niman

Zika Virus InformationAs of April 1, 2016 there are no confirmed cases of Zika virus in South Carolina.

Confirmed Cases of Zika in California, 2015-2016 (as of April 1, 2016) County Travel-associated cases* Locally acquired cases† Alameda 2 0 Contra Costa 3 0 Los Angeles 7 0 Napa 1 0 Orange 2 0 San Bernardino 1 0 San Diego 9** 0 San Francisco 1 0 San Joaquin 1 0 San Mateo 1 0 Santa Clara 1 0 Yolo 1 0 Total 30 0

Map Updated https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU

Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU

Confirmed Cases of Zika in California, 2015-2016 (as of March 25, 2016) County Travel-associated cases* Locally acquired cases† Alameda 1 0 Contra Costa 3 0 Los Angeles 5 0 Napa 1 0 Orange 1 0 San Bernardino 1 0 San Diego 7** 0 San Francisco 1 0 San Joaquin 1 0 Yolo 1 0 Total 22 0

Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU

As of April 1, 201611 confirmed travel-related Zika cases in Georgiahttp://dph.georgia.gov/

As of April 1, 201611 confirmed travel-related Zika cases in Georgia

Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU

April 1, 2016 DEPARTMENT OF HEALTH DAILY ZIKA UPDATE: THREE NEW TRAVEL-RELATED CASES TODAY Contact:Communications [email protected](850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the Florida Department of Health will issue a Zika virus update each week day at 2 p.m. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. There are three new travel-related cases today with one in Polk County, one in Broward County and one involving a pregnant woman. Of the cases confirmed in Florida, four cases are still exhibiting symptoms. According to the CDC, symptoms associated with the Zika virus last between seven to 10 days. Today, Interim State Surgeon General Dr. Celeste Philip is leading a ten-member delegation made up of representatives from the Florida Department of Health, Department of Agriculture and Consumer Services and local Mosquito Control Districts to the U.S. ZIka Action Plan Summit hosted by the CDC. Media may register to watch the summit webcast remotely. Portions of the summit will be broadcast live on the web from 8:30 a.m. to 3 p.m. EDT. Based on CDC guidance, several pregnant women who have traveled to countries with local-transmission of Zika have received antibody testing, and of those, five have tested positive for the Zika virus. The CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. It is recommended that women who are pregnant or thinking of becoming pregnant postpone travel to Zika affected areas. County Number of Cases (all travel related) Alachua 4 Brevard 2 Broward 12 Clay 1 Collier 1 Hillsborough 3 Lee 3 Miami-Dade 32 Orange 5 Osceola 4 Palm Beach 1 Polk 3 Santa Rosa 1 Seminole 1 St. Johns 1 Cases involving pregnant women* 5 Total 79 *Counties of pregnant women will not be shared. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 1,249 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. All cases are travel-associated. There have been no locally-acquired cases of Zika in Florida. For more information on the Zika virus, click here. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. More Information on DOH action on Zika: On Feb. 3, Governor Scott directed the State Surgeon General to issue a Declaration of Public Health Emergency for the counties of residents with travel-associated cases of Zika.The Declaration currently includes the 15 affected counties – Alachua, Brevard, Broward, Clay, Collier, Hillsborough, Lee, Miami-Dade, Orange, Osceola, Palm Beach, Polk, Santa Rosa, Seminole and St. Johns – and will be updated as needed. DOH encourages Florida residents and visitors to protect themselves from all mosquito-borne illnesses by draining standing water; covering their skin with repellent and clothing; and covering windows with screens.DOH has a robust mosquito-borne illness surveillance system and is working with the CDC, the Florida Department of Agriculture and Consumer Services and local county mosquito control boards to ensure that the proper precautions are being taken to protect Florida residents and visitors.Florida currently has the capacity to test 3,979 people for active Zika virus and 1,677 for Zika antibodies.Federal Guidance on Zika: According to the CDC, Zika illness is generally mild with a rash, fever and joint pain. CDC researchers are examining a possible link between the virus and harm to unborn babies exposed during pregnancy.The FDA released guidance regarding donor screening, deferral and product management to reduce the risk of transfusion-transmission of Zika virus. Additional information is available on the FDA website here.The CDC has put out guidance related to the sexual transmission of the Zika virus. This includes the CDC recommendation that if you have traveled to a country with local transmission of Zika you should abstain from unprotected sex.For more information on Zika virus, click here. About the Florida Department of Health The department works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov. http://www.floridahealth.gov/newsroom/2016/04/040116-zika-update.html

County Number of Cases (all travel related) Alachua 4 Brevard 2 Broward 12 Clay 1 Collier 1 Hillsborough 3 Lee 3 Miami-Dade 32 Orange 5 Osceola 4 Palm Beach 1 Polk 3 Santa Rosa 1 Seminole 1 St. Johns 1 Cases involving pregnant women* 5 Total 79 *Counties of pregnant women will not be shared.

Zika Virus – April 1, 2016. Texas has had 27 confirmed cases of Zika virus disease. Of those, 26 were in travelers who were infected abroad and diagnosed after they returned home; one of those travelers was a pregnant woman. One case involved a Dallas County resident who had sexual contact with someone who acquired the Zika infection while traveling abroad. Case counts by county: Bexar – 3Dallas – 4Fort Bend – 2Grayson – 1Harris – 11Tarrant – 3Travis – 2Wise – 1

White House convenes summit on Zika virus Liz Szabo, USA TODAY10:39 a.m. EDT April 1, 2016(Photo: Mark Simons, Purdue University) CONNECTTWEETLINKEDINCOMMENTEMAILMOREThe White House convened a summit Friday about how to fight the Zika virus, urging state, local and national officials to act now to prevent and control the disease. "If we wait until we see widespread transmission in the United States, if we wait until the public is panicking because they're seeing babies born with birth defects, we will have waited too late," said Amy Pope, the White House deputy homeland security adviser and deputy assistant to President Barack Obama. USA TODAY Zika Virus: Full coverage The nation's highest priority should be to protect pregnant women and their fetuses, said Thomas Frieden, director of the Centers for Disease Control and Prevention in Atlanta, which hosted the summit. The Zika virus is now strongly linked to "catastrophic" birth defects, including microcephaly, in which babies are born with abnormally small heads, Frieden said. In this photo, Thomas Frieden, director of the Centers for Disease Control and Prevention, speaks to Congress. He spoke to state and local health leaders Friday about ways to prevent the spread of Zika. (Photo: MICHAEL REYNOLDS, EPA) "We need urgent action from all of us to minimize the risk to pregnant women," said Denise Jamieson, medical officer in the CDC's division of reproductive health. Open GalleryFacebookTwitterGoogle+LinkedInZika virus: Heartbreaking images of birth defects Fullscreen Jose Wesley, who screams uncontrollably for long stretches, is attended to in Bonito, Pernambuco state, Brazil. Felipe Dana, APFullscreen1 of 22 Next Slide22 PhotosZika virus: Heartbreaking images of birth defects The mosquitoes that spread Zika virus live across much of the USA and are especially common in Florida, Texas and Hawaii, which have had outbreaks of related mosquito-borne viruses. The mosquitoes have dramatically expanded their range in recent year and now live even in dry areas, such as Los Angeles. More than 300 U.S. travelers have been infected with the virus after returning from Zika-affected areas and another 349 have been diagnosed in Puerto Rico, where the disease is spreading among local mosquitoes. The White House has asked Congress for $1.9 billion to fight the Zika virus at home and abroad. Congressional Republicans have resisted providing that funding, arguing that the USA should use unspent Ebola money instead. USA TODAY Zika Q&A: Growing evidence links virus to major birth defects ZIKA VIRUS IN THE NEWSAP: Insecticide Shipments Stopped As Zika Spread | 02:38An Associated Press investigation has found that Brazil's fight against Zika was hampered last fall because the Health Ministry ran out of larvicide. Shipments across the country were suspended between August and October. (March 18) AP http://www.usatoday.com/story/news/2016/04/01/white-house-convenes-summit-zika-virus/82507082/

Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome192541925499%0.0100%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome192301923099%0.099%KU321639.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds191131911399%0.099%KU729218.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome191001910099%0.099%KU926309.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds190981909899%0.099%KU365779.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome190971909799%0.099%KU940228.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome190951909599%0.099%KU707826.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome190911909199%0.099%KU527068.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds190891908999%0.099%KU365780.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds190801908099%0.099%KU365777.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome190771907799%0.099%KU497555.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome190731907399%0.099%KU926310.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome190701907099%0.099%KU501215.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome190681906899%0.099%KU870645.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds190641906499%0.099%KU365778.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds190591905999%0.099%KU729217.2Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds190571905799%0.099%KJ776791.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome190371903799%0.099%KU820899.2Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds190171901799%0.099%KU647676.1Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds190011910299%0.099%KU820897.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome189991899999%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome189941899499%0.099%KU922923.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome189881898899%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome189871898799%0.099%KU853012.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome189871898799%0.099%KU744693.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds188891888999%0.099%KU740184.2Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds188861888698%0.099%KU955590.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds188711887199%0.099%KU955589.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome188421884298%0.099%KU940224.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome187851878599%0.099%KU681081.3Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds185771857797%0.099%KU761564.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds185651856597%0.099%KU312312.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome184781847899%0.098%KU955593.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds183991839996%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds183931839396%0.099%KU501216.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds183631836396%0.099%KU820898.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds182361823696%0.099%KU866423.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome181751817599%0.098%KU681082.3Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177981779896%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds177511775194%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds176431764396%0.098%EU545988.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164661646696%0.096%HQ234499.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds139121391299%0.089%KU720415.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds139011390199%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds138921389299%0.089%KF268948.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome138901389099%0.089%KU955595.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID138901389099%0.089%LC002520.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds138851388599%0.089%KF268950.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome138811388199%0.089%KU955592.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome138741387499%0.089%KU955594.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome138581385899%0.089%KU955591.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome138311383199%0.089%AY632535.2Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds132791327996%0.089%KF383115.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds132751327596%0.089%HQ234498.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds132661326696%0.089%DQ859059.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds132631326396%0.089%KF383119.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds132211322196%0.089%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132141321496%0.089%HQ234501.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds131421314296%0.088%KF383117.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131351313596%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds129401300896%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128611286193%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108441084493%0.084%KF383120.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome50651501587%0.095%KU940227.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds5059505926%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds5034503426%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4664466424%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4655465524%0.099%KU646827.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3443344318%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3220322016%0.099%KU740199.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds2879419791%0.071%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2700270014%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2224222411%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2030203010%0.099%KU179098.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds176117619%0.0100%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds175717579%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds175517559%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds175417549%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds175417549%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds175417549%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds175217529%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds161116118%0.0100%KJ873160.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds142914297%0.0100%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds139113917%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds135513557%0.098%KM851038.1Select seq gb|KU985087.1|Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds135313537%0.099%KU985087.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds134613467%0.099%KU556802.1Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds130613069%0.088%AF013415.1Select seq gb|KT200609.1|Zika virus isolate BR/949/15 NS5 gene, partial cds124512456%0.099%KT200609.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds124012406%0.099%KU232300.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds123112316%0.099%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds122912296%0.099%KU232297.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds122012206%0.099%KU232294.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds121812186%0.099%KU232292.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds121412146%0.099%KU232298.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds121112116%0.099%KU232296.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds121112116%0.099%KU232293.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds120512056%0.099%KU232295.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds119511956%0.099%KU232288.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds119111916%0.099%KU232289.1

LOCUS KU509998 10677 bp RNA linear VRL 30-MAR-2016 DEFINITION Zika virus strain Haiti/1225/2014, complete genome. ACCESSION KU509998 VERSION KU509998.2 GI:1012306669 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10677) AUTHORS Lednicky,J.A., Morris,J.G. Jr., Beau De Rochars,V.M., Elbadry,M.A., Okech,B.A. and Loeb,J.C. TITLE Zika virus from a Haitian, December 2014 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10677) AUTHORS Lednicky,J.A., Morris,J.G. Jr., Beau De Rochars,V.M., Elbadry,M.A., Okech,B.A. and Loeb,J.C. TITLE Direct Submission JOURNAL Submitted (10-JAN-2016) Environmental and Global Health, University of Florida - Gainesville, 1225 Center Drive, Room 4155, Gainesville, FL 32610, USA REFERENCE 3 (bases 1 to 10677) AUTHORS Lednicky,J.A., Morris,J.G. Jr., Beau De Rochars,V.M., Elbadry,M.A., Okech,B.A. and Loeb,J.C. TITLE Direct Submission JOURNAL Submitted (30-MAR-2016) Environmental and Global Health, University of Florida - Gainesville, 1225 Center Drive, Room 4155, Gainesville, FL 32610, USA REMARK Sequence update by submitter COMMENT On Mar 30, 2016 this sequence version replaced gi:983657312. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10677 /organism="Zika virus" /mol_type="genomic RNA" /strain="Haiti/1225/2014" /isolation_source="plasma" /host="Homo sapiens" /db_xref="taxon:64320" /country="Haiti" /collection_date="12-Dec-2014" /note="genotype: Asian" 5'UTR 1..106 CDS 107..10378 /note="contains structural and non-structural proteins" /codon_start=1 /product="polyprotein" /protein_id="AMB37295.1" /db_xref="GI:983657313" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SHFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDYSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATMGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLMAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" mat_peptide 107..481 /product="capsid protein" mat_peptide 482..751 /product="propeptide" mat_peptide 752..976 /product="membrane protein" mat_peptide 977..2491 /product="envelope protein" /note="ENV" mat_peptide 2492..3577 /product="NS1" mat_peptide 3578..4231 /product="NS2A" mat_peptide 4232..4663 /product="NS2B" mat_peptide 4664..6472 /product="NS3" mat_peptide 6473..6913 /product="NS4A" mat_peptide 6914..8419 /product="NS4B" mat_peptide 8420..10375 /product="NS5" 3'UTR 10379..10677 ORIGIN 1 agttgttact gttgctgact cagactgcga cagttcgagt ttgaagcgaa agctagcaac 61 agtatcaaca ggttttattt ggatttggaa acgagagttt ctggtcatga aaaacccaaa 121 aaagaaatcc ggaggattcc ggattgtcaa tatgctaaaa cgcggagtag cccgtgtgag 181 cccctttggg ggcttgaaga ggctgccagc cggacttctg ctgggtcatg ggcccatcag 241 gatggtcttg gcaattctag cctttttgag attcacggca atcaagccat cactgggtct 301 catcaataga tggggttcag tggggaaaaa agaggctatg gaaataataa agaagttcaa 361 gaaagatctg gctgccatgc tgagaataat caatgctagg aaggagaaga agagacgagg 421 cgcagatact agtgtcggaa ttgttggcct cctgctgacc acagctatgg cagcggaggt 481 cactagacgt gggagtgcat actatatgta cttggacaga aacgatgctg gggaggccat 541 atcttttcca accacattgg ggatgaataa gtgttatata cagatcatgg atcttggaca 601 catgtgtgat gccaccatga gctatgaatg ccctatgctg gatgaggggg tggaaccaga 661 tgacgtcgat tgttggtgca acacgacgtc aacttgggtt gtgtacggaa cctgccatca 721 caaaaaaggt gaagcacgga gatctagaag agctgtgacg ctcccctccc attccactag 781 gaagctgcaa acgcggtcgc aaacctggtt ggaatcaaga gaatacacaa agcacttgat 841 tagagtcgaa aattggatat tcaggaaccc tggcttcgcg ttagcagcag ctgccatcgc 901 ttggcttttg ggaagctcaa cgagccaaaa agtcatatac ttggtcatga tactgctgat 961 tgccccggca tacagcatca ggtgcatagg agtcagcaat agggactttg tggaaggtat 1021 gtcaggtggg acttgggttg atgttgtctt ggaacatgga ggttgtgtca ccgtaatggc 1081 acaggacaaa ccgactgtcg acatagagct ggttacaaca acagtcagca acatggcgga 1141 ggtaagatcc tactgctatg aggcatcaat atcagacatg gcttcggaca gccgctgccc 1201 aacacaaggt gaagcctacc ttgacaagca atcagacact caatatgtct gcaaaagaac 1261 gttagtggac agaggctggg gaaatggatg tggacttttt ggcaaaggga gtctggtgac 1321 atgcgctaag tttgcatgct ccaagaaaat gaccgggaag agcatccagc cagagaatct 1381 ggagtaccgg ataatgctgt cagttcatgg ctcccagcac agtgggatga tcgttaatga 1441 cacaggacat gaaactgatg agaatagagc gaaggttgag ataacgccca attcaccaag 1501 agccgaagcc accctggggg gttttggaag cctaggactt gattgtgaac cgaggacagg 1561 ccttgacttt tcagatttgt attacttgac tatgaataac aagcactggt tggttcacaa 1621 ggagtggttc cacgacattc cattaccttg gcacgctggg gcagacaccg gaactccaca 1681 ctggaacaac aaagaagcac tggtagagtt caaggacgca catgccaaaa ggcaaactgt 1741 cgtggttcta gggagtcaag aaggagcagt tcacacggcc cttgctggag ctctggaggc 1801 tgagatggat ggtgcaaagg gaaggctgtc ctctggccac ttgaaatgtc gcctgaaaat 1861 ggataaactt agattgaagg gcgtgtcata ctccttgtgt accgcagcgt tcacattcac 1921 caagatcccg gctgaaacac tgcacgggac agtcacagtg gaggtacagt acgcagggac 1981 agatggacct tgcaaggttc cagctcagat ggcggtggac atgcaaactc tgaccccagt 2041 tgggaggttg ataaccgcta accccgtaat cactgaaagc actgagaact ctaagatgat 2101 gctggaactt gatccaccat ttggggactc ttacattgtc ataggagtcg gggagaagaa 2161 gatcacccac cactggcaca ggagtggcag caccattgga aaagcatttg aagccactgt 2221 gagaggtgcc aagagaatgg cagtcttggg agacacagcc tgggactttg gatcagttgg 2281 aggcgctctc aactcattgg gcaagggcat ccatcaaatt tttggagcag ctttcaaatc 2341 attgtttgga ggaatgtcct ggttctcaca aattctcatt ggaacgttgc tgatgtggtt 2401 gggtctgaac acaaagaatg gatctatttc ccttatgtgc ttggccttag ggggagtgtt 2461 gatcttctta tccacagccg tctctgctga tgtggggtgc tcggtggact tctcaaagaa 2521 ggagacgaga tgcggtacag gggtgttcgt ctataacgac gttgaagcct ggagggacag 2581 gtacaagtac catcctgact ccccccgtag attggcagca gcagtcaagc aagcctggga 2641 agatggtatc tgcgggatct cctctgtttc aagaatggaa aacatcatgt ggagatcagt 2701 agaaggggag ctcaacgcaa tcctggaaga gaatggagtt caactgacgg tcgttgtggg 2761 atctgtaaaa aaccccatgt ggagaggtcc acagagattg cccgtgcctg tgaacgagct 2821 gccccacggc tggaaggctt gggggaaatc gcacttcgtc agagcagcaa agacaaataa 2881 cagctttgtc gtggatggtg acacactgaa ggaatgccca ctcaaacata gagcatggaa 2941 cagctttctt gtggaggatc atgggttcgg ggtatttcac actagtgtct ggctcaaggt 3001 tagagaagat tattcattag agtgtgatcc agccgttatt ggaacagctg ttaagggaaa 3061 ggaggctgta cacagtgatc taggctactg gattgagagt gagaagaatg acacatggag 3121 gctgaagagg gcccatctga tcgagatgaa aacatgtgaa tggccaaagt cccacacatt 3181 gtggacagat ggaatagaag agagtgatct gatcataccc aagtctttag ctgggccact 3241 cagccatcac aataccagag agggctacag gacccaaatg aaagggccat ggcacagtga 3301 agagcttgaa attcggtttg aggaatgccc aggcactaag gtccacgtgg aggaaacatg 3361 tggaacaaga ggaccatctc tgagatcaac cactgcaagc ggaagggtga tcgaggaatg 3421 gtgctgcagg gagtgcacaa tgcccccact gtcgttccgg gctaaagatg gctgttggta 3481 tggaatggag ataaggccca ggaaagaacc agaaagcaac ttagtaaggt caatggtgac 3541 tgcaggatca actgatcaca tggatcactt ctcccttgga gtgcttgtga ttctgctcat 3601 ggtgcaggaa gggctgaaga agagaatgac cacaaagatc atcataagca catcaatggc 3661 agtgctggta gctatgatcc tgggaggatt ttcaatgagt gacctggcta agcttgcaat 3721 tttgatgggt gccaccttcg cggaaatgaa cactggagga gatgtagctc atctggcgct 3781 gatagcggca ttcaaagtca gaccagcgtt gctggtatct ttcatcttca gagctaattg 3841 gacaccccgt gaaagcatgc tgctggcctt ggcctcgtgt cttttgcaaa ctgcgatctc 3901 cgccttggaa ggcgacctga tggttctcat caatggtttt gctttggcct ggttggcaat 3961 acgagcgatg gttgttccac gcactgataa catcaccttg gcaatcctgg ctgctctgac 4021 accactggcc cggggcacac tgcttgtggc gtggagagca ggccttgcta cttgcggggg 4081 gtttatgctc ctctctctga agggaaaagg cagtgtgaag aagaacttac catttgtcat 4141 ggccctggga ctaaccgctg tgaggctggt cgaccccatc aacgtggtgg ggctgctgtt 4201 gctcacaagg agtgggaagc ggagctggcc ccctagcgaa gtactcacag ctgttggcct 4261 gatatgcgca ttggctggag ggttcgccaa ggcagatata gagatggctg ggcccatggc 4321 cgcggtcggt ctgctaattg tcagttacgt ggtctcagga aagagtgtgg acatgtacat 4381 tgaaagagca ggtgacatca catgggaaaa agatgcggaa gtcactggaa acagtccccg 4441 gctcgatgtg gcgctagatg agagtggtga tttctccctg gtggaggatg acggtccccc 4501 catgagagag atcatactca aggtggtcct gatgaccatc tgtggcatga acccaatagc 4561 catacccttt gcagctggag cgtggtacgt atacgtgaag actggaaaaa ggagtggtgc 4621 tctatgggat gtgcctgctc ccaaggaagt aaaaaagggg gagaccacag atggagtgta 4681 cagagtaatg actcgtagac tgctaggttc aacacaagtt ggagtgggag ttatgcaaga 4741 gggggtcttt cacactatgt ggcacgtcac aaaaggatcc gcgctgagaa gcggtgaagg 4801 gagacttgat ccatactggg gagatgtcaa gcaggatctg gtgtcatact gtggtccatg 4861 gaagctagat gccgcctggg acgggcacag cgaggtgcag ctcttggccg tgccccccgg 4921 agagagagcg aggaacatcc agactctgcc cggaatattt aagacaaagg atggggacat 4981 tggagcggtt gcgctggatt acccagcagg aacttcagga tctccaatcc tagacaagtg 5041 tgggagagtg ataggacttt atggcaatgg ggtcgtgatc aaaaatggga gttatgttag 5101 tgccatcacc caagggagga gggaggaaga gactcctgtt gagtgcttcg agccttcgat 5161 gctgaagaag aagcagctaa ctgtcttaga cttgcatcct ggagctggga aaaccaggag 5221 agttcttcct gaaatagtcc gtgaagccat aaaaacaaga ctccgtactg tgatcttagc 5281 tccaaccagg gttgtcgctg ctgaaatgga ggaagccctt agagggcttc cagtgcgtta 5341 tatgacaaca gcagtcaatg tcacccactc tggaacagaa atcgtcgact taatgtgcca 5401 tgccaccttc acttcacgtc tactacagcc aatcagagtc cccaactata atctgtatat 5461 tatggatgag gcccacttca cagatccctc aagtatagca gcaagaggat acatttcaac 5521 aagggttgag atgggcgagg cggctgccat cttcatgacc gccacgccac caggaacccg 5581 tgacgcattt ccggactcca actcaccaat tatggacacc gaagtggaag tcccagagag 5641 agcctggagc tcaggctttg attgggtgac ggattattct ggaaaaacag tttggtttgt 5701 tccaagcgtg aggaacggca atgagatcgc agcttgtctg acaaaggctg gaaaacgggt 5761 catacagctc agcagaaaga cttttgagac agagttccag aaaacaaaac atcaagagtg 5821 ggactttgtc gtgacaactg acatttcaga gatgggcgcc aactttaaag ctgaccgtgt 5881 catagattcc aggagatgcc taaagccggt catacttgat ggcgagagag tcattctggc 5941 tggacccatg cctgtcacac atgccagcgc tgcccagagg agggggcgca taggcaggaa 6001 tcccaacaaa cctggagatg agtatctgta tggaggtggg tgcgcagaga ctgacgaaga 6061 ccatgcacac tggcttgaag caagaatgct ccttgacaat atttacctcc aagatggcct 6121 catagcctcg ctctatcgac ctgaggccga caaagtagca gccattgagg gagagttcaa 6181 gcttaggacg gagcaaagga agacctttgt ggaactcatg aaaagaggag atcttcctgt 6241 ttggctggcc tatcaggttg catctgccgg aataacctac acagatagaa gatggtgctt 6301 tgatggcacg accaacaaca ccataatgga agacagtgtg ccggcagagg tgtggaccag 6361 acacggagag aaaagagtgc tcaaaccgag gtggatggac gccagagttt gttcagatca 6421 tgcggccctg aagtcattca aggagtttgc cgctgggaaa agaggagcgg cttttggagt 6481 gatggaagcc ctgggaacac tgccaggaca catgacagag agattccagg aagccattga 6541 caacctcgct gtgctcatgc gggcagagac tggaagcagg ccttacaaag ccgcggcggc 6601 ccaattgccg gagaccctag agaccattat gcttttgggg ttgctgggaa cagtctcgct 6661 gggaatcttt ttcgtcttga tgaggaacaa gggcataggg aagatgggct ttggaatggt 6721 gactcttggg gccagcgcat ggctcatgtg gctctcggaa attgagccag ccagaattgc 6781 atgtgtcctc attgttgtgt tcctattgct ggtggtgctc atacctgagc cagaaaagca 6841 aagatctccc caggacaacc aaatggcaat catcatcatg gtagcagtag gtcttctggg 6901 cttgattacc gccaatgaac tcggatggtt ggagagaaca aagagtgacc taagccatct 6961 aatgggaagg agagaggagg gggcaaccat gggattctca atggacattg acctgcggcc 7021 agcctcagct tgggccatct atgctgcctt gacaactttc attaccccag ccgtccaaca 7081 tgcagtgacc acttcataca acaactactc cttaatggcg atggccacgc aagctggagt 7141 gttgtttggt atgggcaaag ggatgccatt ctacgcatgg gactttggag tcccgctgct 7201 aatgataggt tgctactcac aattaacgcc cctgacccta atagtggcca tcattttgct 7261 cgtggcgcac tacatgtact tgatcccagg gctgcaggca gcagctgcgc gtgctgccca 7321 gaagagaacg gcagctggca tcatgaagaa ccctgttgtg gatggaatag tggtgactga 7381 cattgacaca atgacaattg acccccaagt ggagaaaaag atgggacagg tgctactcat 7441 ggcagtagcc gtctccagcg ccatactgtc gcggaccgcc tgggggtggg gggaggctgg 7501 ggccctgatc acagccgcaa cttccacttt gtgggaaggc tctccgaaca agtactggaa 7561 ctcctctaca gccacttcac tgtgtaacat ttttagggga agttacttgg ctggagcttc 7621 tctaatctac acagtaacaa gaaacgctgg cttggtcaag agacgtgggg gtggaacagg 7681 agagaccctg ggagagaaat ggaaggcccg cttgaaccag atgtcggccc tggagttcta 7741 ctcctacaaa aagtcaggca tcaccgaggt gtgcagagaa gaggcccgcc gcgccctcaa 7801 ggacggtgtg gcaacgggag gccatgctgt gtcccgagga agtgcaaagc tgagatggtt 7861 ggtggagcgg ggatacctgc agccctatgg aaaggtcatt gatcttggat gtggcagagg 7921 gggctggagt tactacgccg ccaccatccg caaagttcaa gaagtgaaag gatacacaaa 7981 aggaggccct ggtcatgaag aacccgtgtt ggtgcaaagc tatgggtgga acatagtccg 8041 tcttaagagt ggggtggacg tctttcatat ggcggctgag ccgtgtgaca cgttgctgtg 8101 tgacataggt gagtcatcat ctagtcctga agtggaagaa gcacggacgc tcagagtcct 8161 ctccatggtg ggggattggc ttgaaaaaag accaggagcc ttttgtataa aagtgttgtg 8221 cccatacacc agcactatga tggaaaccct ggagcgactg cagcgtaggt atgggggagg 8281 actggtcaga gtgccactct cccgcaactc tacacatgag atgtactggg tctctggagc 8341 gaaaagcaac accataaaaa gtgtgtccac cacgagccag ctcctcttgg ggcgcatgga 8401 cgggcctagg aggccagtga aatatgagga ggatgtgaat ctcggctctg gcacgcgggc 8461 tgtggtaagc tgcgctgaag ctcccaacat gaagatcatt ggtaaccgca ttgaaaggat 8521 ccgcagtgag cacgcggaaa cgtggttctt tgacgagaac cacccatata ggacatgggc 8581 ttaccatgga agctatgagg cccccacaca agggtcagcg tcctctctaa taaacggggt 8641 tgtcaggctc ctgtcaaaac cctgggatgt ggtgactgga gtcacaggaa tagccatgac 8701 cgacaccaca ccgtatggtc agcaaagagt tttcaaggaa aaagtggaca ctagggtgcc 8761 agacccccaa gaaggcactc gtcaggttat gagcatggtc tcttcctggt tgtggaaaga 8821 gctaggcaaa cacaaacggc cacgagtctg taccaaagaa gagttcatca acaaggttcg 8881 tagcaatgca gcattagggg caatatttga agaggaaaaa gagtggaaga ctgcagtgga 8941 agctgtgaac gatccaaggt tctgggctct agtggacaag gaaagagagc accacctgag 9001 aggagagtgc cagagttgtg tgtacaacat gatgggaaaa agagaaaaga aacaagggga 9061 atttggaaag gccaagggca gccgcgccat ctggtatatg tggctagggg ctagatttct 9121 agagttcgaa gcccttggat tcttgaacga ggatcactgg atggggagag agaactcagg 9181 aggtggtgtt gaagggctgg gattacaaag actcggatat gtcctagaag agatgagtcg 9241 cataccagga ggaaggatgt atgcagatga cactgctggc tgggacaccc gcatcagcag 9301 gtttgatctg gagaatgaag ctctaatcac caaccaaatg gagaaagggc acagggcctt 9361 ggcattggcc ataatcaagt acacatacca aaacaaagtg gtaaaggtcc ttagaccagc 9421 tgaaaaaggg aagacagtta tggacattat ttcgagacaa gaccaaaggg ggagcggaca 9481 agttgtcact tacgctctta acacatttac caacctagtg gtgcaactca ttcggaatat 9541 ggaggctgag gaagttctag agatgcaaga cttgtggctg ctgcggaggt cagagaaagt 9601 gaccaactgg ttgcagagca acggatggga taggctcaaa cgaatggcag tcagtggaga 9661 tgattgcgtt gtgaagccaa ttgatgatag gtttgcacat gccctcaggt tcttgaatga 9721 tatgggaaaa gttaggaagg acacacaaga gtggaaaccc tcaactggat gggacaactg 9781 ggaagaagtt ccgttttgct cccaccactt caacaagctc catctcaagg acgggaggtc 9841 cattgtggtt ccctgccgcc accaagatga actgattggc cgggcccgcg tctctccagg 9901 ggcgggatgg agcatccggg agactgcttg cctagcaaaa tcatatgcgc aaatgtggca 9961 gctcctttat ttccacagaa gggacctccg actgatggcc aatgccattt gttcatctgt 10021 gccagttgac tgggttccaa ctgggagaac tacctggtca atccatggaa agggagaatg 10081 gatgaccact gaagacatgc ttgtggtgtg gaacagagtg tggattgagg agaacgacca 10141 catggaagac aagaccccag ttacgaaatg gacagacatt ccctatttgg gaaaaaggga 10201 agacttgtgg tgtggatctc tcatagggca cagaccgcgc accacctggg ctgagaacat 10261 taaaaacaca gtcaacatgg tgcgcaggat cataggtgat gaagaaaagt acatggacta 10321 cctatccacc caagttcgct acttgggtga agaagggtct acacctggag tgctgtaagc 10381 accaatctta atgttgtcag gcctgctagt cagccacagc ttggggaaag ctgtgcagcc 10441 tgtgaccccc ccaggagaag ctgggaaacc aagcctatag tcaggccgag aacgccatgg 10501 cacggaagaa gccatgctgc ctgtgagccc ctcagaggac actgagtcaa aaaaccccac 10561 gcgcttggag gcgcaggatg ggaaaagaag gtggcgacct tccccaccct tcaatctggg 10621 gcctgaactg gagatcagct gtggatctcc agaagaggga ctagtggtta gaggaga

Zika virus strain Haiti/1225/2014, complete genomeGenBank: KU509998.2 FASTA Graphics http://www.ncbi.nlm.nih.gov/nuccore/KU509998.2

Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU

DCHHS Reports 5th Zika Virus Case in Dallas County DALLAS (April 1, 2016) – Dallas County Health and Human Services (DCHHS) is reporting the fifth confirmed case of Zika virus in Dallas County in 2016. The 67-year-old patient is a resident of Irving who traveled to Colombia. The patient's symptoms have resolved. For medical confidentiality and personal privacy reasons, DCHHS does not provide additional identifying information. While sexual transmission of Zika virus is possible, it is primarily transmitted to people by Aedes species mosquitoes. The most common symptoms of Zika virus are fever, rash, joint pain, and conjunctivitis (red eyes). The illness is usually mild with symptoms lasting several days to a week. DCHHS advises individuals with symptoms to see a healthcare provider if they visited an area where Zika virus is present or had sexual contact with a person who traveled to an area where Zika virus is present. There is no specific medication available to treat Zika virus and there is not a vaccine. The best ways to avoid Zika virus are to avoid mosquito bites and sexual contact with a person who has Zika virus. DCHHS recommends everyone use the 4Ds to reduce the chance of being bitten by a mosquito. DEET All Day, Every Day: Whenever you’re outside, use insect repellents that contain DEET or other EPA approved repellents and follow label instructions.DRESS: Wear long, loose, and light-colored clothing outside.DRAIN: Remove all standing water in and around your home.DUSK & DAWN: Limit outdoor activities during dusk and dawn hours when mosquitoes are most active.While all 4Ds are important, draining or treating standing water is crucial to stop the breeding of mosquitoes. Standing water can be treated with EPA-approved larvicides that are available for retail purchase. Larvicides are products used to kill immature mosquitoes before they become adults. Larvicides are applied directly to water sources that hold mosquito eggs, larvae, or pupae. When used well, larvicides can help reduce the overall mosquito burden by limiting the number of mosquitoes that are produced, according to CDC. Travelers can protect themselves further by doing the following: Choose a hotel or lodging with air conditioning or screens on windows or doors.Sleep under a mosquito bed net if you are outside or in a room that is not well-screened.Sexual partners can protect each other by abstaining from sex or by using condoms consistently and correctly during sex. Pregnant women and women trying to get pregnant can protect themselves further by taking the following precautions: Pregnant women in any trimester should consider postponing travel to areas where Zika virus transmission is ongoing.Pregnant women who do travel to an area with active Zika virus transmission should talk to their doctor or other healthcare provider first and strictly follow steps to avoid mosquito bites during the trip.Pregnant women should discuss their male partner’s potential exposures to mosquitoes and history of Zika-like illness.Women trying to become pregnant or who are thinking about becoming pregnant should consult with their healthcare provider before traveling to areas with active Zika virus transmission, and strictly follow steps to avoid mosquito bites during the trip.To see countries and territories with active Zika virus transmission, go to:http://www.cdc.gov/zika/geo/. There are currently no reports of Zika virus being locally-transmitted by mosquitoes in Dallas County. However, imported cases make local spread by mosquitoes possible because the mosquitoes that can transmit the virus are found locally. DCHHS advises recent travelers with Zika virus symptoms as well as individuals diagnosed with the virus to protect themselves from further mosquito bites. For more information on Zika virus, go to the DCHHS website. # For additional information, contact: Erikka D. Neroes, Public Information [email protected] 214.819.6329 (office) 214.394.8109 (cell) Zachary Thompson, Director 214.755.9299 (cell)

DALLAS (April 1, 2016) – Dallas County Health and Human Services (DCHHS) is reporting the fifth confirmed case of Zika virus in Dallas County in 2016. The 67-year-old patient is a resident of Irving who traveled to Colombia.