Everything posted by niman
-
Zika virus disease in the United States 2015-2016 - CDC
Zika virus disease in the United States, 2015–2016Language:EnglishEspañol (Spanish)Recommend on FacebookTweetAs of March 9, 2016 (5 am EST) As an arboviral disease, Zika virus is nationally notifiable.This update from the CDC Arboviral Disease Branch includes provisional data reported to ArboNET for January 1, 2015 – March 9, 2016.US States Travel-associated Zika virus disease cases reported: 193Locally acquired vector-borne cases reported: 0US Territories Travel-associated cases reported: 1Locally acquired cases reported:173 Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of March 9, 2016) StatesTravel-associated cases (N=193)Locally acquired cases (N=0)Alabama10Arkansas10California130Colorado20Delaware10District of Columbia30Florida490Georgia50Hawaii50Illinois70Indiana30Iowa30Louisiana20Maryland40Massachusetts30Michigan20Minnesota60Missouri10Montana10Nebraska20New Hampshire10New Jersey20New York250North Carolina50Ohio60Oklahoma20Oregon50Pennsylvania60Tennessee10Texas190Virginia60Washington10 Territories(N=1)(N=173)American Samoa013Puerto Rico1159US Virgin Islands01 Page last reviewed: February 4, 2016Page last updated: March 9, 2016
-
Full Zika Saliva & Urine Sequences Padua Italy ex-Dominican Republic
- H3N2v Case In New Jersey - No Direct Swine Contact
Zika_seq_10272 alignment-20_tree-2 (3).pdf- Zika Confirmed Knox Co Ohio ex-Aruba
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU- Zika Confirmed Knox Co Ohio ex-Aruba
Knox County man returning from Aruba tests positive for Zika virusMOUNT VERNON — Four weeks after having his blood sent for testing, the Knox County Health Department has informed a local resident the test was positive for the Zika virus. The 52-year old man, who vacationed in Aruba, began displaying symptoms upon return to the U.S. and was tested at the health department in early February. Zika virus is primarily transmitted through a mosquito bite. Most people infected with the Zika virus do not have any symptoms. When symptoms occur, they are often mild, lasting from several days to a week, and include fever, rash, joint and muscle pain, conjunctivitis (red eyes) and headache. Severe disease requiring hospitalization is uncommon. Since the beginning of the year, Zika has spread throughout Latin America where it has caused an increase in miscarriages and a condition known as microcephaly, in which babies are born with abnormally small heads. “There is no vaccine available for Zika virus so it’s important for anyone traveling to affected areas to take steps to prevent mosquito bites,” said Mary Derr, BSN, director of nursing at the health department. “Especially with Spring Break approaching, travelers should check CDC travel advisories for their destinations and take precautions to protect themselves from mosquitoes.” Precautions include wearing long sleeved shirts and pants; using an EPA-registered insect repellent containing DEET; and staying or sleeping in screened-in or air conditioned rooms. There is no indication that Zika can spread from person to person through casual contact. CDC has confirmed a U.S. case of Zika virus infection in a non-traveler after the person’s sexual partner returned from an affected country and developed symptoms. Due to the possible association between Zika virus infections in pregnant women and certain birth defects, the Centers for Disease Control and Prevention in Atlanta have recommended that pregnant women and women trying to get pregnant postpone travel to areas with active Zika virus transmission, including the Caribbean, Central America and South America. Men who have traveled to those areas are advised to abstain from sex or use a condom with a pregnant partner. “There have been no reported cases of Zika virus transmission through mosquito bites anywhere in the U.S., including Ohio,” said Nate Overholt, environmental health director. “And at this time, no mosquito species in Ohio are known to carry the Zika virus.” Yet, mosquitoes in Ohio can be carriers of other dangerous diseases like West Nile Virus and Encephalitis. “Warmer weather will be here soon and when we get into the mosquito season, people will need to be more careful not to attract mosquitoes to their property or in their house,” said Overholt. “It’s always important to make sure there isn’t any standing water around your house such as bird baths, gutters and spare tires. Make sure that the door and window screens are in good shape, and put on repellent if you’re going to be out during the biting times of dusk and dawn.”In Ohio, mosquito season runs from May to October. The CDC has reported 192 travel-associated cases of Zika virus in 32 states and the District of Columbia. The Knox County case is the eighth case in Ohio. Read more: Knox County man returning from Aruba tests positive for Zika virus — Mount Vernon News – Mount Vernon, Ohio http://mountvernonnews.com/story/2016/03/12/knox-county-man-returning-from-aruba-tests-positive-for-zika-virus/#ixzz42iEqJJwu- Zika Confirmed Knox Co Ohio ex-Aruba
Four weeks after having his blood sent for testing, the Knox County Health Department has informed a local resident the test was positive for the Zika virus. The 52-year old man, who vacationed in Aruba, began displaying symptoms upon return to the U.S. and was tested at the health department in early February.Read more: Knox County man returning from Aruba tests positive for Zika virus — Mount Vernon News – Mount Vernon, Ohio http://mountvernonnews.com/story/2016/03/12/knox-county-man-returning-from-aruba-tests-positive-for-zika-virus/#ixzz42iE6Xt1J- Infectious Zika In Urine & Saliva Italy ex-Dominican Republic - Eurosurveillance
LOCUS KU853013 10636 bp RNA linear VRL 11-MAR-2016 DEFINITION Zika virus isolate Dominican Republic/2016/PD2, complete genome. ACCESSION KU853013 VERSION KU853013.1 GI:1002634691 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10636) AUTHORS Barzon,L., Pacenti,M., Berto,A., Sinigaglia,A., Frachin,E., Lavezzo,E., Brugnaro,P. and Palu,G. TITLE Isolation of infectious Zika virus from saliva and prolonged viral RNA shedding in a traveller returning from the Dominican Republic to Italy, January 2016 JOURNAL Euro Surveill. 21 (10), 1 (2016) REFERENCE 2 (bases 1 to 10636) AUTHORS Barzon,L., Pacenti,M., Frachin,E., Lavezzo,E., Brugnaro,P. and Palu,G. TITLE Direct Submission JOURNAL Submitted (01-MAR-2016) Department of Molecular Medicine, University of Padua, via Gabelli 63, Padua, PD 35100, Italy COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10636 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Dominican Republic/2016/PD2" /host="Homo sapiens" /db_xref="taxon:64320" /country="Italy: Padua" /collection_date="01-Feb-2016" /note="patient hospitalized in Italy after returning travel to Dominican Republic; passage details: first passage in cell culture"http://www.ncbi.nlm.nih.gov/nuccore/KU853013- Infectious Zika In Urine & Saliva Italy ex-Dominican Republic - Eurosurveillance
LOCUS KU853012 10636 bp RNA linear VRL 11-MAR-2016 DEFINITION Zika virus isolate Dominican Republic/2016/PD1, complete genome. ACCESSION KU853012 VERSION KU853012.1 GI:1002634689 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10636) AUTHORS Barzon,L., Pacenti,M., Berto,A., Sinigaglia,A., Frachin,E., Lavezzo,E., Brugnaro,P. and Palu,G. TITLE Isolation of infectious Zika virus from saliva and prolonged viral RNA shedding in a traveller returning from the Dominican Republic to Italy, January 2016 JOURNAL Euro Surveill. 21 (10), 1 (2016) REFERENCE 2 (bases 1 to 10636) AUTHORS Barzon,L., Pacenti,M., Frachin,E., Lavezzo,E., Brugnaro,P. and Palu,G. TITLE Direct Submission JOURNAL Submitted (01-MAR-2016) Department of Molecular Medicine, University of Padua, via Gabelli 63, Padua, PD 35100, Italy COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10636 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Dominican Republic/2016/PD1" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="Italy: Padua" /collection_date="01-Feb-2016" /note="patient hospitalized in Italy after returning travel to Dominican Republic"http://www.ncbi.nlm.nih.gov/nuccore/KU853012- Infectious Zika In Urine & Saliva Italy ex-Dominican Republic - Eurosurveillance
References Santiago GA, Vergne E, Quiles Y, Cosme J, Vazquez J, Medina JF, et al. Analytical and clinical performance of the CDC real time RT-PCR assay for detection and typing of dengue virus. PLoS Negl Trop Dis. 2013;7(7):e2311. Available from: DOI: 10.1371/journal.pntd.0002311 PMID: 23875046Pastorino B, Bessaud M, Grandadam M, Murri S, Tolou HJ, Peyrefitte CN. Development of a TaqMan RT-PCR assay without RNA extraction step for the detection and quantification of African Chikungunya viruses. J Virol Methods. 2005;124(1-2):65-71. Available from: DOI: 10.1016/j.jviromet.2004.11.002 PMID: 15664052Lanciotti RS, Kosoy OL, Laven JJ, Velez JO, Lambert AJ, Johnson AJ, et al. Genetic and serologic properties of Zika virus associated with an epidemic, Yap State, Micronesia, 2007. Emerg Infect Dis. 2008;14(8):1232-9. Available from: DOI: 10.3201/eid1408.080287 PMID: 18680646Barzon L, Pacenti M, Franchin E, Squarzon L, Sinigaglia A, Ulbert S, et al. Isolation of West Nile virus from urine samples of patients with acute infection. J Clin Microbiol. 2014;52(9):3411-3. Available from: DOI: 10.1128/JCM.01328-14 PMID: 24951801Duffy MR, Chen TH, Hancock WT, Powers AM, Kool JL, Lanciotti RS, et al. Zika virus outbreak on Yap Island, Federated States of Micronesia. N Engl J Med. 2009;360(24):2536-43. Available from: DOI: 10.1056/NEJMoa0805715 PMID: 19516034Cao-Lormeau VM, Roche C, Teissier A, Robin E, Berry AL, Mallet HP, et al. Zika virus, French Polynesia, South Pacific, 2013. Emerg Infect Dis. 2014;20(6):1085-6. Available from: DOI: 10.3201/eid2006.140138 PMID: 24856001Roth A, Mercier A, Lepers C, Hoy D, Duituturaga S, Benyon E, et al. Concurrent outbreaks of dengue, chikungunya and Zika virus infections - an unprecedented epidemic wave of mosquito-borne viruses in the Pacific 2012-2014. Euro Surveill. 2014;19(41):20929. Available from: DOI: 10.2807/1560-7917.ES2014.19.41.20929 PMID: 25345518Zammarchi L, Tappe D, Fortuna C, Remoli ME, Günther S, Venturi G, et al. Zika virus infection in a traveller returning to Europe from Brazil, March 2015. Euro Surveill. 2015;20(23):21153. Available from: DOI: 10.2807/1560-7917.ES2015.20.23.21153 PMID: 26084316World Health Organization,. Zika virus infection: global update on epidemiology and potentially associated clinical manifestations. Wkly Epidemiol Rec. 2016;91(7):73-81.PMID: 26897760Calvet G, Aguiar RS, Melo AS, Sampaio SA, de Filippis I, Fabri A, et al. Detection and sequencing of Zika virus from amniotic fluid of fetuses with microcephaly in Brazil: a case study. Lancet Infect Dis. 2016; pii: S1473-3099(16)00095-5. Mlakar J, Korva M, Tul N, Popović M, Poljšak-Prijatelj M, Mraz J, et al. Zika virus associated with microcephaly. N Engl J Med. 2016. [Epub ahead of print].Martines RB, Bhatnagar J, Keating MK, Silva-Flannery L, Muehlenbachs A, Gary J, et al. Notes from the Field: Evidence of Zika virus infection in brain and placental tissues from two congenitally infected newborns and two fetal losses - Brazil, 2015. MMWR Morb Mortal Wkly Rep. 2016;65(6):159-60. Available from: DOI: 10.15585/mmwr.mm6506e1 PMID: 26890059Cao-Lormeau VM, Blake A, Mons S, Lastère S, Roche C, Vanhomwegen J, et al. Guillain-Barré Syndrome outbreak associated with Zika virus infection in French Polynesia: a case-control study. Lancet. 2016;S0140-6736(16)00562-6. [Epub ahead of print].PMID: 26948433 Li MI, Wong PS, Ng LC, Tan CH. Oral susceptibility of Singapore Aedes (Stegomyia) aegypti (Linnaeus) to Zika virus. PLoS Negl Trop Dis. 2012;6(8):e1792. Grard G, Caron M, Mombo IM, Nkoghe D, Mboui Ondo S, Jiolle D, et al. Zika virus in Gabon (Central Africa)--2007: a new threat from Aedes albopictus? PLoS Negl Trop Dis. 2014;8(2):e2681. Available from: DOI: 10.1371/journal.pntd.0002681 PMID: 24516683Wong PS, Li MZ, Chong CS, Ng LC, Tan CH. Aedes (Stegomyia) albopictus (Skuse): a potential vector of Zika virus in Singapore. PLoS Negl Trop Dis. 2013;7(8):e2348. Available from: DOI: 10.1371/journal.pntd.0002348PMID: 23936579Summer Fever Study Group,Gobbi F, Capelli G, Angheben A, Giobbia M, Conforto M, Franzetti M, et al. . Human and entomological surveillance of West Nile fever, dengue and chikungunya in Veneto Region, Italy, 2010-2012. BMC Infect Dis. 2014;14(1):60. Available from: DOI: 10.1186/1471-2334-14-60 PMID: 24499011CHIKV study group,Rezza G, Nicoletti L, Angelini R, Romi R, Finarelli AC, Panning M, et al. . Infection with chikungunya virus in Italy: an outbreak in a temperate region. Lancet. 2007;370(9602):1840-6. Available from:DOI: 10.1016/S0140-6736(07)61779-6 PMID: 18061059Besnard M, Lastere S, Teissier A, Cao-Lormeau V, Musso D. Evidence of perinatal transmission of Zika virus, French Polynesia, December 2013 and February 2014. Euro Surveill. 2014;19(13):20751.DOI: 10.2807/1560-7917.ES2014.19.13.20751 PMID: 24721538Musso D, Nhan T, Robin E, Roche C, Bierlaire D, Zisou K, et al. Potential for Zika virus transmission through blood transfusion demonstrated during an outbreak in French Polynesia, November 2013 to February 2014. Euro Surveill. 2014;19(14):20761. Available from: DOI: 10.2807/1560-7917.ES2014.19.14.20761 PMID: 24739982Centers for Disease Control and Prevention (CDC). HAN Priority Professional and Media Partners Update. Update: Interim Guidelines for Prevention of Sexual Transmission of Zika Virus — United States, 2016. 23 Feb 2016. Available from: http://content.govdelivery.com/accounts/USCDC/bulletins/1383154. Musso D, Roche C, Robin E, Nhan T, Teissier A, Cao-Lormeau VM. Potential sexual transmission of Zika virus. Emerg Infect Dis. 2015;21(2):359-61. Available from: DOI: 10.3201/eid2102.141363 PMID: 25625872Hills SL, Russell K, Hennessey M, Williams C, Oster AM, Fischer M, et al. Transmission of Zika virus through sexual contact with travelers to areas of ongoing transmission — Continental United States, 2016. MMWR Morb Mortal Wkly Rep. 2016;65(8):215-6. Available from: DOI: 10.15585/mmwr.mm6508e2 PMID: 26937739Foy BD, Kobylinski KC, Chilson Foy JL, Blitvich BJ, Travassos da Rosa A, Haddow AD, et al. Probable non-vector-borne transmission of Zika virus, Colorado, USA. Emerg Infect Dis. 2011;17(5):880-2. Available from: DOI: 10.3201/eid1705.101939 PMID: 21529401Musso D, Roche C, Nhan TX, Robin E, Teissier A, Cao-Lormeau VM. Detection of Zika virus in saliva. J Clin Virol.2015;68:53-5.DOI: 10.1016/j.jcv.2015.04.021 PMID: 26071336Gourinat AC, O’Connor O, Calvez E, Goarant C, Dupont-Rouzeyrol M. Detection of Zika virus in urine. Emerg Infect Dis. 2015;21(1):84-6. Available from: DOI: 10.3201/eid2101.140894 PMID: 25530324de M Campos R. Cirne-Santos C,, Meira GL, Santos LL, de Meneses MD, Friedrich J, et al. Prolonged detection of Zika virus RNA in urine samples during the ongoing Zika virus epidemic in Brazil. J Clin Virol. 2016;77:69-70.Andries AC, Duong V, Ly S, Cappelle J, Kim KS, Lorn Try P, et al. Value of routine dengue diagnostic tests in urine and saliva specimens. PLoS Negl Trop Dis. 2015;9(9):e0004100. Available from: DOI: 10.1371/journal.pntd.0004100 PMID: 26406240Korhonen EM, Huhtamo E, Virtala AM, Kantele A, Vapalahti O. Approach to non-invasive sampling in dengue diagnostics: exploring virus and NS1 antigen detection in saliva and urine of travelers with dengue. J Clin Virol.2014;61(3):353-8. Available from: DOI: 10.1016/j.jcv.2014.08.021 PMID: 25242312Barzon L, Pacenti M, Franchin E, Pagni S, Martello T, Cattai M, et al. Excretion of West Nile virus in urine during acute infection. J Infect Dis. 2013;208(7):1086-92. Available from: DOI: 10.1093/infdis/jit290 PMID: 23821721Barzon L, Pacenti M, Franchin E, Squarzon L, Lavezzo E, Toppo S, et al. Novel West Nile virus lineage 1a full genome sequences from human cases of infection in north-eastern Italy, 2011. Clin Microbiol Infect.2012;18(12):E541-4. Available from: DOI: 10.1111/1469-0691.12001 PMID: 23004685Fonseca K, Meatherall B, Zarra D, Drebot M, MacDonald J, Pabbaraju K, et al. First case of Zika virus infection in a returning Canadian traveler. Am J Trop Med Hyg. 2014;91(5):1035-8. Available from: DOI: 10.4269/ajtmh.14-0151 PMID: 25294619Dupount-Rouzeyrol M, Biron A, O’Connor O, Huguan E, Descloux E. Infectious Zika viral particles in breastmilk. Lancet. 2016; S0140-6736(16)00624-3. Leung GH, Baird RW, Druce J, Anstey NM. Zika virus infection in Australia following a monkey bite in Indonesia. Southeast Asian J Trop Med Public Health. 2015;46(3):460-4.PMID: 26521519Gardner J, Rudd PA, Prow NA, Belarbi E, Roques P, Larcher T, et al. Infectious chikungunya virus in the saliva of mice, monkeys and humans. PLoS One. 2015;10(10):e0139481. Available from: DOI: 10.1371/journal.pone.0139481 PMID: 26447467Tamura K, Nei M. Estimation of the number of nucleotide substitutions in the control region of mitochondrial DNA in humans and chimpanzees. Mol Biol Evol. 1993;10(3):512-26.PMID: 8336541Tamura K, Stecher G, Peterson D, Filipski A, Kumar S. MEGA6: Molecular Evolutionary Genetics Analysis version 6.0. Mol Biol Evol. 2013;30(12):2725-9. Available from: DOI: 10.1093/molbev/mst197 PMID: 24132122- Infectious Zika In Urine & Saliva Italy ex-Dominican Republic - Eurosurveillance
Discussion and conclusionsIn this report, we described the isolation of infectious ZIKV in cell culture from saliva collected from a patient during acute ZIKV infection. This finding poses questions on the potential risk of human-to-human transmission of the virus through saliva. In particular, the virus was isolated from saliva collected on day 6 after symptom onset. It is conceivable that viral isolation is more successful from saliva samples characterised by high viral load and collected during the first week after symptom onset, before the appearance of antibodies. However, further analyses in other patients are required to assess the infectivity of ZIKV in saliva. Shedding of ZIKV RNA in saliva has been reported in the literature. In particular, it has been observed in 48% of patients tested during the first week after symptom onset, i.e. more frequently, although not for a longer time, than in plasma [25]. For this reason, testing ZIKV in saliva by RT-PCR has been recommended as a non-invasive and sensitive method for the direct diagnosis of ZIKV infection during the first week after symptom onset [25]. In the case reported here, ZIKV RNA was present at high titre during the first week after symptom onset and remained detectable for a relatively long period, up to 29 days after onset of symptoms. Viral RNA was also excreted in urine for a long-time, in agreement with previous reports on ZIKV detection in urine for more than 10 days after onset of disease [26,27]. Shedding in saliva and urine has also been demonstrated for other vector-borne flaviviruses, i.e. DENV [28,29] and West Nile virus [30,31], and these samples are used for direct diagnosis based on viral nucleic acid or antigen detection. While isolation of ZIKV in cell culture from urine, semen, and breast milk has been described [22,32,33], to our knowledge, isolation of ZIKV from saliva has not been reported so far. Epidemiological data and experimental studies are needed to assess the potential risk of ZIKV spread and transmission through saliva. Interestingly, a human case of ZIKV infection following a monkey bite has been reported [34]. In addition, CHIKV, a mosquito-borne alphavirus, has been isolated in oral fluids of patients with severe infection and in the saliva of experimentally infected mice and monkeys, and mouse-to-mouse transmission of CHIKV without an arthropod vector was demonstrated [35]. Finally, from the laboratory perspective, the results of this study showed that saliva is a useful sample not only for ZIKV nucleic acids detection, but also for virus isolation. AcknowledgementsWe thank the patient for collaborating in the sample collection; we also thank Dr Vittoria Lisi for technical support and Dr Erika Morelli for support in the management of the patient. The study was approved by the local Ethics Committee and the patient provided written informed consent to participate in the study and for the publication of this case report.- Infectious Zika In Urine & Saliva Italy ex-Dominican Republic - Eurosurveillance
BackgroundZIKV is a mosquito-borne flavivirus that generally causes asymptomatic infections in humans and, in an estimated 20% of cases, a mild and self-limited febrile illness associated with rash, arthralgia, and conjunctivitis. The virus, endemic in central and western Africa and in south and south-east Asia, was not considered a relevant human pathogen until outbreaks occurred in Yap, Federal States of Micronesia, in 2007 [5], in French Polynesia in 2013 [6], and in other countries in the Pacific Region in 2013–2014 [7]. In Brazil, the first cases of ZIKV infection were confirmed in March 2015 [8]; since then, the virus has spread exponentially also to other countries in South and Central America and has been estimated to have caused 0.5–1.5 million human infections [9]. The association of the recent human epidemics of ZIKV infection in French Polynesia and Brazil with an increased incidence of Guillain–Barré syndrome and foetal microcephaly has led the World Health Organization (WHO) to declare a public health emergency of international concern on 1 February 2016 [9]. The aetiological link between foetal microcephaly and ZIKV infection has been recently supported by detection of the virus in the amniotic fluid [10] and in brain tissues of microcephalic foetuses [9,11,12], while the association with Guillain–Barré syndrome has been confirmed by a case–control study in French Polynesia [13]. ZIKV is transmitted between humans through Aedes spp. mosquito vectors, mainly the anthropophilic Ae. aegypti [14], which is widespread in tropical and subtropical regions in Africa, Asia, and Latin America, and is the main vector also for DENV and CHIKV. The virus has also been detected in Ae. albopictus [15], which has been shown to be a competent vector by experimental infection [16]. Ae. albopictus is established in Europe, especially in Mediterranean countries, including northern Italy [17], where the case reported in this study was imported. Due to the risk of emergence of outbreaks of vector-borne viruses following the introduction of a viraemic individual in areas where the vector is present [18], an integrated surveillance programme for imported dengue, chikungunya, and Zika virus infections has been implemented in Italy, along with veterinary and entomologic surveillance [17]. Although conceivably rare, non-vector-borne modes of ZIKV transmission may also occur, including trans-placental and perinatal transmission [11,19], blood-transfusion [20], and, potentially, organ donations. Unlike other arboviruses, sexual transmission of ZIKV is also possible and is of particular concern during pregnancy [21]. Actually, ZIKV has been detected and isolated in cell culture from semen samples of patients with infection and cases of probable sexual transmission of ZIKV infection from males to their female partners have been documented [22-24].- Infectious Zika In Urine & Saliva Italy ex-Dominican Republic - Eurosurveillance
Viral isolationWithin the diagnostic workup for arboviral infections, viral isolation was attempted from serum, urine, and saliva specimens collected during the first week after symptom onset. In particular, ZIKV was isolated from a saliva sample collected on day 6 after symptom onset. For virus isolation, both Vero and Vero E6 cells were used, following the procedures described for WNV isolation, with slight modifications [4]. Briefly, saliva was diluted 1:3 in serum-free Dulbecco’s modified Eagle’s medium (DMEM), centrifuged at 1,200 x g for 10 minutes to separate cells from supernatant. Both saliva cells and supernatant were then inoculated into Vero and Vero E6 cells grown at 70% confluence in shell vials. After inoculation, shell vials were centrifuged at 290 x g for 30 minutes and incubated for 60 minutes at 37 °C in 5% CO2; then, DMEM with 2% fetal bovine serum was added, followed by cell culture at 37 °C in 5% CO2 for up to seven days. On day 4, a cytopathic effect appeared in all infection conditions, i.e. both Vero and Vero E6 cells infected with saliva cells or with saliva supernatant. Viral replication in cell culture was confirmed by increased ZIKV RNA load in cell supernatant (ca 330x106 copies/mL). The ZIKV isolate was then propagated in Vero cells; a titre of 0.5x105 TCID50 was obtained at the second passage in cell culture. Sequencing of the full ZIKV genome from the first passage of the viral cell culture (GenBank KU853013) identified only a G to A synonymous nt change in position 6971 in comparison with the ZIKV genome that was sequenced directly from urine and saliva specimens (Figure 2).- Infectious Zika In Urine & Saliva Italy ex-Dominican Republic - Eurosurveillance
Figure 2Phylogenetic tree of full genome sequences of Zika virus obtained directly from saliva and isolated in cell culture from saliva of a traveller returning from the Dominican Republic to Italy, January 2016 The evolutionary history was inferred by using the Maximum Likelihood method based on the Tamura-Nei model [36]. The percentage of trees in which the associated taxa clustered together is shown next to the branches. A discrete Gamma distribution was used to model evolutionary rate differences among sites (5 categories ( + G, parameter = 0.2745)). The analysis involved 23 nt sequences. All positions containing gaps and missing data were eliminated. There were a total of 10,092 positions in the final dataset. Evolutionary analyses were conducted in MEGA6 [37].- Infectious Zika In Urine & Saliva Italy ex-Dominican Republic - Eurosurveillance
Viral genome sequencingFull ZIKV genome sequence was obtained with the Sanger method from nucleic acids purified from saliva and urine specimens collected on day 6 after symptom onset (GenBank KU853012). No nt sequence differences were observed between ZIKV in saliva and urine. Phylogenetic analysis demonstrated that the virus belonged to the Asian lineage and clustered with ZIKV strains from Latin America; it had > 99.6% nt identity with ZIKV strains isolated in French Polynesia (2013) and Brazil (2015), 97.9% nt identity with a ZIKV strain isolated in Yap island in 2007, and 88.9% identity with the Uganda MR766 strain isolated in 1947 (Figure 2).- Infectious Zika In Urine & Saliva Italy ex-Dominican Republic - Eurosurveillance
Laboratory findingsUpon hospital admission, laboratory tests showed blood cell count, haemoglobin, liver and kidney function tests in the normal range. Real-time RT-PCR tests for dengue virus (DENV) [1] and chikungunya virus (CHIKV) [2] were negative, while real-time RT-PCR for Zika virus (ZIKV) [3] was positive in plasma, urine, and saliva, with estimated ZIKV RNA loads of 30 copies/mL; 0.5x106 copies/mL; and 3x106 copies/mL, respectively; IgM and IgG antibodies against DENV (ELISA, Focus Diagnostics Inc., Cypress, CA), CHIKV (immunofluorescence assay, IFA, IgM and IgG, Euroimmun AG, Luebeck, Germany), and ZIKV (IFA Mosaic Arbovirus 2 IgM and IgG and ELISA Zika virus IgM and IgG; Euroimmun AG) were negative. The patient was invited to collect saliva and urine samples daily and to return weekly for follow-up visits and blood sampling. Real-time RT-PCR testing of follow-up blood, urine, and saliva samples demonstrated persistent shedding of ZIKV RNA in saliva and urine for up to 29 days after symptom onset, while viral RNA was detectable in plasma up to day 10 after symptom onset. ZIKV RNA load in saliva and urine was higher than in blood also in follow-up samples (Figure 1). Anti-ZIKV IgM and IgG antibodies appeared on days 7 and 10, respectively, as demonstrated by IFA and ELISA. Figure 1Kinetics of ZIKV RNA load measured by quantitative real-time RT-PCR in plasma, urine, and saliva samples of a patient with ZIKV infection, Italy, January 2016 ZIKV: Zika virus. For real-time RT-PCR analysis, viral RNA was purified from 1 mL of plasma, saliva, or urine samples and eluted in a final volume of 50 µL by using a NucliSENS easyMag automated nucleic acid purification system (bioMérieux, Marcy-l'Étoile, France); 10 µL of purified nucleic acids were used for each real-time RT-PCR reaction, in a final volume of 30 µL. Real-time RT-PCR was performed using the primers and probe set 1086/1162c/1107-FAM developed by Lanciotti et al. [3] and AgPath-ID One-Step RT-PCR Reagents (Thermo Fisher Scientific, Waltham, MA) on a 7900HT Fast Real-Time PCR System (Thermo Fisher Scientific) for 45 cycles. ZIKV RNA load was estimated against a standard curve obtained by dilution of a plasmid in which the target sequence was cloned.- Infectious Zika In Urine & Saliva Italy ex-Dominican Republic - Eurosurveillance
Case reportA young woman in her 20s was admitted to the Infectious Disease Unit of Venice City Hospital in Italy because of persisting fever (38 °C) associated with arthralgia, myalgia, and macular cutaneous rash, that had developed four days before, upon return from a two-week stay in the Dominican Republic, in January 2016. Clinical examination was remarkable for a mild macular erythematous skin eruption on the arms and the abdomen, and for conjunctival hyperaemia. There was no lymph node, liver or spleen enlargement. The abdominal ultrasound did not reveal pathological findings. Fever disappeared on the second day of hospital stay, and the skin eruption faded away completely after three days. The patient had no underlying diseases or important medical history and was not taking any medication. None of the household contacts reported suspected symptoms similar to that of the patient.- Infectious Zika In Urine & Saliva Italy ex-Dominican Republic - Eurosurveillance
We report the isolation of infectious Zika virus (ZIKV) in cell culture from the saliva of a patient who developed a febrile illness after returning from the Dominican Republic to Italy, in January 2016. The patient had prolonged shedding of viral RNA in saliva and urine, at higher load than in blood, for up to 29 days after symptom onset. Sequencing of ZIKV genome showed relatedness with strains from Latin America.- Infectious Zika In Urine & Saliva Italy ex-Dominican Republic - Eurosurveillance
L Barzon 1 2 , M Pacenti 2 , A Berto 1 , A Sinigaglia 3 , E Franchin 1 2 , E Lavezzo 1 , P Brugnaro 4 , G Palù 1 2+ Author affiliations 1. Department of Molecular Medicine, University of Padova, Padova, Italy 2. Microbiology and Virology Unit, Padova University Hospital, Padova, Italy 3. Veneto Institute of Oncology IOV IRCCS, Padova, Italy 4. Infectious Disease Department, Venice City Hospital ‘SS. Giovanni e Paolo’, Venice, Italy Correspondence: Luisa Barzon ([email protected]) Citation style for this article: Barzon L, Pacenti M, Berto A, Sinigaglia A, Franchin E, Lavezzo E, Brugnaro P, Palù G. Isolation of infectious Zika virus from saliva and prolonged viral RNA shedding in a traveller returning from the Dominican Republic to Italy, January 2016. Euro Surveill. 2016;21(10):pii=30159. DOI: http://dx.doi.org/10.2807/1560-7917.ES.2016.21.10.30159 Received:03 March 2016; Accepted:10 March 2016- Infectious Zika In Urine & Saliva Italy ex-Dominican Republic - Eurosurveillance
Eurosurveillance, Volume 21, Issue 10, 10 March 2016Rapid communication ISOLATION OF INFECTIOUS ZIKA VIRUS FROM SALIVA AND PROLONGED VIRAL RNA SHEDDING IN A TRAVELLER RETURNING FROM THE DOMINICAN REPUBLIC TO ITALY, JANUARY 2016 http://www.eurosurveillance.org/ViewArticle.aspx?ArticleId=21409#f2- Full Zika Saliva & Urine Sequences Padua Italy ex-Dominican Republic
Eurosurveillance, Volume 21, Issue 10, 10 March 2016Rapid communication ISOLATION OF INFECTIOUS ZIKA VIRUS FROM SALIVA AND PROLONGED VIRAL RNA SHEDDING IN A TRAVELLER RETURNING FROM THE DOMINICAN REPUBLIC TO ITALY, JANUARY 2016 L Barzon 1 2 , M Pacenti 2 , A Berto 1 , A Sinigaglia 3 , E Franchin 1 2 , E Lavezzo 1 , P Brugnaro 4 , G Palù 1 2+ Author affiliations 1. Department of Molecular Medicine, University of Padova, Padova, Italy 2. Microbiology and Virology Unit, Padova University Hospital, Padova, Italy 3. Veneto Institute of Oncology IOV IRCCS, Padova, Italy 4. Infectious Disease Department, Venice City Hospital ‘SS. Giovanni e Paolo’, Venice, Italy Correspondence: Luisa Barzon ([email protected]) Citation style for this article: Barzon L, Pacenti M, Berto A, Sinigaglia A, Franchin E, Lavezzo E, Brugnaro P, Palù G. Isolation of infectious Zika virus from saliva and prolonged viral RNA shedding in a traveller returning from the Dominican Republic to Italy, January 2016. Euro Surveill. 2016;21(10):pii=30159. DOI: http://dx.doi.org/10.2807/1560-7917.ES.2016.21.10.30159 Received:03 March 2016; Accepted:10 March 2016 We report the isolation of infectious Zika virus (ZIKV) in cell culture from the saliva of a patient who developed a febrile illness after returning from the Dominican Republic to Italy, in January 2016. The patient had prolonged shedding of viral RNA in saliva and urine, at higher load than in blood, for up to 29 days after symptom onset. Sequencing of ZIKV genome showed relatedness with strains from Latin America. http://www.eurosurveillance.org/ViewArticle.aspx?ArticleId=21409#f2- Full Zika Saliva & Urine Sequences Padua Italy ex-Dominican Republic
Viral genome sequencinghttp://www.eurosurveillance.org/ViewArticle.aspx?ArticleId=21409#f2 Full ZIKV genome sequence was obtained with the Sanger method from nucleic acids purified from saliva and urine specimens collected on day 6 after symptom onset (GenBank KU853012). No nt sequence differences were observed between ZIKV in saliva and urine. Phylogenetic analysis demonstrated that the virus belonged to the Asian lineage and clustered with ZIKV strains from Latin America; it had > 99.6% nt identity with ZIKV strains isolated in French Polynesia (2013) and Brazil (2015), 97.9% nt identity with a ZIKV strain isolated in Yap island in 2007, and 88.9% identity with the Uganda MR766 strain isolated in 1947 (Figure 2). Figure 2Phylogenetic tree of full genome sequences of Zika virus obtained directly from saliva and isolated in cell culture from saliva of a traveller returning from the Dominican Republic to Italy, January 2016 The evolutionary history was inferred by using the Maximum Likelihood method based on the Tamura-Nei model [36]. The percentage of trees in which the associated taxa clustered together is shown next to the branches. A discrete Gamma distribution was used to model evolutionary rate differences among sites (5 categories ( + G, parameter = 0.2745)). The analysis involved 23 nt sequences. All positions containing gaps and missing data were eliminated. There were a total of 10,092 positions in the final dataset. Evolutionary analyses were conducted in MEGA6 [37].- Full Zika Saliva & Urine Sequences Padua Italy ex-Dominican Republic
Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1837218372100%0.099%KU509998.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1836618366100%0.099%KU729217.2Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1836618366100%0.099%KJ776791.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1835718357100%0.099%KU321639.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1834818348100%0.099%KU729218.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1834818348100%0.099%KU707826.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1834818348100%0.099%KU527068.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1834818348100%0.099%KU365779.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1833618336100%0.099%KU501217.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1833618336100%0.099%KU365780.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1833018330100%0.099%KU647676.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1833018330100%0.099%KU501216.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1833018330100%0.099%KU365777.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome183231832399%0.099%KU497555.1Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds1831818318100%0.099%KU820897.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1831818318100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1831818318100%0.099%KU312312.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1830918309100%0.099%KU501215.1Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1828218282100%0.099%KU761564.1Select seq gb|KU740184.1|Zika virus isolate GD01 polyprotein gene, complete cds1828218282100%0.099%KU740184.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1826418264100%0.099%KU820899.2Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1812318123100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1803318033100%0.099%KU681081.3Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177261772699%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds176881768898%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1757117571100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1742517425100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164061640699%0.095%HQ234499.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1332413324100%0.089%KF383115.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1332213322100%0.089%KU720415.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1332013320100%0.089%DQ859059.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds133171331799%0.089%HQ234498.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1331113311100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1330613306100%0.089%KF268948.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1330413304100%0.089%KF383119.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1329913299100%0.089%LC002520.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1329913299100%0.089%KF268950.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1327013270100%0.089%KF383116.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1325013250100%0.089%AY632535.2Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132451324599%0.089%HQ234501.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1319613196100%0.088%KF383117.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131711317199%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1298113049100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds129091290997%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108521085297%0.084%KF383120.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4967496727%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4940494027%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4641464125%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4632463225%0.099%KU646827.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3425342518%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3205320517%0.099%KU740199.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds2883421895%0.071%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2686268614%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2057205711%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2017201711%0.099%KU179098.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds174617469%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds174517459%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds174317439%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds173917399%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds173917399%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds173917399%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds173717379%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds159715978%0.099%KJ873160.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds141514157%0.099%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds138213827%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds134613467%0.098%KM851038.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds134213427%0.099%KU556802.1Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds1301130110%0.088%AF013415.1Select seq gb|KT200609.1|Zika virus isolate BR/949/15 NS5 gene, partial cds124512456%0.099%KT200609.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds123412346%0.099%KU232300.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds122512256%0.099%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds122312236%0.099%KU232297.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds121612166%0.099%KU232294.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds121312136%0.099%KU232292.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds120912096%0.099%KU232298.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds120712076%0.099%KU232293.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds120512056%0.099%KU232296.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds120212026%0.099%KU232295.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds119111916%0.099%KU232288.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds118711876%0.099%KU232289.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds118411846%0.099%KU232299.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds118011806%0.099%KU232291.1Select seq gb|KU758878.1|Zika virus polyprotein gene, partial cds113311336%0.099%KU758878.1Select seq gb|KF270886.1|Zika virus strain CCB-870 envelope glycoprotein gene, partial cds107710778%0.089%KF270886.1Select seq gb|AF372422.1|AF372422Zika virus envelope protein (E) gene, partial cds102310238%0.087%AF372422.1Select seq gb|KU867812.1|Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds101810185%0.0100%KU867812.1- Full Zika Saliva & Urine Sequences Padua Italy ex-Dominican Republic
LOCUS KU853013 10636 bp RNA linear VRL 11-MAR-2016 DEFINITION Zika virus isolate Dominican Republic/2016/PD2, complete genome. ACCESSION KU853013 VERSION KU853013.1 GI:1002634691 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10636) AUTHORS Barzon,L., Pacenti,M., Berto,A., Sinigaglia,A., Frachin,E., Lavezzo,E., Brugnaro,P. and Palu,G. TITLE Isolation of infectious Zika virus from saliva and prolonged viral RNA shedding in a traveller returning from the Dominican Republic to Italy, January 2016 JOURNAL Euro Surveill. 21 (10), 1 (2016) REFERENCE 2 (bases 1 to 10636) AUTHORS Barzon,L., Pacenti,M., Frachin,E., Lavezzo,E., Brugnaro,P. and Palu,G. TITLE Direct Submission JOURNAL Submitted (01-MAR-2016) Department of Molecular Medicine, University of Padua, via Gabelli 63, Padua, PD 35100, Italy COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10636 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Dominican Republic/2016/PD2" /host="Homo sapiens" /db_xref="taxon:64320" /country="Italy: Padua" /collection_date="01-Feb-2016" /note="patient hospitalized in Italy after returning travel to Dominican Republic; passage details: first passage in cell culture" CDS 108..10379 /codon_start=1 /product="polyprotein" /protein_id="AMN14620.1" /db_xref="GI:1002634692" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSVVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLVNGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGEEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 agttgttgat ctgtgtgaat cagactgcga cagttcgagt ttgaagcgaa agctagcaac 61 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa 121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga 181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca 241 ggatggtctt ggcgattcta gcctttttga gattcacggc aatcaagcca tcactgggtc 301 tcatcaatag atggggttca gtggggaaaa aagaggctat ggaaataata aagaagttca 361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag 421 gcgcagatac tagtgtcgga attgttggcc tcctgctgac cacagctatg gcagcggagg 481 tcactagacg tgggagtgca tactacatgt acttggacag aaacgatgct ggggaggcca 541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac 601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag 661 atgacgtcga ttgttggtgc aacacgacgt caacttgggt tgtgtacgga acctgccatc 721 acaaaaaagg tgaagcacgg agatctagaa gagctgtgac gctcccctcc cattccacta 781 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcacttga 841 ttagagtcga aaattggata ttcaggaacc ctggcttcgc gttagcagca gctgccatcg 901 cttggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga 961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta 1021 tgtcaggtgg gacttgggtt gatgttgtct tggaacatgg aggttgtgtc accgtaatgg 1081 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg 1141 aggtaagatc ctactgctat gaggcatcaa tatcagacat ggcttcggac agccgctgcc 1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtc tgcaaaagaa 1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga 1321 catgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc 1381 tggagtaccg gataatgctg tcagttcatg gctcccagca cagtgggatg atcgttaatg 1441 acactggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa 1501 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag 1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggttcaca 1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac 1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg 1741 tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga gctctggagg 1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa 1861 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca 1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga 1981 cagatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact ctgaccccag 2041 ttgggaggtt gataaccgcc aaccccgtaa tcactgaaag cactgagaac tctaagatga 2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga 2161 agatcaccca ccactggcac aggagtggca gcaccattgg aaaagcattt gaagccactg 2221 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg 2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat 2341 cattgtttgg aggaatgtcc tggttctcac aaatcctcat tggaacgttg ctgatgtggt 2401 tgggtctgaa cacaaagaat ggatctattt ccctcatgtg cttggcctta gggggagtgt 2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga 2521 aggagacgag atgcggtaca ggggtgttcg tctataacga cgttgaagcc tggagggaca 2581 ggtacaagta ccatcctgac tccccccgta gattggcagc agcagtcaag caagcctggg 2641 aagatggtat ctgcgggatc tcctctgttt caagaatgga aaacatcatg tggagatcag 2701 tagaagggga gctcaatgca atcctggaag agaatggagt tcaactgacg gtcgttgtgg 2761 gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct gtgaacgagc 2821 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt tagagcagca aagacaaata 2881 acagctttgt cgtggatggt gacacactga aggaatgccc actcaaacat agagcatgga 2941 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg 3001 ttagagaaga ttattcatta gagtgtgatc cagccgttat tggaacagct gttaagggaa 3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga 3121 ggctgaagag ggcccatctg atcgagatga aaacatgtga atggccaaag tcccacacat 3181 tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttta gctgggccac 3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg 3301 aagagcttga aattcggttt gaggaatgcc caggcactaa ggtccacgtg gaggaaacat 3361 gtggaacaag aggaccatct ctgagatcaa ccactgcaag cggaagggtg atcgaggaat 3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttccg ggctaaagat ggctgttggt 3481 atggaatgga gataaggccc aggaaagaac cagaaagcaa cttagtaagg tcagtggtga 3541 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca 3601 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcaatgg 3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa 3721 ttttgatggg tgccaccttc gcggaaatga acactggagg agatgtagct catctggcgc 3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc tttcatcttc agagctaatt 3841 ggacaccccg tgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct 3901 ccgccttgga aggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa 3961 tacgagcgat ggttgttcca cgcactgata acatcacctt ggcaatcctg gctgctctga 4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg 4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca 4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt 4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc 4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg 4321 ccgcagtcgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca 4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc 4441 ggctcgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc 4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag 4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggtg 4621 ctctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt 4681 acagagtaat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag 4741 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag 4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat 4861 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg 4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca 4981 ttggagcggt tgcgctggat tacccagcag gaacttcagg atctccaatc ctagacaagt 5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg agttatgtta 5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga 5161 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga 5221 gagttcttcc tgaaatagtc cgtgaagcta taaaaacaag actccgtact gtgatcttag 5281 ctccaaccag ggttgtcgct gctgaaatgg aggaagccct tagagggctt ccagtgcgtt 5341 atatgacaac agcagtcaat gtcacccatt ctggaacaga aatcgtcgac ttaatgtgcc 5401 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtaca 5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcaa 5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc 5581 gtgacgcatt tccggactcc aactcaccaa ttatggacac cgaagtggaa gtcccagaga 5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg 5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg 5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt 5821 gggactttgt cgtgacaacc gacatttcag agatgggcgc caactttaaa gctgaccgtg 5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattctgg 5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga 6001 atcccaacaa acctggagat gagtatctgt atggaggtgg gtgcgcagag actgacgaag 6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc 6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca 6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg 6241 tttggctggc ctatcaggtt gcatctgccg gaataactta cacagataga agatggtgct 6301 ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag gtgtggacca 6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc 6421 atgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag 6481 tgatggaagc cctgggaaca ctgccaggac acatgacaga gagattccag gaagccattg 6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg 6601 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgc 6661 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg 6721 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg 6781 catgtgtcct cattgttgtg ttcctactgc tggtggtgct catacctgag ccagaaaagc 6841 aaagatctcc ccaggacaac caaatggcaa tcatcatcat ggtagcagta ggtcttctgg 6901 gcttgatcac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc 6961 taatgggaag aagagaggag ggagcaacca taggattctc aatggacatt gacctgcggc 7021 cagcctcagc ttgggccatc tatgctgcct tgacaacttt cattacccca gccgtccaac 7081 atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg caagctggag 7141 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc 7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc 7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc 7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg 7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca 7441 tagcagtagc cgtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg 7501 gggccctgat cacagccgca acttccactt tgtgggaagg ctctccgaac aagtactgga 7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt 7621 ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag 7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct 7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca 7801 aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt 7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag 7921 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa 7981 aaggaggccc tggtcatgaa gaacccgtgt tggtgcaaag ctatgggtgg aacatagtcc 8041 gtctcaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt 8101 gtgacatagg tgagtcatca tctagtcctg aagtggaaga agcacggacg ctcagagtcc 8161 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt 8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag 8281 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag 8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg 8401 acgggcctag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg 8461 ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga 8521 tccgcagtga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg 8581 cttaccatgg aagctatgag gcccccacac aagggtcagc atcctctcta gtaaacgggg 8641 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga 8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc 8761 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag 8821 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc aacaaggttc 8881 gtagcaatgc agcattaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg 8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga 9001 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg 9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc 9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag 9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc 9241 gcataccagg aggaaggatg tatgcagatg acactgctgg ctgggatacc cgcatcagca 9301 ggtttgatct agagaatgaa gctctaatca ccaaccaaat ggagaaaggg cacagggcct 9361 tggcattggc cataatcaag tacacatacc aaaacaaagt ggtaaaggtc cttagaccag 9421 ctgaaaaagg gaaaacagtt atggacatta tttcgagaca agaccaaagg gggagcggac 9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggaata 9541 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag 9601 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag 9661 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg 9721 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact 9781 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt 9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag 9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc 9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg 10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat 10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc 10141 acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg gggaaaaggg 10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca 10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga ggaagaaaag tacatggact 10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctgga gtgctgtaag 10381 caccaatctt aatgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc 10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg 10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca 10561 cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg 10621 ggcctgaact ggagat- Full Zika Saliva & Urine Sequences Padua Italy ex-Dominican Republic
Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1837018370100%0.099%KU509998.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1837018370100%0.099%KJ776791.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1836618366100%0.099%KU729217.2Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1835718357100%0.099%KU321639.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1834818348100%0.099%KU729218.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1834818348100%0.099%KU707826.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1834818348100%0.099%KU527068.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1834818348100%0.099%KU365779.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1833418334100%0.099%KU501217.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1833418334100%0.099%KU365780.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1833018330100%0.099%KU647676.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1833018330100%0.099%KU501216.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1833018330100%0.099%KU365777.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome183211832199%0.099%KU497555.1Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds1831618316100%0.099%KU820897.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1831618316100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1831618316100%0.099%KU312312.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1830718307100%0.099%KU501215.1Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1828018280100%0.099%KU761564.1Select seq gb|KU740184.1|Zika virus isolate GD01 polyprotein gene, complete cds1828018280100%0.099%KU740184.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1826218262100%0.099%KU820899.2Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1812318123100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1803318033100%0.099%KU681081.3Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177241772499%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds176901769098%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1757117571100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1742317423100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164061640699%0.095%HQ234499.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1332413324100%0.089%KF383115.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1332013320100%0.089%KU720415.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1331913319100%0.089%DQ859059.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds133151331599%0.089%HQ234498.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1331013310100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1330613306100%0.089%KF268948.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1330213302100%0.089%KF383119.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1329913299100%0.089%LC002520.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1329913299100%0.089%KF268950.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1327013270100%0.089%KF383116.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1324813248100%0.089%AY632535.2Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132451324599%0.089%HQ234501.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1319413194100%0.088%KF383117.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131691316999%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1298013048100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds129111291197%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108531085397%0.084%KF383120.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4967496727%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4940494027%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4641464125%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4632463225%0.099%KU646827.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3425342518%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3205320517%0.099%KU740199.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds2879421395%0.071%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2686268614%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2057205711%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2017201711%0.099%KU179098.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds174617469%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds174517459%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds174317439%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds173917399%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds173917399%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds173917399%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds173717379%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds159715978%0.099%KJ873160.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds141514157%0.099%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds138213827%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds134613467%0.098%KM851038.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds134213427%0.099%KU556802.1Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds1301130110%0.088%AF013415.1Select seq gb|KT200609.1|Zika virus isolate BR/949/15 NS5 gene, partial cds124512456%0.099%KT200609.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds123412346%0.099%KU232300.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds122512256%0.099%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds122312236%0.099%KU232297.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds121612166%0.099%KU232294.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds121312136%0.099%KU232292.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds120912096%0.099%KU232298.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds120712076%0.099%KU232293.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds120512056%0.099%KU232296.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds120212026%0.099%KU232295.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds119111916%0.099%KU232288.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds118711876%0.099%KU232289.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds118411846%0.099%KU232299.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds118011806%0.099%KU232291.1Select seq gb|KU758878.1|Zika virus polyprotein gene, partial cds113311336%0.099%KU758878.1Select seq gb|KF270886.1|Zika virus strain CCB-870 envelope glycoprotein gene, partial cds107710778%0.089%KF270886.1Select seq gb|AF372422.1|AF372422Zika virus envelope protein (E) gene, partial cds102310238%0.087%AF372422.1Select seq gb|KU867812.1|Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds101810185%0.0100%KU867812.1- Full Zika Saliva & Urine Sequences Padua Italy ex-Dominican Republic
LOCUS KU853012 10636 bp RNA linear VRL 11-MAR-2016 DEFINITION Zika virus isolate Dominican Republic/2016/PD1, complete genome. ACCESSION KU853012 VERSION KU853012.1 GI:1002634689 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10636) AUTHORS Barzon,L., Pacenti,M., Berto,A., Sinigaglia,A., Frachin,E., Lavezzo,E., Brugnaro,P. and Palu,G. TITLE Isolation of infectious Zika virus from saliva and prolonged viral RNA shedding in a traveller returning from the Dominican Republic to Italy, January 2016 JOURNAL Euro Surveill. 21 (10), 1 (2016) REFERENCE 2 (bases 1 to 10636) AUTHORS Barzon,L., Pacenti,M., Frachin,E., Lavezzo,E., Brugnaro,P. and Palu,G. TITLE Direct Submission JOURNAL Submitted (01-MAR-2016) Department of Molecular Medicine, University of Padua, via Gabelli 63, Padua, PD 35100, Italy COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10636 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Dominican Republic/2016/PD1" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="Italy: Padua" /collection_date="01-Feb-2016" /note="patient hospitalized in Italy after returning travel to Dominican Republic" CDS 108..10379 /codon_start=1 /product="polyprotein" /protein_id="AMN14619.1" /db_xref="GI:1002634690" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSVVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLVNGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGEEEKYMDYLST QVRYLGEEGSTPGXL" ORIGIN 1 agttgttgat ctgtgtgaat cagactgcga cagttcgagt ttgaagcgaa agctagcaac 61 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa 121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga 181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca 241 ggatggtctt ggcgattcta gcctttttga gattcacggc aatcaagcca tcactgggtc 301 tcatcaatag atggggttca gtggggaaaa aagaggctat ggaaataata aagaagttca 361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag 421 gcgcagatac tagtgtcgga attgttggcc tcctgctgac cacagctatg gcagcggagg 481 tcactagacg tgggagtgca tactacatgt acttggacag aaacgatgct ggggaggcca 541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac 601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag 661 atgacgtcga ttgttggtgc aacacgacgt caacttgggt tgtgtacgga acctgccatc 721 acaaaaaagg tgaagcacgg agatctagaa gagctgtgac gctcccctcc cattccacta 781 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcacttga 841 ttagagtcga aaattggata ttcaggaacc ctggcttcgc gttagcagca gctgccatcg 901 cttggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga 961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta 1021 tgtcaggtgg gacttgggtt gatgttgtct tggaacatgg aggttgtgtc accgtaatgg 1081 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg 1141 aggtaagatc ctactgctat gaggcatcaa tatcagacat ggcttcggac agccgctgcc 1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtc tgcaaaagaa 1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga 1321 catgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc 1381 tggagtaccg gataatgctg tcagttcatg gctcccagca cagtgggatg atcgttaatg 1441 acactggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa 1501 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag 1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggttcaca 1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac 1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg 1741 tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga gctctggagg 1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa 1861 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca 1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga 1981 cagatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact ctgaccccag 2041 ttgggaggtt gataaccgcc aaccccgtaa tcactgaaag cactgagaac tctaagatga 2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga 2161 agatcaccca ccactggcac aggagtggca gcaccattgg aaaagcattt gaagccactg 2221 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg 2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat 2341 cattgtttgg aggaatgtcc tggttctcac aaatcctcat tggaacgttg ctgatgtggt 2401 tgggtctgaa cacaaagaat ggatctattt ccctcatgtg cttggcctta gggggagtgt 2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga 2521 aggagacgag atgcggtaca ggggtgttcg tctataacga cgttgaagcc tggagggaca 2581 ggtacaagta ccatcctgac tccccccgta gattggcagc agcagtcaag caagcctggg 2641 aagatggtat ctgcgggatc tcctctgttt caagaatgga aaacatcatg tggagatcag 2701 tagaagggga gctcaatgca atcctggaag agaatggagt tcaactgacg gtcgttgtgg 2761 gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct gtgaacgagc 2821 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt tagagcagca aagacaaata 2881 acagctttgt cgtggatggt gacacactga aggaatgccc actcaaacat agagcatgga 2941 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg 3001 ttagagaaga ttattcatta gagtgtgatc cagccgttat tggaacagct gttaagggaa 3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga 3121 ggctgaagag ggcccatctg atcgagatga aaacatgtga atggccaaag tcccacacat 3181 tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttta gctgggccac 3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg 3301 aagagcttga aattcggttt gaggaatgcc caggcactaa ggtccacgtg gaggaaacat 3361 gtggaacaag aggaccatct ctgagatcaa ccactgcaag cggaagggtg atcgaggaat 3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttccg ggctaaagat ggctgttggt 3481 atggaatgga gataaggccc aggaaagaac cagaaagcaa cttagtaagg tcagtggtga 3541 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca 3601 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcratgg 3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa 3721 ttttgatggg tgccaccttc gcggaaatga acactggagg agatgtagct catctggcgc 3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc tttcatcttc agagctaatt 3841 ggacaccccg tgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct 3901 ccgccttgga aggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa 3961 tacgagcgat ggttgttcca cgcactgata acatcacctt ggcaatcctg gctgctctga 4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg 4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca 4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt 4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc 4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg 4321 ccgcagtcgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca 4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc 4441 ggctcgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc 4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag 4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggtg 4621 ctctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt 4681 acagagtaat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag 4741 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag 4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat 4861 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg 4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca 4981 ttggagcggt tgcgctggat tacccagcag gaacttcagg atctccaatc ctagacaagt 5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg agttatgtta 5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga 5161 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga 5221 gagttcttcc tgaaatagtc cgtgaagcta taaaaacaag actccgtact gtgatcttag 5281 ctccaaccag ggttgtcgct gctgaaatgg aggaagccct tagagggctt ccagtgcgtt 5341 atatgacaac agcagtcaat gtcacccatt ctggaacaga aatcgtcgac ttaatgtgcc 5401 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtaca 5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcaa 5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc 5581 gtgacgcatt tccggactcc aactcaccaa ttatggacac cgaagtggaa gtcccagaga 5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg 5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg 5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt 5821 gggactttgt cgtgacaacc gacatttcag agatgggcgc caactttaaa gctgaccgtg 5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattctgg 5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga 6001 atcccaacaa acctggagat gagtatctgt atggaggtgg gtgcgcagag actgacgaag 6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc 6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca 6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg 6241 tttggctggc ctatcaggtt gcatctgccg gaataactta cacagataga agatggtgct 6301 ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag gtgtggacca 6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc 6421 atgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag 6481 tgatggaagc cctgggaaca ctgccaggac acatgacaga gagattccag gaagccattg 6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg 6601 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgc 6661 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg 6721 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg 6781 catgtgtcct cattgttgtg ttcctactgc tggtggtgct catacctgag ccagaaaagc 6841 aaagatctcc ccaggacaac caaatggcaa tcatcatcat ggtagcagta ggtcttctgg 6901 gcttgatcac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc 6961 taatgggaag gagagaggag ggagcaacca taggattctc aatggacatt gacctgcggc 7021 cagcctcagc ttgggccatc tatgctgcct tgacaacttt cattacccca gccgtccaac 7081 atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg caagctggag 7141 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc 7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc 7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc 7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg 7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca 7441 tagcagtagc cgtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg 7501 gggccctgat cacagccgca acttccactt tgtgggaagg ctctccgaac aagtactgga 7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt 7621 ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag 7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct 7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca 7801 aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt 7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag 7921 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa 7981 aaggaggccc tggtcatgaa gaacccgtgt tggtgcaaag ctatgggtgg aacatagtcc 8041 gtctcaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt 8101 gtgacatagg tgagtcatca tctagtcctg aagtggaaga agcacggacg ctcagagtcc 8161 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt 8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag 8281 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag 8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg 8401 acgggcctag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg 8461 ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga 8521 tccgcagtga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg 8581 cttaccatgg aagctatgag gcccccacac aagggtcagc atcctctcta gtaaacgggg 8641 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga 8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc 8761 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag 8821 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc aacaaggttc 8881 gtagcaatgc agcattaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg 8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga 9001 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg 9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc 9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag 9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc 9241 gcataccagg aggaaggatg tatgcagatg acactgctgg ctgggatacc cgcatcagca 9301 ggtttgatct agagaatgaa gctctaatca ccaaccaaat ggagaaaggg cacagggcct 9361 tggcattggc cataatcaag tacacatacc aaaacaaagt ggtaaaggtc cttagaccag 9421 ctgaaaaagg gaaaacagtt atggacatta tttcgagaca agaccaaagg gggagcggac 9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggaata 9541 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag 9601 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag 9661 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg 9721 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact 9781 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt 9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag 9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc 9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg 10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat 10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc 10141 acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg gggaaaaggg 10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca 10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga ggaagaaaag tacatggact 10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctgga rtgctgtaag 10381 caccaatctt aatgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc 10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg 10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca 10561 cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg 10621 ggcctgaact ggagat - H3N2v Case In New Jersey - No Direct Swine Contact