Everything posted by niman
-
CDC Week 10 MMWR Zika Total Increases To 242
Zika virus disease in the United States, 2015–2016Language:EnglishEspañolRecommend on FacebookTweetAs of March 16, 2016 (5 am EST) Zika virus disease and Zika virus congenital infection are nationally notifiable conditions.This update from the CDC Arboviral Disease Branch includes provisional data reported to ArboNET for January 1, 2015 – March 16, 2016.US States Travel-associated Zika virus disease cases reported: 258Locally acquired vector-borne cases reported: 0Of the 258 travel-associated infections, 18 are in pregnant women and 6 were sexually transmittedUS Territories Travel-associated cases reported: 3Locally acquired cases reported: 283Of the 283 locally acquired infections, 35 are pregnant women Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of March 16, 2016) StatesTravel-associated cases* No. (%) (N=258)Locally acquired cases† No. (%) (N=0)Alabama1 (<1)0 (0)Arkansas1 (<1)0 (0)California13 (5)0 (0)Colorado2 (1)0 (0)Delaware1 (<1)0 (0)District of Columbia3 (1)0 (0)Florida59 (23)0 (0)Georgia7 (3)0 (0)Hawaii5 (2)0 (0)Illinois7 (3)0 (0)Indiana4 (2)0 (0)Iowa4 (2)0 (0)Kansas1 (<1)0 (0)Kentucky1 (<1)0 (0)Louisiana2 (1)0 (0)Maryland5 (2)0 (0)Massachusetts3 (1)0 (0)Michigan2 (1)0 (0)Minnesota7 (3)0 (0)Missouri1 (<1)0 (0)Montana1 (<1)0 (0)Nebraska2 (1)0 (0)New Hampshire2 (1)0 (0)New Jersey2 (1)0 (0)New York42 (16)0 (0)North Carolina6 (2)0 (0)Ohio8 (3)0 (0)Oklahoma3 (1)0 (0)Oregon6 (2)0 (0)Pennsylvania8 (3)0 (0)Tennessee1 (<1)0 (0)Texas34 (13)0 (0)Virginia7 (3)0 (0)Washington2 (1)0 (0)West Virginia5 (2)0 (0) Territories(N=3)(N=283)American Samoa0 (0)14 (5)Puerto Rico2 (67)259 (92)US Virgin Islands1 (33)10 (4)*Travelers returning from affected areas, their sexual contacts, or infants infected in utero †Presumed local mosquito-borne transmission Page last reviewed: February 4, 2016Page last updated: March 16, 2016
-
Feb 2016 Partial NS2 Zika Sequence Moscow ex-Dominican Republic
Sequence map updated https://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en
-
Feb 2016 Partial NS2 Zika Sequence Moscow ex-Dominican Republic
Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU872850.1|Zika virus isolate Dominican Rep-Rus-2016, NS2 partial cds829829100%0.0100%KU872850.1Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds823823100%0.099%KU820897.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome823823100%0.099%KU497555.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome820820100%0.099%KU820899.2Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds820820100%0.099%KU729218.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome820820100%0.099%KU707826.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome820820100%0.099%KU527068.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds820820100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds820820100%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome820820100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds820820100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds820820100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds820820100%0.099%KU365777.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds820820100%0.099%KU312312.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds820820100%0.099%KJ776791.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome814814100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome814814100%0.099%KU853012.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds814814100%0.099%KU729217.2Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome814814100%0.099%KU744693.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds814814100%0.099%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome814814100%0.099%KU509998.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds814814100%0.099%KU365778.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome814814100%0.099%KU321639.1Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds810810100%0.099%KU761564.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome810810100%0.099%KU681081.3Select seq gb|KU740184.1|Zika virus isolate GD01 polyprotein gene, complete cds810810100%0.099%KU740184.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds810810100%0.099%KU740199.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds796796100%0.098%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds796796100%0.098%JN860885.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome792792100%0.098%KU681082.3Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds756756100%0.097%EU545988.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds726726100%0.095%HQ234499.1
-
Feb 2016 Partial NS2 Zika Sequence Moscow ex-Dominican Republic
LOCUS KU872850 459 bp ss-RNA linear VRL 07-MAR-2016 DEFINITION Zika virus isolate Dominican Rep-Rus-2016, NS2 partial cds. ACCESSION KU872850 VERSION KU872850.1 GI:1003121936 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 459) AUTHORS Karan,L.S., Maleev,V.V., Fedorova,M.V., Grigorieva,Y.E., Kotiv,S.I., Voldokhina,A.V., Shipulin,G.A. and Pokrovsky,V.I. TITLE First case of imported Zika virus disease in Russia from Dominican Republic, February 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 459) AUTHORS Karan,L.S., Maleev,V.V., Fedorova,M.V., Grigorieva,Y.E., Kotiv,S.I. and Voldokhina,A.V. TITLE Direct Submission JOURNAL Submitted (07-MAR-2016) Central Research Institute of Epidemiology, Novogireevskaya Str, 3a, Moscow 111123, Russia COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..459 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Dominican Rep-Rus-2016" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="Russia" /collection_date="Feb-2016" /note="type: Asian" CDS <1..>459 /codon_start=1 /product="NS2" /protein_id="AMO25682.1" /db_xref="GI:1003121937" /translation="TAISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALT PLARGTLLVAWRAGLATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGL LLLTRSGKRSWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSY" ORIGIN 1 actgcgatct ccgccttgga gggcgacctg atggttctca tcaatggttt tgctttggcc 61 tggttggcaa tacgagcgat ggttgttcca cgcactgaca acatcacctt ggcaatcctg 121 gctgctctga caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct 181 acttgcgggg ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta 241 ccatttgtca tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg 301 ggactgctgt tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca 361 gctgttggcc tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct 421 gggcccatgg ccgcggtcgg tctgctaatt gtcagttac
-
Feb 2016 Partial NS2 Zika Sequence Moscow ex-Dominican Republic
Partial NS2 sequence, Dominican Rep-Rus-2016, from Moscow ex-Dominican Republic Feb 2016 urine collection http://www.ncbi.nlm.nih.gov/nuccore/KU872850
-
Zika Confirmed In Moscow ex-Dominican Republic
LOCUS KU872850 459 bp ss-RNA linear VRL 07-MAR-2016 DEFINITION Zika virus isolate Dominican Rep-Rus-2016, NS2 partial cds. ACCESSION KU872850 VERSION KU872850.1 GI:1003121936 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 459) AUTHORS Karan,L.S., Maleev,V.V., Fedorova,M.V., Grigorieva,Y.E., Kotiv,S.I., Voldokhina,A.V., Shipulin,G.A. and Pokrovsky,V.I. TITLE First case of imported Zika virus disease in Russia from Dominican Republic, February 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 459) AUTHORS Karan,L.S., Maleev,V.V., Fedorova,M.V., Grigorieva,Y.E., Kotiv,S.I. and Voldokhina,A.V. TITLE Direct Submission JOURNAL Submitted (07-MAR-2016) Central Research Institute of Epidemiology, Novogireevskaya Str, 3a, Moscow 111123, Russia COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..459 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Dominican Rep-Rus-2016" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="Russia" /collection_date="Feb-2016" /note="type: Asian"http://www.ncbi.nlm.nih.gov/nuccore/KU872850
-
WHO Zika Situation Report March 17
- WHO Zika Situation Report March 17
Summary From 1 January 2007 to 16 March 2016, Zika virus transmission was documented in a total of 59 countries and territories. Cuba and Dominica are the latest to report autochthonous (local) transmission of Zika virus on 14 and 15 March, respectively. Five of these countries and territories reported a Zika virus outbreak that is now over. Three countries (France, Italy and United States of America) have reported locally acquired infection in the absence of any known mosquito vectors, probably through sexual transmission.The geographical distribution of Zika virus has steadily widened since the virus was first detected in the Americas in 2014. Autochthonous Zika virus transmission has been reported in 33 countries and territories of this region.So far an increase in microcephaly and other fetal malformations has been reported in Brazil and French Polynesia, although two additional cases linked to a stay in Brazil were detected in the United States of America and Slovenia.In the context of Zika virus circulation 12 countries or territories have reported an increased incidence of Guillain-Barré syndrome (GBS) and/or laboratory confirmation of a Zika virus infection among GBS cases.The mounting evidence from observational, cohort and case-control studies indicates that Zika virus is highly likely to be a cause of microcephaly, GBS and other neurologic disorders. Among the tasks ahead are to further quantify the risk of neurologic disorders following Zika virus infection, and to investigate the biological mechanisms that lead to neurologic disorders.The global prevention and control strategy launched by WHO as a Strategic Response Framework encompasses surveillance, response activities and research, and this situation report is organized under those headings.- WHO Zika Situation Report March 17
- WHO Zika Situation Report March 17
Zika situation report17 March 2016http://www.who.int/emergencies/zika-virus/situation-report/17-march-2016/en/- Local Zika Transmission In Dominica
Dominica Reports First Case Of Zika VirusHealth Minister Kenneth Darroux says it is a locally transmitted case as the patient hasn't travelled out17/03/2016 10:52 AMZIKA VIRUS :It is believed that the number of affected by the mosquito-borne virus, associated with brain damage in babies, is expected to rise CARIBBEAN ISLAND Dominica is reporting its first case of the Zika virus that has been rapidly spreading across the hemisphere. Health minister Dr Kenneth Darroux said it is a locally transmitted case as the patient person has not recently travelled off the island. In a statement, Dr Darroux said that the patient has since recovered “and all immediate contacts have so far been deemed healthy. “To date, a total of 13 samples have been tested for Zika virus with only one being positive,” he said. Darroux asserted that there was “no need for alarm” and advised anyone showing symptoms to seek medical help. The mosquito-spread Zika causes a mild illness in most people. But researchers are trying to determine whether the virus can cause microcephaly, a condition in which babies are born with abnormally small heads and brain damage. The virus has also been linked to the rare Guillain-Barre paralysis. Since the first case of the virus was recorded in 2015, it has steadily spread to 36 countries in the Americas and the Caribbean including Barbados, Trinidad and Tobago, Jamaica as well as Guyana and Suriname. Posted on: 17/03/2016 10:52 AMhttp://www.voice-online.co.uk/article/dominica-reports-first-case-zika-virus- Indiana Zika Cases Increase To Four
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU- Indiana Zika Cases Increase To Four
Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of March 16, 2016) http://www.cdc.gov/zika/geo/united-states.html StatesTravel-associated cases* No. (%) (N=258)Locally acquired cases† No. (%) (N=0)Alabama1 (<1)0 (0)Arkansas1 (<1)0 (0)California13 (5)0 (0)Colorado2 (1)0 (0)Delaware1 (<1)0 (0)District of Columbia3 (1)0 (0)Florida59 (23)0 (0)Georgia7 (3)0 (0)Hawaii5 (2)0 (0)Illinois7 (3)0 (0)Indiana4 (2)0 (0)Iowa4 (2)0 (0)Kansas1 (<1)0 (0)Kentucky1 (<1)0 (0)Louisiana2 (1)0 (0)Maryland5 (2)0 (0)Massachusetts3 (1)0 (0)Michigan2 (1)0 (0)Minnesota7 (3)0 (0)Missouri1 (<1)0 (0)Montana1 (<1)0 (0)Nebraska2 (1)0 (0)New Hampshire2 (1)0 (0)New Jersey2 (1)0 (0)New York42 (16)0 (0)North Carolina6 (2)0 (0)Ohio8 (3)0 (0)Oklahoma3 (1)0 (0)Oregon6 (2)0 (0)Pennsylvania8 (3)0 (0)Tennessee1 (<1)0 (0)Texas34 (13)0 (0)Virginia7 (3)0 (0)Washington2 (1)0 (0)West Virginia5 (2)0 (0)- Texas Zika Cases Increase To 34
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU- Texas Zika Cases Increase To 34
Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of March 16, 2016) http://www.cdc.gov/zika/geo/united-states.html StatesTravel-associated cases*No. (%)(N=258)Locally acquired cases†No. (%)(N=0)Alabama1 (<1)0 (0)Arkansas1 (<1)0 (0)California13 (5)0 (0)Colorado2 (1)0 (0)Delaware1 (<1)0 (0)District of Columbia3 (1)0 (0)Florida59 (23)0 (0)Georgia7 (3)0 (0)Hawaii5 (2)0 (0)Illinois7 (3)0 (0)Indiana4 (2)0 (0)Iowa4 (2)0 (0)Kansas1 (<1)0 (0)Kentucky1 (<1)0 (0)Louisiana2 (1)0 (0)Maryland5 (2)0 (0)Massachusetts3 (1)0 (0)Michigan2 (1)0 (0)Minnesota7 (3)0 (0)Missouri1 (<1)0 (0)Montana1 (<1)0 (0)Nebraska2 (1)0 (0)New Hampshire2 (1)0 (0)New Jersey2 (1)0 (0)New York42 (16)0 (0)North Carolina6 (2)0 (0)Ohio8 (3)0 (0)Oklahoma3 (1)0 (0)Oregon6 (2)0 (0)Pennsylvania8 (3)0 (0)Tennessee1 (<1)0 (0)Texas34 (13)0 (0)Virginia7 (3)0 (0)Washington2 (1)0 (0)West Virginia5 (2)0 (0)- West Virginia Zika Cases Increase To Five
Map Updated https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU- West Virginia Zika Cases Increase To Five
Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of March 16, 2016) http://www.cdc.gov/zika/geo/united-states.html StatesTravel-associated cases* No. (%) (N=258)Locally acquired cases† No. (%) (N=0)Alabama1 (<1)0 (0)Arkansas1 (<1)0 (0)California13 (5)0 (0)Colorado2 (1)0 (0)Delaware1 (<1)0 (0)District of Columbia3 (1)0 (0)Florida59 (23)0 (0)Georgia7 (3)0 (0)Hawaii5 (2)0 (0)Illinois7 (3)0 (0)Indiana4 (2)0 (0)Iowa4 (2)0 (0)Kansas1 (<1)0 (0)Kentucky1 (<1)0 (0)Louisiana2 (1)0 (0)Maryland5 (2)0 (0)Massachusetts3 (1)0 (0)Michigan2 (1)0 (0)Minnesota7 (3)0 (0)Missouri1 (<1)0 (0)Montana1 (<1)0 (0)Nebraska2 (1)0 (0)New Hampshire2 (1)0 (0)New Jersey2 (1)0 (0)New York42 (16)0 (0)North Carolina6 (2)0 (0)Ohio8 (3)0 (0)Oklahoma3 (1)0 (0)Oregon6 (2)0 (0)Pennsylvania8 (3)0 (0)Tennessee1 (<1)0 (0)Texas34 (13)0 (0)Virginia7 (3)0 (0)Washington2 (1)0 (0)West Virginia5 (2)0 (0)- Zika Cases In Florida Increase To 66
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU- Zika Cases In Florida Increase To 66
March 17, 2016 DEPARTMENT OF HEALTH DAILY ZIKA UPDATE: FOUR NEW CASES IN ALACHUA AND BREVARD COUNTIES Contact:Communications [email protected](850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the Florida Department of Health will issue a Zika virus update each week day at 2 p.m. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. There are four new cases today with one in Brevard County and three in Alachua County. Of the cases confirmed in Florida, seven cases are still exhibiting symptoms. According to the CDC, symptoms associated with the Zika virus last between seven to 10 days. Based on CDC guidance, several pregnant women who have traveled to countries with local-transmission of Zika have received antibody testing, and of those, four have tested positive for the Zika virus. The CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. It is recommended that women who are pregnant or thinking of becoming pregnant postpone travel to Zika affected areas. County Number of Cases (all travel related) Alachua 4 Brevard 2 Broward 8 Hillsborough 3 Lee 3 Miami-Dade 30 Orange 4 Osceola 3 Polk 2 Santa Rosa 1 Seminole 1 St. Johns 1 Cases involving pregnant women* 4 Total 66 *Counties of pregnant women will not be shared. Yesterday, Governor Rick Scott announced that the CDC will host a second conference call with Florida health care workers - including OBGYNS, doctors and those who work with pregnant women - on the CDC’s most recent update and guidance regarding Zika. The CDC call will take place this afternoon and the department has shared information with health care workers on how to participate. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 1,085 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. All cases are travel-associated. There have been no locally-acquired cases of Zika in Florida. For more information on the Zika virus, click here. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. More Information on DOH action on Zika: On Feb. 3, Governor Scott directed the State Surgeon General to issue a Declaration of Public Health Emergency for the counties of residents with travel-associated cases of Zika.The Declaration currently includes the 12 affected counties – Alachua, Brevard, Broward, Hillsborough, Lee, Miami-Dade, Orange, Osceola, Polk, Santa Rosa, Seminole and St. Johns – and will be updated as needed. DOH encourages Florida residents and visitors to protect themselves from all mosquito-borne illnesses by draining standing water; covering their skin with repellent and clothing; and covering windows with screens.DOH has a robust mosquito-borne illness surveillance system and is working with the CDC, the Florida Department of Agriculture and Consumer Services and local county mosquito control boards to ensure that the proper precautions are being taken to protect Florida residents and visitors.Florida currently has the capacity to test 4,273 people for active Zika virus and 1,832 for Zika antibodies.Federal Guidance on Zika: According to the CDC, Zika illness is generally mild with a rash, fever and joint pain. CDC researchers are examining a possible link between the virus and harm to unborn babies exposed during pregnancy.The FDA released guidance regarding donor screening, deferral and product management to reduce the risk of transfusion-transmission of Zika virus. Additional information is available on the FDA website here.The CDC has put out guidance related to the sexual transmission of the Zika virus. This includes the CDC recommendation that if you have traveled to a country with local transmission of Zika you should abstain from unprotected sex.For more information on Zika virus, click here. About the Florida Department of Health The department works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.- Zika Cases In Florida Increase To 66
http://www.floridahealth.gov/newsroom/2016/03/031716-zika-update.html County Number of Cases (all travel related) Alachua 4 Brevard 2 Broward 8 Hillsborough 3 Lee 3 Miami-Dade 30 Orange 4 Osceola 3 Polk 2 Santa Rosa 1 Seminole 1 St. Johns 1 Cases involving pregnant women* 4 Total 66- New York City Zika Tally Page
Latest Facts and Advisories as of 3/16/2016 [ Español (PDF)]Reported cases of Zika in New York City: 18 Two of the eighteen cases were pregnant women;All cases contracted Zika while visiting other countries; andAll patients have recovered.- Maryland Zika Cases Increase To Five
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU- Maryland Zika Cases Increase To Five
Maryland Confirmed Zika Virus Infections (As of March 16, 2016) http://phpa.dhmh.maryland.gov/Pages/Zika.aspx Travel-AssociatedLocally Acquired Vector-BorneTotal505- Maryland Zika Tally Page
Maryland Confirmed Zika Virus Infections (As of March 16, 2016) Travel-AssociatedLocally Acquired Vector-BorneTotal505- Zika Cases In Canada Increase To 30
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU - WHO Zika Situation Report March 17