Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. Lawrence Gostin Statement
  2. Thomas Frieden Statement
  3. Anthony Fauci Statement
  4. Joseph Conlon statement
  5. Luciana Borio statement
  6. Examining the U.S. Public Health Response to the Zika VirusWednesday, March 2, 2016 - 10:15amLocation: 2322 RayburnExamining the U.S. Public Health Response to the Zika VirusSubcommittees: Oversight and Investigations (114th Congress)WitnessesDr. Luciana Borio Assistant Commissioner for Counterterrorism Policy, U.S. Food and Drug Administration Witness StatementTruth in Testimony and CVMr. Joseph M. Conlon Technical Advisor, American Mosquito Control Association Witness StatementTruth in Testimony and CVDr. Anthony Fauci Director, National Institute of Allergy and Infectious Diseases, National Institutes of Health Witness StatementTruth in Testimony and CVDr. Thomas R. Frieden Director, Centers for Disease Control and Prevention Witness StatementMr. Lawrence O. Gostin Faculty Director, O'Neill Institute for National and Global Health Law, Georgetown University Law Center Witness StatementTruth in Testimony and CVDr. Peter J. Hotez Dean, National School of Tropical Medicine, Texas Children's Hospital Witness StatementTruth in Testimony and CVDr. Nicole Lurie Assistant Secretary for Preparedness and Response, U.S. Department of Health and Human Services Witness StatementTruth in Testimony and CVDr. Timothy M. Persons Chief Scientist, U.S. Government Accountability Office Witness StatementTruth in Testimony and CVDr. Jeanne S. Sheffield Director of the Division of Maternal-Fetal Medicine, Johns Hopkins University School of Medicine Witness StatementDocumentsHearing NoticeHearing Memo
  7. Wed Mar 2, 2016 5:46am ESTRelated: HEALTHCuba reports first case of Zika in Venezuelan doctorHAVANA | BY MARC FRANK An Aedes aegypti mosquitoe is seen inside the International Atomic Energy Agency's (IAEA) insect pest control laboratory in Seibersdorf, Austria, February 10, 2016.REUTERS/LEONHARD FOEGER Cuba reported its first case of Zika on Wednesday, diagnosed in a 28-year-old Venezuelan doctor whose husband and brother-in-law previously contracted the virus in their home country. The World Health Organization declared the Zika outbreak, suspected of causing thousands of birth defects in Brazil, an international health emergency on Feb. 1, although much about the virus remains unknown. The patient arrived in Cuba on Feb. 21 to take a post-graduate course in medicine along with 37 others. She reported a fever a day later and was diagnosed with Zika on Monday. She was recovering well in hospital, the Health Ministry said in a statement on Wednesday. Her husband was diagnosed with Zika two months ago and her brother two weeks before she traveled, the statement said. Zika is carried by mosquitoes, which transmit the virus to humans, though the U.S. Centers for Disease Control said on Feb. 23 it was investigating possible cases of sexual transmission. The outbreak has spread to many parts of Latin America and the Caribbean and the WHO estimates Zika could eventually affect as many as four million people in the region. The Cuban government, which has fumigated neighborhoods and homes for decades to contain dengue -- also a mosquito-borne virus and a close cousin of Zika -- put doctors on alert for the virus weeks ago and ramped up mosquito eradication efforts. The WHO is investigating a "strongly suspected" relationship between Zika and microcephaly, a condition marked by abnormally small head size. There is no vaccine or treatment for the virus and some 80 percent of people infected show no symptoms. (Reporting by Marc Frank; Editing by Daniel Trotta and John Stonestreet)
  8. The patient arrived in Cuba on Feb. 21 to take a post-graduate course in medicine along with 37 others. She reported a fever a day later and was diagnosed with Zika on Monday. She was recovering well in hospital, the Health Ministry said in a statement on Wednesday. http://www.reuters.com/article/us-health-zika-cuba-idUSKCN0W40VL
  9. Brazil: 82 microcephaly cases confirmed by Zika infectionAPAnti-mosquito poster in Brazil The number of confirmed cases of severe cranial malformations in newborns in Brazil continues to grow. In 82 cases, microcephaly authorities were able to show a mother Zika infection. The confirmed cases of cranial malformations in babies whose mothers became infected with the Zika virus during pregnancy, have doubled in Brazil in the past two weeks. In 82 of 641 microcephaly cases Zika-infection is in the mothers have been detected, said the Ministry of Health. Two weeks ago, the figure was 41 confirmed cases. The authorities suspect that the majority of microcephaly births preceded the mother a Zika disease. Currently, 4222 more suspected cases of cranial malformations are investigated. Among the 641 registered since October 2015 microcephaly cases so far 139 babies died from the serious defect. Normally there is a year in Brazil around 150 cases of microcephaly. A suspected microcephaly there when the baby comes with a head circumference of 32 centimeters or less to the world. It is still the suspicion that the Zika virus can cause the skull malformation and thus mental retardation in babies, but not definitively proven. It run scientific research on the suspected relationship. As secured, however, that the virus which cause severe nerve disease called Guillain-Barré syndrome can. Condoms for safety The Zika virus has been detected in about 40 countries, mainly in South America, Brazil is the most affected. The number of Zika infections is estimated there to 1.5 million. The virus is spread primarily by diurnal mosquitoes. Healthy develop flu-like symptoms, such as mild fever generally. Even rash and red eyes occur.Anyone who has ever been infected, is immune to the virus. Pregnant women in non-Zika areas recommends the US health authority CDC currently as a precautionary measure to use condoms or avoid sex if their partner was in a recent Zika infection area.Even Pope Francis announced that women given the risk of Zika transmission should use contraceptives. British researchers had previously reported that they had recently been established the pathogen 62 days after infection in the semen of a man.In addition, earlier in the week that was first transmitted through sexual contact case in France known. A woman had been infected with her partner, who had recently returned from a trip to Brazil. But she is not pregnant, fortunately. http://www.spiegel.de/gesundheit/diagnose/zika-virus-82-mikrozephalie-faelle-nach-infektion-bestaetigt-a-1080226.html
  10. Registration Date: 03/01/2016 19:03:45 the amended 03/01/2016 19:03:30 theINQUIRE Health investigates 4,222 suspected cases of microcephaly in the countryThey are being investigated all cases of microcephaly and other disorders of the central nervous system, including the possible relationship with the Zika virus and other congenital infections The Ministry of Health and the states investigating 4,222 suspected cases of microcephaly across the country.This represents 71.5% of reported cases. The new report released on Tuesday (1st) also points to 1,046 notifications have been discarded and 641 confirmed for microcephaly and other nervous system disorders, suggestive of congenital infection. In all, 5,909 suspected cases of microcephaly were recorded until 27 February. The 641 confirmed cases occurred in 250 municipalities located in 15 Brazilian states: Alagoas, Bahia, Ceará, Maranhão, Paraíba, Pernambuco, Piauí, Rio Grande do Norte, Espirito Santo, Rio de Janeiro, Pará, Rondônia, Goiás, Mato Grosso South and Rio Grande do Sul. Already 1,046 cases were discarded because of normal examinations or submit microcefalias and / or changes in the central nervous system by an infectious causes. It should be noted that the Ministry of Health is investigating all cases of microcephaly and other disorders of the central nervous system, informed by the states and the possible relationship with the Zika virus and other congenital infections. Microcephaly can be caused by various infectious agents beyond Zika as Syphilis, Toxoplasmosis, Other Infectious Agents, Rubella, Cytomegalovirus and Herpes Viral. According to the report, the 5,909 cases reported since the beginning of the investigation on 22 October last year - were recorded in 1,143 municipalities in 25 Brazilian states. The Northeast region has 81% of reported cases, and Pernambuco continues with the greatest number of cases that remain under investigation (1672), followed by the states of Bahia (817), Paraíba (810), Rio Grande do Norte (383), Ceará (352), Rio de Janeiro (261), Alagoas (222), Sergipe (192) and Maranhao (192). In all, 139 deaths were reported by microcephaly and / or alteration of the central nervous system after birth (stillbirth) or during pregnancy (miscarriage or stillbirth). Of these, 31 were confirmed to microcephaly and / or alteration of the central nervous system. Other research continue 96 and 12 have been discarded. Of the total confirmed cases of microcephaly, 82 were reported by specific laboratory criteria for Zika virus.However, the Ministry of Health points out that this figure does not represent adequately the total number of cases related to the virus. The folder considers that there was infection Zika most of the mothers who had babies, whose final diagnosis was microcephaly. To date, are with indigenous circulation of Zika virus 22 Brazilian states: Goiás, Minas Gerais, Federal District, Mato Grosso do Sul, Roraima, Amazonas, Pará, Rondônia, Mato Grosso, Tocantins, Maranhao, Piaui, Ceara, Rio Grande do Norte, Paraiba, Pernambuco, Alagoas, Bahia, Espirito Santo, Rio de Janeiro, São Paulo and Paraná. ORIENTATION - The Ministry of Health advises pregnant women to adopt measures to reduce the presence of Aedes aegypti, with the elimination of breeding sites , and protect themselves from mosquito exposure, keeping doors and closed or screened windows, wear pants and shirt sleeve and use repellents allowed for pregnant women. Distribution of reported cases of microcephaly by UF until February 27, 2016 Regions and Federative Units Microcephaly cases and / or malformations suggestive of congenital infection Total accumulated 1of reported cases from 2015 to 2016 research confirmed 2.3 discarded 4 Brazil 4,222 641 1,046 5,909 Alagoas 92 30 100 222 Bahia 603 136 78 817 Ceará 271 33 48 352 Maranhão 148 25 19 192 Paraíba 441 63 306 810 Pernambuco 1,232 215 225 1,672 Piauí 77 46 15 138 large northern river 281 77 25 383 Sergipe 180 0 12 192 Northeast 3,325 625 828 4,778 Holy Spirit 69 3 8 80 Minas Gerais 28 0 39 67 Rio de Janeiro 255 two 4 261 Sao Paulo 125 * 5 0 41 166 Southeast region 477 5 92 574 Acre 24 0 0 24 Amapá No registry No registry No registry No registry Amazon 7 0 0 7 For 15 1 0 16 Rondônia 6 two 3 11 Roraima 13 0 0 13 Tocantins 99 0 17 116 North region 164 3 20 187 Federal district 8 0 18 26 Goiás 79 6 14 99 Mato Grosso 125 0 52 177 Mato Grosso do Sul 6 1 5 12 Midwest region 218 7 89 314 Paraná 3 0 15 18 Santa Catarina 0 0 1 1 Rio Grande do Sul 35 1 1 37 South region 38 1 17 56 Source: Health Departments of the States and the Federal District (updated data until 02/27/2016). 1 Cumulative number of reported cases that met the definition of previous operating case (33 cm), and the definitions adopted in Surveillance Protocol (from 12/09/2015) that defined the Head Circumference 32 cm for newborns 37 or more weeks of gestation and other protocol definitions. 2 present typical changes: indicative of congenital infection, such as intracranial calcifications, dilation of cerebral ventricles or changes in posterior fossa and other clinical signs observed by any imaging method or identification of Zika virus in laboratory tests. 3 were confirmed 82 cases by specific laboratory criteria for Zika (PCR and serology technique) virus. 4 Discarded have normal exams by presenting microcephaly and / or congenital malformations by non-infectious causes or does not meet the case definitions. * 5 As stated by the Epidemiological Surveillance Center "Prof. Alexandre Vranjac ", the State Secretary of Health of São Paulo, 125 cases are under investigation for congenital infection. Of these, 29 are possibly associated with infection by Zika virus, but have not yet been finalized investigations. Source: Health Departments of the States and the Federal District (updated data until 02/27/2016).
  11. Registration Date: 03/01/2016 19:03:45 the amended 03/01/2016 19:03:30 theINQUIRE Health investigates 4,222 suspected cases of microcephaly in the countryThey are being investigated all cases of microcephaly and other disorders of the central nervous system, including the possible relationship with the Zika virus and other congenital infections The Ministry of Health and the states investigating 4,222 suspected cases of microcephaly across the country.This represents 71.5% of reported cases. The new report released on Tuesday (1st) also points to 1,046 notifications have been discarded and 641 confirmed for microcephaly and other nervous system disorders, suggestive of congenital infection. In all, 5,909 suspected cases of microcephaly were recorded until 27 February. http://portalsaude.saude.gov.br/index.php/cidadao/principal/agencia-saude/22396-saude-investiga-4-222-casos-suspeitos-de-microcefalia-no-pais
  12. Wed Mar 2, 2016 3:55am ESTRelated: HEALTHSlovakia confirms first case of Zika virus in country: ministerBRATISLAVA An aedes aegypti mosquitoes is seen in The Gorgas Memorial institute for Health Studies laboratory as they conduct a research on preventing the spread of the Zika virus and other mosquito-borne diseases in Panama City February 4, 2016.REUTERS/CARLOS JASSO A Slovak woman returning from South America was confirmed as the first case of the Zika virus in the country, Slovak Health Minister Viliam Cislak said on Wednesday. The World Health Organization declared the Zika outbreak linked to thousands of birth defects in Brazil an international health emergency on Feb. 1, although much about the virus remains unknown. "Test results of the patient hospitalized with a suspected Zika virus last week in Presov, eastern Slovakia, were positive," Cislak told reporters. "The patient is in good health and does not require further treatment," he said. The first two cases of the mosquito-borne Zika virus were confirmed last week in the neighboring Czech Republic, in a man returning from Martinique and a woman who traveled to the Dominican Republic. Much remains unclear about the virus, including whether it causes microcephaly in babies, a condition defined by unusually small heads that can result in developmental problems. (Reporting by Tatiana Jancarikova; Editing by Hugh Lawson)
  13. A Slovak woman returning from South America was confirmed as the first case of the Zika virus in the country, Slovak Health Minister Viliam Cislak said on Wednesday. The World Health Organization declared the Zika outbreak linked to thousands of birth defects in Brazil an international health emergency on Feb. 1, although much about the virus remains unknown. "Test results of the patient hospitalized with a suspected Zika virus last week in Presov, eastern Slovakia, were positive," Cislak told reporters. http://www.reuters.com/article/us-health-zika-slovakia-idUSKCN0W40PM
  14. Sequence map updated https://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en
  15. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KT381874.1|Zika virus strain Zika1697_BR-RJ/2015 envelope protein gene, partial cds440440100%5e-120100%KT381874.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds424424100%5e-11599%KU729218.1Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds424424100%5e-11599%KU761564.1Select seq gb|KU740184.1|Zika virus isolate GD01 polyprotein gene, complete cds424424100%5e-11599%KU740184.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome424424100%5e-11599%KU527068.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds424424100%5e-11599%KU646828.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds424424100%5e-11599%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome424424100%5e-11599%KU509998.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds424424100%5e-11599%KU365778.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds424424100%5e-11599%KU312315.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds424424100%5e-11599%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds424424100%5e-11599%KU312313.1Select seq gb|KM212966.1|Zika virus isolate NC13(FP)-26112013-22072 glycoprotein gene, partial cds424424100%5e-11599%KM212966.1Select seq gb|KJ579441.1|Zika virus isolate PF13-CP221013c polyprotein gene, partial cds424424100%5e-11599%KJ579441.1Select seq dbj|AB908162.1|Zika virus gene for polyprotein, partial cds, strain: ZIKV Hu/Tahiti/01u/2014NIID424424100%5e-11599%AB908162.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome418418100%2e-11398%KU744693.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome418418100%2e-11398%KU497555.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome418418100%2e-11398%KU707826.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds418418100%2e-11398%KU646827.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds418418100%2e-11398%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds418418100%2e-11398%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome418418100%2e-11398%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds418418100%2e-11398%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds418418100%2e-11398%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds418418100%2e-11398%KU365777.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds418418100%2e-11398%KU312312.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome418418100%2e-11398%KU321639.1Select seq gb|KM212965.1|Zika virus isolate NC13(FP)-20112013-22015 glycoprotein gene, partial cds418418100%2e-11398%KM212965.1Select seq gb|KM212964.1|Zika virus isolate NC14-17042014-4554 glycoprotein gene, partial cds418418100%2e-11398%KM212964.1Select seq gb|KM212963.1|Zika virus isolate NC14-23012014-250 glycoprotein gene, partial cds418418100%2e-11398%KM212963.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds418418100%2e-11398%KJ634273.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds418418100%2e-11398%KJ776791.1Select seq gb|KJ680134.1|Zika virus strain PF13-091213-121 polyprotein gene, partial cds418418100%2e-11398%KJ680134.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome412412100%1e-11198%KU681081.3Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds412412100%1e-11198%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds412412100%1e-11198%JN860885.1Select seq gb|KU729217.1|Zika virus isolate BeH823339 polyprotein gene, complete cds407407100%5e-11097%KU729217.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome401401100%2e-10897%KU681082.3Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds401401100%2e-10897%EU545988.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds39239295%1e-10598%KU686218.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds351351100%3e-9393%HQ234499.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds307307100%6e-8090%HQ234500.1
  16. LOCUS KT381874 238 bp RNA linear VRL 14-FEB-2016 DEFINITION Zika virus strain Zika1697_BR-RJ/2015 envelope protein gene, partial cds. ACCESSION KT381874 VERSION KT381874.1 GI:987919162 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 238) AUTHORS Sequeira,P.C., Mendonca,M.C.L., Brasil,P., Calvet,G., Alves,S.S., Fabri,A.A., Araujo,E.S.M., Santos,F.B.D., Nogueira,R.M.R. and Filippis,A.M.B. TITLE Detection of Zika RNA in cerebrospinal fluid (CSF) from a patient with neurological manifestations during Zika outbreak in Rio de Janeiro, Brazil JOURNAL Unpublished REFERENCE 2 (bases 1 to 238) AUTHORS Sequeira,P.C., Mendonca,M.C.L., Brasil,P., Calvet,G., Alves,S.S., Fabri,A.A., Araujo,E.S.M., Santos,F.B.D., Nogueira,R.M.R. and Filippis,A.M.B. TITLE Direct Submission JOURNAL Submitted (11-AUG-2015) Oswaldo Cruz Institute, Oswaldo Cruz Foundation, Av. Brasil, 4365 - Pavilhao Helio e Peggy Pereira, B103, Rio de Janeiro, RJ 21045-900, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..238 /organism="Zika virus" /mol_type="genomic RNA" /strain="Zika1697_BR-RJ/2015" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="2015" /note="genotype: Asian" CDS <1..>238 /codon_start=2 /product="envelope protein" /protein_id="AME17706.1" /db_xref="GI:987919163" /translation="CIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELV TTTVSNMAEVRSYCYEVSISDMASDSRCPTQGEAY" ORIGIN 1 gtgcatagga gtcagcaata gggactttgt ggaaggtatg tcaggtggga cttgggttga 61 tgttgtcttg gaacatggag gttgtgtcac cgtaatggca caggacaaac cgactgtcga 121 catagagctg gttacaacaa cagtcagcaa catggcggag gtaagatcct actgctatga 181 ggtctccata tcagacatgg cttcggacag ccgctgccca acacaaggtg aagcctac
  17. LOCUS KT381874 238 bp RNA linear VRL 14-FEB-2016 DEFINITION Zika virus strain Zika1697_BR-RJ/2015 envelope protein gene, partial cds. ACCESSION KT381874 VERSION KT381874.1 GI:987919162 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 238) AUTHORS Sequeira,P.C., Mendonca,M.C.L., Brasil,P., Calvet,G., Alves,S.S., Fabri,A.A., Araujo,E.S.M., Santos,F.B.D., Nogueira,R.M.R. and Filippis,A.M.B. TITLE Detection of Zika RNA in cerebrospinal fluid (CSF) from a patient with neurological manifestations during Zika outbreak in Rio de Janeiro, Brazil JOURNAL Unpublished REFERENCE 2 (bases 1 to 238) AUTHORS Sequeira,P.C., Mendonca,M.C.L., Brasil,P., Calvet,G., Alves,S.S., Fabri,A.A., Araujo,E.S.M., Santos,F.B.D., Nogueira,R.M.R. and Filippis,A.M.B. TITLE Direct Submission JOURNAL Submitted (11-AUG-2015) Oswaldo Cruz Institute, Oswaldo Cruz Foundation, Av. Brasil, 4365 - Pavilhao Helio e Peggy Pereira, B103, Rio de Janeiro, RJ 21045-900, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..238 /organism="Zika virus" /mol_type="genomic RNA" /strain="Zika1697_BR-RJ/2015" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="2015" /note="genotype: Asian"
  18. Oswaldo Cruz Institute released a partial sequence from cerebral spinal fluid of Rio de Janeiro case, Zika1697_BR-RJ/2015, collected in mid-2015.http://www.ncbi.nlm.nih.gov/nuccore/KT381874
  19. Bexar Co 3 Dallas Co 4 Harris Co 8 Tarrant Co 1 Travis Co 2 Total 18 https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.