db_xref="GI:1018266331" /translation="EALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGR LSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKV PAQMAVDMQTLTPV" ORIGIN 1 gaagcactgg tagagttcaa ggacgcacat gccaaaaggc aaactgtcgt ggttctaggg 61 agtcaagaag gagcagttca cacggccctt gctggagctc tggaggctga gatggatggt 121 gcaaagggaa ggctgtcctc tggccacttg aaatgtcgcc tgaaaatgga taaacttaga 181 ttgaagggcg tgtcatactc cttgtgtacc gcagcgttca cattcaccaa gatcccggct 241 gaaacactgc acgggacagt cacagtggag gtacagtacg cagggacaga tggaccttgc 301 aaggttccag cccagatggc ggtggacatg caaactctga ccccagttg
-
2014 Haiti Zika Envelope Sequences Address Americas Origin - Haiti/1227/2014
University of Florida has released a partial Zika 2014 envelope sequence A/Haiti/1227/2014 which is distinct from other 2014 envelope sequences from Haiti. This sequence shares a polymorphisms with two sequences from Mexico and one from Martinique,suggesting Haiti seeded Zika into multiple countries in the Americas,including Brazil. All four Haiti sequences (three from 2014 and 1 from 2016) have an identical NS5 sequence.which has not been reported in any sequence from Brazil.
-
2014 Haiti Zika Envelope Sequences Address Americas Origin - Haiti/1230/2014
Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds645645100%0.0100%KU963796.1Select seq gb|KU509998.2|Zika virus strain Haiti/1225/2014, complete genome645645100%0.0100%KU509998.2Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds645645100%0.0100%KU991811.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds645645100%0.0100%KU955589.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome645645100%0.0100%KU926309.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds645645100%0.0100%KU866423.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome645645100%0.0100%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome645645100%0.0100%KU853012.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome645645100%0.0100%KU820899.2Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds645645100%0.0100%KU820897.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome645645100%0.0100%KU681081.3Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome645645100%0.0100%KU527068.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds645645100%0.0100%KU646828.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome645645100%0.0100%KU321639.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds645645100%0.0100%KJ776791.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome640640100%8e-18099%KU870645.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome640640100%8e-18099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome640640100%8e-18099%KU922923.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds640640100%8e-18099%KU729217.2Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds640640100%8e-18099%KU729218.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome640640100%8e-18099%KU497555.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome640640100%8e-18099%KU707826.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds640640100%8e-18099%KU647676.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds640640100%8e-18099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds640640100%8e-18099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome640640100%8e-18099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds640640100%8e-18099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds640640100%8e-18099%KU365779.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds640640100%8e-18099%KU365778.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds640640100%8e-18099%KU365777.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds640640100%8e-18099%KU312315.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds640640100%8e-18099%KU312312.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds640640100%8e-18099%KJ634273.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome634634100%4e-17899%KU940228.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome634634100%4e-17899%KU940224.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome634634100%4e-17899%KU955593.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds634634100%4e-17899%KU955590.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome634634100%4e-17899%KU926310.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds634634100%4e-17899%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds634634100%4e-17899%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds634634100%4e-17899%KU761564.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds634634100%4e-17899%KU646827.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds634634100%4e-17899%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds634634100%4e-17899%KU312313.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds634634100%4e-17899%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds634634100%4e-17899%EU545988.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome617617100%4e-17399%KU744693.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds617617100%4e-17399%KF993678.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome612612100%2e-17198%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds573573100%8e-16096%HQ234499.1Select seq gb|KR815989.1|Zika virus isolate 15095 envelope protein gene, partial cds56056086%6e-156100%KR815989.1Select seq gb|KR816334.1|Zika virus isolate BR/UFBA/LabViro/Ex1 envelope protein gene, partial cds55655687%8e-15599%KR816334.1Select seq gb|KR816333.1|Zika virus isolate BR/UFBA/LabViro/23 envelope protein gene, partial cds55555587%3e-15499%KR816333.1Select seq gb|KR816335.1|Zika virus isolate BR/UFBA/LabViro/18 envelope protein gene, partial cds55155187%4e-15399%KR816335.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome54054086%8e-15099%KU940227.1
-
2014 Haiti Zika Envelope Sequences Address Americas Origin - Haiti/1230/2014
LOCUS KX062045 349 bp ss-RNA linear VRL 14-APR-2016 DEFINITION Zika virus isolate Haiti/1230/2014 envelope protein gene, partial cds. ACCESSION KX062045 VERSION KX062045.1 GI:1018266332 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 349) AUTHORS Lednicky,J.A., Morris,J.G. Jr., Beau De Rochars,V.M., Elbadry,M.A., Okech,B.A. and Loeb,J.C. TITLE Envelope protein gene sequences of two different Zika virus isolates from blood drawn in 2014 from Haitian children JOURNAL Unpublished REFERENCE 2 (bases 1 to 349) AUTHORS Lednicky,J.A., Morris,J.G. Jr., Beau De Rochars,V.M., Elbadry,M.A., Okech,B.A. and Loeb,J.C. TITLE Direct Submission JOURNAL Submitted (12-APR-2016) Environmental and Global Health, University of Florida - Gainesville, 1225 Center Drive, Room 4155, Gainesville, FL 32610, USA COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..349 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Haiti/1230/2014" /isolation_source="plasma" /host="Homo sapiens" /db_xref="taxon:64320" /country="Haiti" /collection_date="17-Dec-2014" /identified_by="John Lednicky" CDS <1..>349 /codon_start=1 /product="envelope protein" /protein_id="AMY50630.1" /db_xref="GI:1018266333" /translation="EALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGR LSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKV PAQMAVDMQTLTPV" ORIGIN 1 gaagcactgg tagagttcaa ggacgcacat gccaaaaggc aaactgtcgt ggttctaggg 61 agtcaagaag gagcagttca cacggccctt gctggagctc tggaggctga gatggatggt 121 gcaaagggaa ggctgtcctc tggccacttg aaatgtcgcc tgaaaatgga taaacttaga 181 ttgaagggcg tgtcatactc cttgtgtacc gcagcgttca cattcaccaa gatcccggct 241 gaaacactgc acgggacagt cacagtggag gtacagtacg cagggacaga tggaccttgc 301 aaggttccag ctcagatggc ggtggacatg caaactctga ccccagttg
-
2014 Haiti Zika Envelope Sequences Address Americas Origin - Haiti/1230/2014
University of Florida has released 2 more 2014 Zika envelope sequences. The partial sequence from Haiti/1230/2014 matches Haiti/1225/2014 as well as the NP 5 gene, which is identical in all four Haiti sequences. However,Haiti/1227/2014 has a different envelope sequence ,adding to data indicating that Zikain the Americas was seeded by Haiti sequences, which traveled from French Polynesia in 2013 to Easter Island and Haiti in 2014.
-
New Jersey Zika Cases Increase To Eight
Map update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
-
New Jersey Zika Cases Increase To Eight
The latest Zika case in NJ is Camden County womanBy Sergio Bichao April 16, 2016 8:41 AM In this Jan. 27, 2016, file photo, an Aedes aegypti mosquito is photographed through a microscope at the Fiocruz institute in Recife, Pernambuco state, Brazil. (AP Photo/Felipe Dana, File)A Camden County woman is the New Jersey’s latest victim of the Zika virus. Less than 10 people in New Jersey have contracted the illness, which is carried by certain mosquitoes and can cause birth-defects in infected pregnant women. All the cases in the state — including the woman in Camden — have been a result of travel to countries dealing with an outbreak, the Centers for Disease Control and Prevention says. The Camden County woman, who is not pregnant, visited a doctor April 2 with symptoms of ever, rash, fatigue and joint pain. Her doctor provided specimens for testing to the CDC, which then notified the state Department of Health. The Camden County Health and Human Services Department was notified of the positive results on Friday. Ted Louie, an infectious disease expert with Highland Park Medical Associates in East Brunswick, told New Jersey 101.5 in February that Zika isn’t a major cause for concern in New Jersey, especially men and women who are not pregnant. The illness from Zika is mild and the mosquito that carries the virus is not found in the Garden State. Health officials urge travelers to guard against mosquitoes when they travel to areas affected with Zika. http://nj1015.com/the-latest-zika-case-in-nj-is-camden-county-woman/ Read More: The latest Zika case in NJ is Camden County woman | http://nj1015.com/the-latest-zika-case-in-nj-is-camden-county-woman/?trackback=tsmclip
-
Zika Traveler In Irving Texas ex-Jamaica
Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
-
Zika Traveler In Irving Texas ex-Jamaica
Dallas County traveler contracts Zika virus By: FOX4News.com Staff POSTED:APR 15 2016 11:45AM CDT UPDATED:APR 15 2016 11:45AM CDT DALLAS - A sixth Dallas County resident has contacted the Zika virus. This time the patient caught it while visiting Jamaica. County health officials said the 41-year-old patient lives in Irving. No other details about his or her identity were released. Ad Content DevOps: Buzzword Or Way Of Life?Microsoft Easy-to-Use Job Search Tools as Impressive as Your ResumeMonster The Zika virus is primarily transmitted by Aedes mosquitoes, but can be spread through sexual contact. Symptoms are often mild and include fever, rash, joint pain and red eyes. They often only last for a few days. Top fox4news.com Searches ArmeniaBairSouth DallasFrisco MotherShermanMesquiteAd What Are Index FundsBut, scientists are now convinced the virus sweeping through Latin America and the Caribbean causes devastating defects in fetal brains if women become infected during pregnancy. Residents, especially pregnant women, are encouraged to avoid mosquito bites and unprotected sexual contact with people who have traveled to areas where the virus is common. There have been a total of six cases reported in Dallas County, three in Tarrant County and one in Denton County. All were imported, except for one case through sexual transmission in Dallas County.
-
Zika Traveler In Irving Texas ex-Jamaica
A sixth Dallas County resident has contacted the Zika virus. This time the patient caught it while visiting Jamaica. County health officials said the 41-year-old patient lives in Irving. No other details about his or her identity were released. http://www.fox4news.com/news/123209833-story
-
Florida Zika Cases Increase To 88
Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
-
Florida Zika Cases Increase To 88
April 15, 2016 DEPARTMENT OF HEALTH DAILY ZIKA UPDATE: ONE NEW TRAVEL-RELATED CASE IN MIAMI-DADE COUNTY TODAY Contact:Communications [email protected](850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the Florida Department of Health will issue a Zika virus update each week day at 2 p.m. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. There is one new travel-related case in Miami-Dade County today. Of the cases confirmed in Florida, six cases are still exhibiting symptoms. According to the CDC, symptoms associated with the Zika virus last between seven to 10 days. Based on CDC guidance, several pregnant women who have traveled to countries with local-transmission of Zika have received antibody testing, and of those, five have tested positive for the Zika virus. The CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. It is recommended that women who are pregnant or thinking of becoming pregnant postpone travel to Zika affected areas. County Number of Cases (all travel related) Alachua 4 Brevard 2 Broward 13 Clay 1 Collier 1 Hillsborough 3 Lee 4 Miami-Dade 36 Orange 5 Osceola 4 Palm Beach 4 Polk 3 Santa Rosa 1 Seminole 1 St. Johns 1 Cases involving pregnant women* 5 Total 88 *Counties of pregnant women will not be shared. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 1,414 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. All cases are travel-associated. There have been no locally-acquired cases of Zika in Florida. For more information on the Zika virus, click here. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. More Information on DOH action on Zika: On Feb. 3, Governor Scott directed the State Surgeon General to issue a Declaration of Public Health Emergency for the counties of residents with travel-associated cases of Zika.There have been 15 counties included in the declaration– Alachua, Brevard, Broward, Clay, Collier, Hillsborough, Lee, Miami-Dade, Orange, Osceola, Palm Beach, Polk, Santa Rosa, Seminole and St. Johns – and will be updated as needed. DOH encourages Florida residents and visitors to protect themselves from all mosquito-borne illnesses by draining standing water; covering their skin with repellent and clothing; and covering windows with screens.DOH has a robust mosquito-borne illness surveillance system and is working with the CDC, the Florida Department of Agriculture and Consumer Services and local county mosquito control boards to ensure that the proper precautions are being taken to protect Florida residents and visitors.On April 6, Governor Rick Scott and Interim State Surgeon General Dr. Celeste Philip hosted a conference call with Florida Mosquito Control Districts to discuss ongoing preparations to fight the possible spread of the Zika virus in Florida. There were 74 attendees on the call.Florida currently has the capacity to test 6,728 people for active Zika virus and 1,537 for Zika antibodies.Federal Guidance on Zika: According to the CDC, Zika illness is generally mild with a rash, fever and joint pain. CDC researchers have concluded that Zika virus is a cause of microcephaly and other birth defects.The FDA released guidance regarding donor screening, deferral and product management to reduce the risk of transfusion-transmission of Zika virus. Additional information is available on the FDA website here.The CDC has put out guidance related to the sexual transmission of the Zika virus. This includes the CDC recommendation that if you have traveled to a country with local transmission of Zika you should abstain from unprotected sex.For more information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov. http://www.floridahealth.gov/newsroom/2016/04/041516-zika-update.html
-
Florida Zika Cases Increase To 88
County Number of Cases (all travel related) Alachua 4 Brevard 2 Broward 13 Clay 1 Collier 1 Hillsborough 3 Lee 4 Miami-Dade 36 Orange 5 Osceola 4 Palm Beach 4 Polk 3 Santa Rosa 1 Seminole 1 St. Johns 1 Cases involving pregnant women* 5 Total 88
-
Zika Cases In Canada Increase To 46
Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
-
Zika Cases In Canada Increase To 46
Zika virus reported in Manitoba for 1st time CBC News Posted: Apr 15, 2016 11:07 AM CT Last Updated: Apr 15, 2016 12:59 PM CT The edes aegypti mosquito, which can carry Zika virus, can't survive Canada's cool winters, Manitoba Health says. (Daniel Becerril/Reuters) 612 shares Facebook Twitter Reddit Google Share Email Related StoriesZika confirmed as a cause of microcephaly: CDCZika's potential to spread in U.S. 'scarier than we initially thought:' CDCManitobans asked to donate blood amid Zika virus concerns20 Canadians, including pregnant woman, infected by Zika in other countriesExternal LinksManitoba Health: More information on Zika virus(Note: CBC does not endorse and is not responsible for the content of external links.) Manitoba health officials have confirmed the first two cases of Zika virus infection in the province. Both individuals had recently travelled to an area affected by an outbreak, the provincial government said Friday. Officials did not release any details about the patients or where they had been. "These two cases are travel-related; they are not locally acquired," Dr. Elise Weiss, of Manitoba Public Health, told CBC News. "Canada is reporting several cases and they all have been related to Canadians — Manitobans, in our case — who have travelled to areas where Zika is known to be circulating. So that is to be differentiated from, say, some of these countries where they're acquired locally." Even though cases have been confirmed, Weiss said the overall risk of Zika virus to people in the province is "very low," as the mosquito species that carries the virus cannot survive Canada's cool weather. "The mosquitoes we do have are not known to carry the virus that causes Zika," she said. Zika confirmed as a cause of microcephaly: CDCEntomologists gather in Brazil to stop Zika mosquitoZika's potential to spread in U.S. 'scarier than we initially thought:' CDCEarlier this week, the U.S. Centers for Disease Control and Prevention confirmed Zika virus is a cause of microcephaly and other serious birth defects. Babies with microcephaly are born with abnormally small heads that can result in developmental problems. Microcephaly and other fetal malformations that might be associated with Zika infection have been reported in more than 1,000 cases in Brazil, seven in Colombia, eight in French Polynesia and smaller numbers in Martinique, Panama and Cabo Verde, the World Health Organization said last week. Mosquito-borne Zika virus cases have been reported in 17 countries since 2007 and areas of the Western Pacific, the United Nations public health agency said. There are no documented cases of Zika infections in Canada or the continental U.S. contracted from local mosquitoes. Local mosquito transmission has been reported in Puerto Rico, the U.S. Virgin Islands and American Samoa. Widespread outbreaks are reported in Brazil and Colombia. Health authorities urge cautionHealth authorities, including Manitoba Health, advise people travelling to areas affected by the current Zika virus outbreak, or areas at risk of an outbreak, to protect themselves against mosquito bites by wearing protective clothing, using insect repellant and making sure windows and doors have screens on them. As well, pregnant women are advised against travelling to areas with an outbreak or at risk of an outbreak. Manitoba Health also urges caution as research is underway into the potential of Zika virus being sexually transmitted. Possible Zika virus case in Saskatchewan may have been sexually transmitted"Women should avoid becoming pregnant during travel to an affected area by the current Zika virus outbreak or an area at risk, and for two months after return from these areas," the department said in a news release. "It is recommended that men returning from an affected area or an area at risk, who show symptoms or are diagnosed with Zika virus, consider using condoms or not having sex for at least six months after symptoms begin. It is also recommended that even men returning from an affected area or an area at risk who show no symptoms consider using condoms or not having sex for at least eight weeks after returning from an affected area." With files from The Associated Press http://www.cbc.ca/news/canada/manitoba/zika-virus-manitoba-1.3537654
-
Zika Cases In Canada Increase To 46
Zika virus cases in Canada, as of April 14, 2016 http://www.healthycanadians.gc.ca/diseases-conditions-maladies-affections/disease-maladie/zika-virus/surveillance-eng.php?id=zikacases#s1 CountryLocally acquired through sexual transmissionTravel-relatedCanada046