-
Posts
74,774 -
Joined
-
Last visited
-
Days Won
31
Content Type
Profiles
Forums
Articles
Events
Blogs
Everything posted by niman
-
LOCUS KU963796 10709 bp RNA linear VRL 05-APR-2016 DEFINITION Zika virus isolate SZ-WIV01 polyprotein gene, complete cds. ACCESSION KU963796 VERSION KU963796.1 GI:1009327546 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10709) AUTHORS Deng,C.-L., Liu,S.-Q., Zhang,Q.-Y., Xu,M.-Y., Zhang,H.-L., Gu,D.-Y., Shi,L., He,J.-A., Xiao,G.-F. and Zhang,B. TITLE Isolation and characterization of Zika virus imported to China in C6/36 mosquito cells JOURNAL Unpublished REFERENCE 2 (bases 1 to 10709) AUTHORS Deng,C.-L., Liu,S.-Q., Zhang,Q.-Y., Xu,M.-Y., Zhang,H.-L., Gu,D.-Y., Shi,L., He,J.-A., Xiao,G.-F. and Zhang,B. TITLE Direct Submission JOURNAL Submitted (24-MAR-2016) Key Laboratory of Special Pathogens and Biosafety, Center for Emerging Infectious Diseases, Wuhan Institute of Virology, Chinese Academy of Sciences, Xiao Hong Shan Zhong Qu 44, Wuhan, Hubei 430071, China COMMENT ##Assembly-Data-START## Assembly Method :: DNAStar v. 7.0 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10709 /organism="Zika virus" /mol_type="genomic RNA" /isolate="SZ-WIV01" /isolation_source="serum" /host="Homo sapiens" /culture_collection="CCGVCC:IVCAS 6.6110" /db_xref="taxon:64320" /country="China: Shenzhen" /collection_date="2016" /note="imported from American Samoa; genotype: Asian" CDS 59..10330 /codon_start=1 /product="polyprotein" /protein_id="AMR68932.1" /db_xref="GI:1009327547" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTNVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGARRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFQAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPMLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRSMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVRPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 aagctagcaa cagtatcaac aggttttatt ttggatttgg aaacgagagt ttctggtcat 61 gaaaaaccca aaaaagaaat ccggaggatt ccggattgtc aatatgctaa aacgcggagt 121 agcccgtgtg agcccctttg ggggcttgaa gaggctgcca gccggacttc tgctgggtca 181 tgggcccatc aggatggtct tggcgattct agccttcttg agattcacgg caatcaagcc 241 atcactgggt ctcatcaata gatggggttc agtggggaaa aaagaggcta tggaaataat 301 aaagaagttc aagaaagatc tggctgccat gctgagaata atcaatgcta ggaaggagaa 361 gaagagacga ggcgcagata ctaatgtcgg aattgttggc ctcctgctga ccacagctat 421 ggcagcggag gtcactagac gtgggagtgc atactatatg tacttggaca gaaacgatgc 481 tggggaggcc atatcttttc caaccacatt ggggatgaat aagtgttata tacagatcat 541 ggatcttgga cacatgtgtg atgccaccat gagctatgaa tgccctatgc tggatgaggg 601 ggtggaacca gatgacgtcg attgttggtg caacacgacg tcaacttggg ttgtgtacgg 661 aacctgccat cacaaaaaag gtgaagcacg gagatctaga agagctgtga cgctcccctc 721 ccattccact aggaagctgc aaacgcggtc gcaaacttgg ttggaatcaa gagaatacac 781 aaagcacttg attagagtcg aaaattggat attcaggaac cctggcttcg cgttagcagc 841 agctgccatc gcttggcttt tgggaagctc aacgagccaa aaagtcatat acttggtcat 901 gatactgctg attgccccgg catacagcat caggtgcata ggagtcagca atagggactt 961 tgtggaaggt atgtcaggtg ggacttgggt tgatgttgtc ttggaacatg gaggttgtgt 1021 caccgtaatg gcacaggaca aaccgactgt cgacatagag ctggttacaa caacagtcag 1081 caacatggcg gaggtaagat cctactgcta tgaggcatca atatcggaca tggcttcgga 1141 cagccgctgc ccaacacaag gtgaagccta ccttgacaag caatcagaca ctcaatatgt 1201 ctgcaaaaga acgttagtgg acagaggctg gggaaatgga tgtggacttt ttggcaaagg 1261 gagcctggtg acatgcgcta agtttgcatg ctccaagaaa atgaccggga agagcatcca 1321 gccagagaat ctggagtacc ggataatgct gtcagttcat ggctcccagc acagtgggat 1381 gatcgttaat gacacaggac atgaaactga tgagaataga gcgaaggttg agataacgcc 1441 caattcacca agagccgaag ccaccctggg gggttttgga agcctaggac ttgattgtga 1501 accgaggaca ggccttgact tttcagattt gtattacttg actatgaata acaagcactg 1561 gttggttcac aaggagtggt tccacgacat tccattacct tggcacgctg gggcagacac 1621 cggaactcca cactggaaca acaaagaagc actggtagag ttcaaggacg cacatgccaa 1681 aaggcaaact gtcgtggttc tagggagtca agaaggagca gttcacacgg cccttgctgg 1741 agctctggag gctgagatgg atggtgcaaa gggaaggctg tcctctggcc acttgaaatg 1801 tcgcctgaaa atggataaac ttagattgaa gggcgtgtca tactccttgt gtaccgcagc 1861 gttcacattc accaagatcc cggctgaaac actgcacggg acagtcacag tggaggtaca 1921 gtacgcaggg acagatggac cttgcaaggt tccagctcag atggcggtgg acatgcaaac 1981 tctgacccca gttgggaggc tgataaccgc taaccccgta atcactgaaa gcactgagaa 2041 ctccaagatg atgctggaac ttgatccacc atttggggac tcttacattg tcataggagt 2101 cggggagaag aagatcaccc accactggca caggagtggc agcaccattg gaaaagcatt 2161 tgaagccact gtgagaggtg ccaggagaat ggcagtcttg ggagacacag cctgggactt 2221 tggatcagtt ggaggcgctc tcaactcatt gggcaagggc atccatcaaa tttttggagc 2281 agctttcaaa tcattgtttg gaggaatgtc ctggttctca caaattctca ttggaacgtt 2341 gctgatgtgg ttgggtctga acacaaagaa tggatctatt tcccttatgt gcttggcctt 2401 agggggagtg ttgatcttct tatccacagc cgtctctgct gatgtggggt gctcggtgga 2461 cttctcaaag aaggagacga gatgcggtac aggggtgttc gtctataacg acgttgaagc 2521 ctggagggac aggtacaagt accatcctga ctccccccgt agattggcag cagcagtcaa 2581 gcaagcctgg gaagatggta tctgtgggat ctcctctgtt tcaagaatgg aaaacatcat 2641 gtggagatca gtagaagggg agctcaacgc aatcctggaa gagaatggag ttcaactgac 2701 ggtcgttgtg ggatctgtaa aaaaccccat gtggagaggt ccacagagat tgcccgtgcc 2761 tgtgaacgag ctgccccacg gctggaaggc ttgggggaaa tcgtacttcg tcagagcagc 2821 aaagacaaat aacagctttg tcgtggatgg tgacacactg aaggaatgcc cactcaaaca 2881 tagagcatgg aacagctttc ttgtggagga tcatgggttc ggggtatttc acactagtgt 2941 ctggctcaag gttagagaag attattcatt agagtgtgat ccagccgtta ttggaacagc 3001 tgttaaggga aaggaggctg tacacagtga tctaggctac tggattgaga gtgagaagaa 3061 tgacacatgg aggctgaaga gggcccatct gatcgagatg aaaacatgtg aatggccaaa 3121 gtcccacaca ttgtggacag atggaataga agagagtgat ctgatcatac ccaagtcttt 3181 agctgggcca ctcagccatc acaataccag agagggctac aggacccaaa tgaaagggcc 3241 atggcacagt gaagagcttg aaattcggtt tgaggaatgc ccaggcacca aggtccacgt 3301 ggaggaaaca tgtggaacaa gaggaccatc tctgagatca accactgcaa gcggaagggt 3361 gatcgaggaa tggtgctgca gggagtgcac aatgccccca ctgtcgttcc aggctaaaga 3421 tggctgttgg tatggaatgg agataaggcc caggaaagaa ccagaaagta acttagtaag 3481 gtcaatggtg actgcaggat caactgatca catggatcac ttctcccttg gagtgcttgt 3541 gattctgctc atggtgcagg aagggctgaa gaagagaatg accacaaaga tcatcataag 3601 cacatcaatg gcagtgctgg tagctatgat cctgggagga ttttcaatga gtgacctggc 3661 taagcttgca attttgatgg gtgccacctt cgcggaaatg aacactggag gagatgtagc 3721 tcatctggcg ctgatagcgg cattcaaagt cagaccagcg ttgctggtat ctttcatctt 3781 cagagctaat tggacacccc gtgaaagcat gctgctggcc ttggcctcgt gtcttttgca 3841 aactgcgatc tccgccttgg aaggcgacct gatggttctc atcaatggtt ttgctttggc 3901 ctggttggca atacgagcga tggttgttcc acgcactgat aacatcacct tggcaatcct 3961 ggctgctctg acaccactgg cccggggcac actgcttgtg gcgtggagag caggccttgc 4021 tacttgcggg gggtttatgc tcctctctct gaagggaaaa ggcagtgtga agaagaactt 4081 accatttgtc atggccctgg gactaaccgc tgtgaggctg gtcgacccca tcaacgtggt 4141 gggactgctg ttgctcacaa ggagtgggaa gcggagctgg ccccctagcg aagtactcac 4201 agctgttggc ctgatatgcg cattggctgg agggttcgcc aaggcagata tagagatggc 4261 tgggcccatg gccgcggtcg gtctgctaat tgtcagttac gtggtctcag gaaagagtgt 4321 ggacatgtac attgaaagag caggtgacat cacatgggaa aaagatgcgg aagtcactgg 4381 aaacagtccc cggcttgatg tggcgctaga tgagagtggt gatttctccc tggtggagga 4441 tgacggtccc cccatgagag agatcatact caaggtggtc ctgatgacca tctgtggcat 4501 gaacccaata gccataccct ttgcagctgg agcgtggtac gtatacgtga agactggaaa 4561 aaggagtgga gctctatggg atgtgcctgc tcccaaggaa gtaaaaaagg gggagaccac 4621 agatggagtg tacagagtga tgactcgtag actgctaggt tcaacacaag ttggagtggg 4681 agttatgcaa gagggggtct ttcacaccat gtggcacgtc acaaaaggat ccgcgctgag 4741 aagcggtgaa gggagacttg atccatactg gggagatgtc aagcaggatc tggtgtcata 4801 ctgtggtcca tggaagctag atgccgcctg ggacgggcac agcgaggtgc agctcttggc 4861 cgtgcccccc ggagagagag cgaggaacat ccagactctg cccggaatat ttaagacaaa 4921 ggatggggac attggagcgg ttgcgctgga ttacccagca ggaacttcag gatctccaat 4981 cctagacaag tgtgggagag tgataggact ttatggcaat ggggtcgtga tcaaaaatgg 5041 gagttatgtt agtgccatca cccaagggag gagggaggaa gagactcctg ttgagtgctt 5101 cgagccttcg atgctgaaga agaagcagct aactgtctta gacttgcatc ctggagctgg 5161 gaaaaccagg agagttcttc ctgaaatagt ccgtgaagcc ataaaaacaa gactccgtac 5221 tgtgatctta gctccaacca gggttgtcgc tgccgaaatg gaggaagccc ttagagggct 5281 tccagtgcgt tatatgacaa cagcagtcaa tgtcacccac tctggaacag aaatcgtcga 5341 cttaatgtgc catgccacct tcacttcacg tctactacag ccaatcagag tccccaacta 5401 taatctgtat attatggatg aggcccactt cacagatccc tcaagtatag cagcaagagg 5461 atacatttca acaagggttg agatgggcga ggcggctgcc atcttcatga ccgccacgcc 5521 accaggaacc cgtgacgcat ttccggactc caactcacca attatggaca ccgaagtgga 5581 agtcccagag agagcctgga gctcaggctt tgattgggtg acggatcatt ctggaaaaac 5641 agtctggttt gttccaagcg tgaggaacgg caatgagatc gcagcttgtc tgacaaaggc 5701 tggaaaacgg gtcatacagc tcagcagaaa gacttttgag acagagttcc agaaaacaaa 5761 acatcaagag tgggactttg tcgtgacaac tgacatttca gagatgggcg ccaactttaa 5821 agctgaccgt gtcatagatt ccaggagatg cctaaagccg gtcatacttg atggcgagag 5881 agtcattctg gctggaccca tgcctgtcac acatgccagc gctgcccaga ggagggggcg 5941 cataggcagg aatcccaaca aacctggaga tgagtatctg tatggaggtg ggtgcgcaga 6001 gactgacgaa gaccatgcac actggcttga agcaagaatg ctccttgaca atatttacct 6061 ccaagatggc ctcatagcct cgctctatcg acctgaggcc gacaaagtag cagccattga 6121 gggagagttc aagcttagga cggagcaaag gaagaccttt gtggaactca tgaaaagagg 6181 agatcttcct gtttggctgg cctatcaggt tgcatctgcc ggaataacct acacagatag 6241 aagatggtgc tttgatggca cgaccaacaa caccataatg gaagacagtg tgccggcaga 6301 ggtgtggacc agacacggag agaaaagagt gctcaaaccg aggtggatgg acgccagagt 6361 ttgttcagat cacgcggccc tgaagtcatt caaggagttt gccgctggga aaagaggagc 6421 ggcttttgga gtgatggaag ccttgggaac actgccagga cacatgacag agagattcca 6481 ggaagccatt gacaacctcg ctgtgctcat gcgggcagag actggaagca ggccttacaa 6541 agccgcggcg gcccaattgc cggagaccct agagaccatt atgcttttgg ggttgctggg 6601 aacagtctcg ctgggaatct ttttcgtctt gatgaggaac aagggcatag ggaagatggg 6661 ctttggaatg gtgactcttg gggccagcgc atggctcatg tggctctcgg aaattgagcc 6721 agccagaatt gcatgtgtcc tcattgttgt gttcctattg ctggtggtgc tcatacctga 6781 gccagaaaag caaagatctc cccaggacaa ccaaatggca atcatcatca tggtagcagt 6841 aggtcttctg ggcttgatta ccgccaatga actcggatgg ttggagagaa caaagagtga 6901 cctaagccat ctaatgggaa ggagagagga gggggcaacc ataggattct caatggacat 6961 tgacctgcgg ccagcctcag cttgggccat ctacgctgcc ttgacaactt tcattacccc 7021 agccgtccaa catgcagtga ccacttcata caacaactac tccttaatgg cgatggccac 7081 gcaagctgga gtgttgtttg gtatgggcaa agggatgcca ttctacgcat gggactttgg 7141 agtcccgctg ctaatgatag gttgctactc acaattaaca cccctgaccc taatagtagc 7201 catcattttg ctcgtggcgc actacatgta cttgatccca gggctgcagg cagcagctgc 7261 gcgtgctgcc cagaagagaa cggcagctgg catcatgaag aaccctgttg tggatggaat 7321 agtggtgact gacattgaca caatgacaat tgacccccaa gtggagaaaa agatgggaca 7381 ggtgctactc atagcagtag ccgtctccag cgccatactg tcgcggaccg cctgggggtg 7441 gggggaggct ggggccctga tcacagctgc aacttccact ttgtgggaag gctctccgaa 7501 caagtactgg aactcctcta cagccacttc actgtgtaac atttttaggg gaagttactt 7561 ggctggagct tctctaatct acacagtaac aagaaacgct ggcttggtca agagacgtgg 7621 gggtggaaca ggagagaccc tgggagagaa atggaaggcc cgcttgaacc agatgtcggc 7681 cctggagttc tactcctaca aaaagtcagg catcaccgag gtgtgcagag aagaggcccg 7741 ccgcgccctc aaggacggtg tggcaacggg aggccatgct gtgtcccgag gaagtgcaaa 7801 gctgagatgg ttggtggagc ggggatacct gcagccctat ggaaaggtca ttgatcttgg 7861 atgtggcaga gggggctgga gttactacgc cgccaccatc cgcaaagttc aagaagtgaa 7921 aggatacaca aaaggaggcc ctggtcatga agaacccatg ttggtgcaaa gctatgggtg 7981 gaacatagtc cgtcttaaga gtggggtgga cgtctttcat atggcggctg agccgtgtga 8041 cacgttgctg tgtgacatag gtgagtcatc atctagtcct gaagtggaag aagcacggac 8101 gctcagagtc ctttccatgg tgggggattg gcttgaaaaa agaccaggag ccttttgtat 8161 aaaagtgttg tgcccataca ccagcactat gatggaaacc ctggagcgac tgcagcgtag 8221 gtatggggga ggactggtca gagtgccact ctcccgcaac tctacacatg agatgtactg 8281 ggtctctgga gcgaaaagca acaccataaa aagtgtgtcc accacgagcc agctcctctt 8341 ggggcgcatg gacgggccca ggaggccagt gaaatatgag gaggatgtga atctcggctc 8401 tggcacgcgg gctgtggtaa gctgcgctga agctcccaac atgaagatca ttggtaaccg 8461 cattgaaagg atccgcagtg agcacgcgga aacgtggttc tttgacgaga accacccata 8521 taggacatgg gcttaccatg gaagctatga ggcccccaca caagggtcag cgtcctctct 8581 aataaacggg gttgtcaggc tcctgtcaaa accctgggat gtggtgactg gagtcacagg 8641 aatagccatg accgacacca caccgtatgg tcagcaaaga gttttcaagg aaaaagtgga 8701 cactagggtg ccagatcccc aagaaggcac tcgtcaggtt atgagcatgg tctcttcctg 8761 gttgtggaaa gagctaggca aacacaaacg gccacgagtc tgtaccaaag aagagttcat 8821 caacaaggtt cgtagcaatg cagcattagg ggcaatattt gaagaggaaa aagagtggaa 8881 gactgcagtg gaagctgtga acgatccaag gttctgggct ctagtggaca aggaaagaga 8941 gcaccacctg agaggagagt gccagagttg tgtgtacaac atgatgggaa aaagagaaaa 9001 gaaacaaggg gaatttggaa aggccaaggg cagccgcgcc atctggtata tgtggctagg 9061 ggctagattt ctagagttcg aagcccttgg attcttgaac gaggatcact ggatggggag 9121 agagaactca ggaggtggtg ttgaagggct gggattacaa agactcggat atgtcctaga 9181 agagatgagt cgcataccag gaggaaggat gtatgcagat gacactgctg gctgggacac 9241 ccgcatcagc aggtttgatc tggagaatga agctctaatc accaaccaaa tggagaaagg 9301 gcacagggcc ttggcattgg ccataatcaa gtacacatac caaaacaaag tggtaaaggt 9361 ccttagacca gctgaaaaag ggaagacagt tatggacatt atttcgagac aagaccaaag 9421 ggggagcgga caagttgtca cttacgctct taacacattt accaacctag tggtgcaact 9481 cattcggagt atggaggctg aggaagttct agagatgcaa gacttgtggc tgctgcggag 9541 gtcagagaaa gtgaccaact ggctgcagag caacggatgg gataggctca aacgaatggc 9601 agtcagtgga gatgattgcg ttgtgaggcc aattgatgat aggtttgcac atgccctcag 9661 gttcttgaat gatatgggga aagttaggaa ggacacacaa gagtggaaac cctcaactgg 9721 atgggacaac tgggaggaag ttccgttttg ctcccaccac ttcaacaagc tccatctcaa 9781 ggacgggagg tccattgtgg ttccctgccg ccaccaagat gaactgattg gccgggcccg 9841 cgtctctcca ggggcgggat ggagcatccg ggagactgct tgcctagcaa aatcatatgc 9901 gcaaatgtgg cagctccttt atttccacag aagggacctc cgactgatgg ccaatgccat 9961 ttgttcatct gtgccagttg actgggttcc aactgggaga actacctggt caatccatgg 10021 aaagggagaa tggatgacca ctgaagacat gcttgtggtg tggaacagag tgtggattga 10081 ggagaacgac cacatggaag acaagacccc agttacgaaa tggacagaca ttccctattt 10141 gggaaaaagg gaagacttgt ggtgtggatc tctcataggg cacagaccgc gcaccacctg 10201 ggctgagaac attaaaaaca cagtcaacat ggtgcgcagg atcataggtg atgaagaaaa 10261 gtacatggac tacctatcca cccaagttcg ctacttgggt gaagaagggt ctacacctgg 10321 agtgctgtaa gcaccaactt tagtgttgtc aggcctgcta gtcagccaca gcttggggaa 10381 agctgtgcag cctgtgaccc ccccaggaga agctgggaaa ccaagcctat agtcaggccg 10441 agaacgccat ggcacggaag aagccatgct gcctgtgagc ccctcagagg acactgagtc 10501 aaaaaacccc acgcgcttgg aggcgcagga tgggaaaaga aggtggcgac cttccccacc 10561 cttcaatctg gggcctgaac tggagatcag ctgtggatct ccagaagagg gactagtggt 10621 tagaggagac cccccggaaa acgcaaaaca gcatattgac gctgggaaag accagagact 10681 ccatgagttt ccaccacgct ggccgccag
-
Wuhan Institute released full Zika sequence of Shenzhen ex-American Samoa, SZ-WIV01, grown in mosquito cell line.
-
Map Update https://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kT4qLMXp3SLU&hl=en
-
Salt Lake County woman with Zika gives birth, baby healthyPrintFont [+] [-]Leave a comment »By Daphne Chen, Deseret News Published: Friday, April 8 2016 5:15 p.m. MDT Updated: 2 hours ago Share1 Share1 Tweet0 0 0View 2 photos »A Salt Lake County woman who was infected with Zika virus gave birth in late March, the Salt Lake County Health Department announced Friday. The baby has tested negative for Zika and is healthy, according to a department spokeswoman. Adobe stock photo SummaryA Salt Lake County woman who was infected with Zika virus gave birth in late March, the Salt Lake County Health Department announced Friday. The baby has tested negative for Zika and is healthy, according to a department spokeswoman. SALT LAKE CITY — A Salt Lake County woman who was infected with Zika virus gave birth to a healthy baby in late March, the Salt Lake County Health Department announced Friday. Spokeswoman Pam Davenport said the baby tested negative for the Zika virus. This is the second Zika case in Salt Lake County. In March, a child who had recently traveled to an affected country also tested positive for the virus. According to Davenport, the Salt Lake County woman had traveled to a region that was affected by the virus while pregnant. Davenport said the woman found out she was infected after getting tested, in accordance with CDC guidelines. The health department is not releasing further information about the woman or infant due to privacy concerns. Dr. Dagmar Vitek, the Salt Lake County Health Department medical officer, said in a statement that the outcome "of this particular situation is a good one." But he said the situation is a strong reminder that women traveling to affected regions should take precautions to protect themselves from mosquitos. The mosquito-borne virus has stoked fears internationally due to the virus' link with severe birth defects in children in Brazil and other South American and Central American countries. Experts say the virus is unlikely to take hold in Utah due to its cold and dry climate, but it could circulate in the warmer parts of the southern U.S. As of April 6, 346 travel-associated Zika cases have been reported in the U.S., according to the CDC. None were locally acquired. The CDC has posted travel notices for Mexico, the Caribbean, Central America, the Pacific Islands, South America and the 2016 Summer Olympics in Brazil. People traveling to those areas are urged to protect themselves against mosquitos; women who are or may become pregnant are being asked to take extra precautions. Because of evidence the Zika virus can also be transmitted through semen, the CDC is advising people who may have been exposed to wait at least eight weeksto attempt to conceive. It is recommended that travelers visit a travel clinic in advance of their trip. Appointments at the Salt Lake County Health Department Travel Clinic can be made by calling 385-468-4111. Email: [email protected] http://www.deseretnews.com/article/865651851/Salt-Lake-County-woman-with-Zika-gives-birth-baby-healthy.html?pg=all
-
Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
-
A Salt Lake County woman who was infected with the Zika virus has given birth to a healthy baby, according to a news release from the Salt Lake County Health Department. The infant tested negative for the Zika virus, despite the mother testing positive. http://fox13now.com/2016/04/08/salt-lake-co-woman-infected-with-zika-virus-gives-birth/
-
Confirmed four cases of microcephaly associated with zika in Panama 0 April 8, 2016Panama City, April 8 (dpa) - Four cases of microcephaly registered in Panama are linked to the Zika virus, which infected 201 people in the country, said today the director of the Gorgas Memorial Institute for Health Studies (ICGES ), Nestor Sosa. The viral disease was registered in this country in 2015 and from there the cases have been increasing. Zika common symptoms are fever, rash, joint pain or conjunctivitis (red eyes). Other symptoms include muscle pain and headache, although there are asymptomatic patients. Sosa told local radio station RPC Radio that microcephaly "is a reality in the country" and issued a call for pregnant women to keep their homes clean and eliminate breeding places of Aedes aegypti mosquito, which transmits zika. Also, the director of ICGES urged men who have the disease to protect themselves for six months using condoms, because scientific studies warn about the possible transmission of the virus through sex. In March, the Ministry of Health confirmed the death of a baby with microcephaly, which became the first case of this type associated with the Zika virus in Panama. Epidemiological authorities revealed in March that was a first case of Guillain-Barré syndrome in an adult, presumably related to Zika virus. http://sumarium.us/2016/04/08/confirman-cuatro-casos-de-microcefalia-asociados-al-zika-en-panama/
-
Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
-
Confirmed Cases of Zika in California, 2015-2016 (as of April 8, 2016) County Travel-associated cases* Locally acquired cases† Alameda 2 0 Contra Costa 3 0 Los Angeles 7 0 Napa 1 0 Orange 2 0 San Bernardino 2 0 San Diego 9** 0 San Francisco 1 0 San Joaquin 1 0 San Mateo 2 0 Santa Clara 1 0 Yolo 2 0 Total 33 0
-
Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
-
April 8, 2016 DEPARTMENT OF HEALTH DAILY ZIKA UPDATE: TWO NEW TRAVEL-RELATED CASES TODAY IN PALM BEACH AND BROWARD COUNTIES Contact:Communications [email protected](850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the Florida Department of Health will issue a Zika virus update each week day at 2 p.m. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. There are two new travel-related cases today with one in Palm Beach County and one in Broward County. Of the cases confirmed in Florida, seven cases are still exhibiting symptoms. According to the CDC, symptoms associated with the Zika virus last between seven to 10 days. Based on CDC guidance, several pregnant women who have traveled to countries with local-transmission of Zika have received antibody testing, and of those, five have tested positive for the Zika virus. The CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. It is recommended that women who are pregnant or thinking of becoming pregnant postpone travel to Zika affected areas. County Number of Cases (all travel related) Alachua 4 Brevard 2 Broward 13 Clay 1 Collier 1 Hillsborough 3 Lee 3 Miami-Dade 33 Orange 5 Osceola 4 Palm Beach 4 Polk 3 Santa Rosa 1 Seminole 1 St. Johns 1 Cases involving pregnant women* 5 Total 84 *Counties of pregnant women will not be shared. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 1,319 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. All cases are travel-associated. There have been no locally-acquired cases of Zika in Florida. For more information on the Zika virus, click here. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. More Information on DOH action on Zika: On Feb. 3, Governor Scott directed the State Surgeon General to issue a Declaration of Public Health Emergency for the counties of residents with travel-associated cases of Zika.The Declaration currently includes the 15 affected counties – Alachua, Brevard, Broward, Clay, Collier, Hillsborough, Lee, Miami-Dade, Orange, Osceola, Palm Beach, Polk, Santa Rosa, Seminole and St. Johns – and will be updated as needed. DOH encourages Florida residents and visitors to protect themselves from all mosquito-borne illnesses by draining standing water; covering their skin with repellent and clothing; and covering windows with screens.DOH has a robust mosquito-borne illness surveillance system and is working with the CDC, the Florida Department of Agriculture and Consumer Services and local county mosquito control boards to ensure that the proper precautions are being taken to protect Florida residents and visitors.On April 6, Governor Rick Scott and Interim State Surgeon General Dr. Celeste Philip hosted a conference call with Florida Mosquito Control Districts to discuss ongoing preparations to fight the possible spread of the Zika virus in Florida. There were 74 attendees on the call.Florida currently has the capacity to test 6,836 people for active Zika virus and 1,603 for Zika antibodies.Federal Guidance on Zika: According to the CDC, Zika illness is generally mild with a rash, fever and joint pain. CDC researchers are examining a possible link between the virus and harm to unborn babies exposed during pregnancy.The FDA released guidance regarding donor screening, deferral and product management to reduce the risk of transfusion-transmission of Zika virus. Additional information is available on the FDA website here.The CDC has put out guidance related to the sexual transmission of the Zika virus. This includes the CDC recommendation that if you have traveled to a country with local transmission of Zika you should abstain from unprotected sex.For more information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov. http://www.floridahealth.gov/newsroom/2016/04/040816-zika-update.html
-
County Number of Cases (all travel related) Alachua 4 Brevard 2 Broward 13 Clay 1 Collier 1 Hillsborough 3 Lee 3 Miami-Dade 33 Orange 5 Osceola 4 Palm Beach 4 Polk 3 Santa Rosa 1 Seminole 1 St. Johns 1 Cases involving pregnant women* 5 Total 84
-
Zika Confirmed Cases County Cases* Clallam1Mason1Washington State Total 2* Confirmed travel-associated cases in WA as of 4/4/16
-
Zika Virus – April 8, 2016. Texas has had 27 confirmed cases of Zika virus disease. Of those, 26 were in travelers who were infected abroad and diagnosed after they returned home; one of those travelers was a pregnant woman. One case involved a Dallas County resident who had sexual contact with someone who acquired the Zika infection while traveling abroad. Case counts by county: Bexar – 3Dallas – 4Fort Bend – 2Grayson – 1Harris – 11Tarrant – 3Travis – 2Wise – 1
-
Boca Raton woman with Zika virus disappointed in hospital careLOCALBy Alexandra Seltzer - Palm Beach Post Staff Writer 0 Zika patient speaks out, calls testing stressfulWPTV - West Palm, FL Updated: 12:41 p.m. Friday, April 8, 2016 | Posted: 6:31 a.m. Friday, April 8, 2016 The sister of a 36-year-old Boca Raton woman who has the Zika virus says she is disappointed in the care she received from Boca Raton Regional Hospital. Ibana Villasenor says her sister, who asked that her name not be used, first went to the hospital on March 31 and was discharged Monday. She came back Wednesday and was again discharged, she said. On Thursday, the sister was notified that test results came back positive forZika, which has been linked to microcephaly, a condition resulting in abnormally small heads and brain damage in newborns. She likely contracted the virus during a recent trip to South America. “Now this is an emergency. What happened before when they tried to release her at the worst state of her illness?” Villasenor told The Palm Beach Post on Friday. The hospital issued this statement dated April 7 from Charles Posternack, its chief medical officer: +In this undated file photo provided by the USDA, an aedes aegypti mosquito is shown on human skin.“This morning, we were informed that a patient who was admitted to our hospital last week and subsequently discharged, has tested positive for the Zika Virus. The hospital was following all appropriate CDC and Palm Beach County Healthguidelines for the appropriate screening of the Zika and other viral diseases. Once confirmed, the results were communicated to one of the Infectious Disease physicians on our medical staff, for follow up in his office.” The Florida Department of Health on Wednesday said there are three cases of Zika in Palm Beach County. All three have been confirmed in the past week — the first was announced March 30 and the second Tuesday. So far, there are 82 cases in the state, by far the most in the nation, which had 346 confirmed cases as of Wednesday, according to the federal Centers for Disease Control and Prevention. Of those 82 cases in Florida, six are still exhibiting symptoms. Five of the cases involve pregnant women. +The aedes aegypti mosquito carries the Zika virus and other diseases.All cases in the country involve people who contracted the virus while traveling outside of the U.S. Villasenor’s sister recently went to Colombia, where she is from, for her grandfather’s funeral. She returned to Boca Raton on March 28 and felt ill. “Her symptoms were she felt weak and like she was going to pass out,” Villasenor said. Villasenor said she didn’t want her sister, who doesn’t have health insurance, to be released. Throughout the past several days, her sister has felt so weak that she couldn’t open a water bottle. She’s been exhausted and dehydrated, Villasenor said. “Why didn’t they just let her stay in the hospital until they knew what type of virus there was?” she said. Villasenor also questioned why it took so long for the test results to come back. The hospital follows CDC protocol and Florid Department of Health guidelines, spokeswoman Alexandra Schilling said. http://www.mypalmbeachpost.com/news/news/local/report-zika-virus-victim-describes-bout-with-disea/nq2df/ “I want them to have better protocols. Doctors have to have training in this. This is a disease that’s going to be very common,” Villasenor said. The state has created a hotline for questions about the Zika virus at 850-245-4111.
-
Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
-
Video: Zika virus victim describes bout with disease 6:31 a.m. Friday, April 8, 2016 | Filed in: Southern PBCCOMMENTS 0Zika patient speaks out, calls testing stressfulWPTV - West Palm, FL WPTV NewsChannel 5, The Post’s news partner, reported Friday that it has spoken with a Palm Beach County woman who has contracted the Zika virus and worked with doctors at Boca Raton Regional Hospital to treat the disease. The mosquito-born virus has been linked to microcephaly, a condition resulting in abnormally small heads and brain damage in newborns. The aedes aegypti mosquito carries the Zika virus and other diseases.Click here to read the latest breaking news from The Post. ADVERTISINGFlorida has 82 cases, the Florida Department of Health said Thursday. That is by far the leader in the U.S., which had 346 cases as of Wednesday, according to the federalCenters for Disease Control and Prevention. Three of those cases are in Palm Beach County. All of Florida’s cases are related to travel to areas where the disease is rampant, such as South America and the Caribbean. Five of those cases have contracted the virus while pregnant, according to health officials. The woman, whom WPTV did not identify, told the TV station she contracted the virus while traveling to attend a family funeral in Colombia. Mosquitoes were everywhere, she said. The woman told WPTV she began having chills and a fever on her way home and then developed a rash. Doctors at Boca Raton Regional Hospital acknowledged to WPTV that it had treated the woman. http://www.palmbeachpost.com/news/news/local/report-zika-virus-victim-describes-bout-with-disea/nq2df/
-
Belize wary over US suspicion woman caught Zika on tripApril 8, 2016The government of Belize issued a statement Thursday saying it was treating with caution information from US health authorities that a woman who was recently in the country caught Zika there. "The ministry of health at this time is not confirming that this is the first case of Zika in Belize," the statement said. "We are presently in communication with officials from the CDC (the US Centers for Disease Control and Prevention) and the Pan American Health Organization Office in Belize to get more information in order to launch a proper epidemiological investigation." According to the statement from Belize's health ministry, US authorities got in touch on Wednesday to say a woman who visited Belize March 14-19 came down with a rash on March 23 and a Zika infection was confirmed. The woman, who was not identified, had not traveled elsewhere recently and there was "no evidence of sexual transmission." Zika is a mosquito-borne virus that has been linked to a surge of birth defects in Brazil and paralysis in some other cases. It is usually transmitted by female Aedes aegypti mosquitoes, but some rare cases of transmission through sex have also been recorded. Outbreaks have occurred in 34 countries throughout the Americas and the Caribbean, according to the CDC website. Belize, a small Central American country next to Guatemala, was not on the CDC's list. http://medicalxpress.com/news/2016-04-belize-wary-suspicion-woman-caught.html
-
World | Fri Apr 8, 2016 8:15am ISTRelated: WORLDSt. Lucia confirms first two cases of Zika, contracted locallyCASTRIES, ST. LUCIA, | BY SARAH PETER An edes aegypti mosquito is seen inside a test tube as part of a research on preventing the spread of the Zika virus and other mosquito-borne diseases at a control and prevention center in Guadalupe, neighbouring Monterrey, Mexico, in this March 8, 2016 file photo.REUTERS/DANIEL BECERRIL/FILES A man and a woman in the Caribbean country of St. Lucia have locally contracted the Zika virus, which has been linked to hundreds of cases of a rare birth defect in Brazil, the first infections by the mosquito-borne virus in the island nation, its health ministry said on Thursday. The Caribbean Public Health Agency (CARPHA) has confirmed the cases, the Ministry of Health said at a news conference, noting that the individuals had no history of recent travel to a Zika affected country. "We have increased our surveillance within our health system to ensure the timely diagnosis," said Sharon Belmar George, senior medical officer at the ministry. "There are so far two cases of the Zika virus disease on the island." The Zika outbreak is affecting large parts of Latin America and the Caribbean, with Brazil the hardest hit so far. Tourism-dependent Caribbean countries are concerned that the virus will impact their economies. Hotels and travel companies operating there have reported moderate cancellations because of Zika, and some have offered discounts or agreed to allow travelers to defer trips. Zika has not been proven to cause the birth defect microcephaly, but there is growing evidence that suggests a link. The condition is defined by unusually small heads that could result in developmental problems. Brazil said it has confirmed more than 900 cases of microcephaly, and considers most of them to be related to Zika infections in the mothers. (Reporting by Sarah Peter; Writing by Frank Jack Daniel; Editing by Richard Chang) http://in.reuters.com/article/health-zika-stlucia-idINKCN0X5071
-
Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
-
ZIKA VIRUS: Second Inland case confirmed in San Bernardino CountyBy SUZANNE HURT / STAFF WRITER Published: April 7, 2016 Updated: 3:15 p.m. By DAVID GOLDMAN, ASSOCIATED PRESSA second Inland resident has been confirmed to have the Zika virus, a county health department spokeswoman said Thursday, April 7. Another person living in San Bernardino County has tested positive for the virus the second case in the Inland region, said spokeswoman Claudia Doyle The person’s gender, age and hometown, and whether the virus was picked up while traveling, was not available. San Bernardino County’s Department of Public Health did not provide any other information about the latest case, Doyle said. The county reported its first confirmed case of Zika on March 11. That case involved a woman who returned from South America in January. No other information was made available by the county. The second resident also became infected while traveling outside the U.S. The residents live in Colton and Rancho Cucamonga, Doyle said. http://www.pe.com/articles/inland-799185-second-confirmed.html
-
A second Inland resident has been confirmed to have the Zika virus, a county health department spokeswoman said Thursday, April 7. Another person living in San Bernardino County has tested positive for the virus the second case in the Inland region, said spokeswoman Claudia Doyle The person’s gender, age and hometown, and whether the virus was picked up while traveling, was not available. http://www.pe.com/articles/inland-799185-second-confirmed.html
-
Map update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
-
The Shelby County Health Department has confirmed its first case of the Zika virus. According to the department, the person recently traveled to one of the affected areas. http://wreg.com/2016/04/07/first-case-of-zika-virus-confirmed-in-shelby-county/