Everything posted by niman
-
2014 Missouri D68 Enterovirus Matches Novel Sub-clade Linked To AFP
Items: 1 to 100 of 1112<< First< PrevPage of 12Next >Last >> Select item 9130751621.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO54/2014, complete genome 7,285 bp linear RNA Accession: KT347223.1 GI: 913075162GenBankFASTAGraphics Select item 9130751642.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO58/2014, complete genome 7,285 bp linear RNA Accession: KT347224.1 GI: 913075164GenBankFASTAGraphics Select item 9130751663.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO25/2014, complete genome 7,285 bp linear RNA Accession: KT347225.1 GI: 913075166GenBankFASTAGraphics Select item 9130751684.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO53/2014, complete genome 7,285 bp linear RNA Accession: KT347226.1 GI: 913075168GenBankFASTAGraphics Select item 9130751705.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO26/2014, complete genome 7,285 bp linear RNA Accession: KT347227.1 GI: 913075170GenBankFASTAGraphics Select item 9130751726.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO15/2014, complete genome 7,285 bp linear RNA Accession: KT347228.1 GI: 913075172GenBankFASTAGraphics Select item 9130751747.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO31/2014, complete genome 7,285 bp linear RNA Accession: KT347229.1 GI: 913075174GenBankFASTAGraphics Select item 9130751768.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO48/2014, complete genome 7,285 bp linear RNA Accession: KT347230.1 GI: 913075176GenBankFASTAGraphics Select item 9130751789.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO40/2014, complete genome 6,946 bp linear RNA Accession: KT347231.1 GI: 913075178GenBankFASTAGraphics Select item 91307518010.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO46/2014, complete genome 7,285 bp linear RNA Accession: KT347232.1 GI: 913075180GenBankFASTAGraphics Select item 91307518211.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO19/2014, complete genome 7,285 bp linear RNA Accession: KT347233.1 GI: 913075182GenBankFASTAGraphics Select item 91307518412.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO1/2014, complete genome 7,285 bp linear RNA Accession: KT347234.1 GI: 913075184GenBankFASTAGraphics Select item 91307518613.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO4/2014, complete genome 7,285 bp linear RNA Accession: KT347235.1 GI: 913075186GenBankFASTAGraphics Select item 91307518814.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO39/2014, complete genome 7,285 bp linear RNA Accession: KT347236.1 GI: 913075188GenBankFASTAGraphics Select item 91307519015.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO30/2014, complete genome 7,285 bp linear RNA Accession: KT347237.1 GI: 913075190GenBankFASTAGraphics Select item 91307519216.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO32/2014, complete genome 7,286 bp linear RNA Accession: KT347238.1 GI: 913075192GenBankFASTAGraphics Select item 91307519417.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO6/2014, complete genome 7,285 bp linear RNA Accession: KT347239.1 GI: 913075194GenBankFASTAGraphics Select item 91307519618.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO49/2014, complete genome 7,285 bp linear RNA Accession: KT347240.1 GI: 913075196GenBankFASTAGraphics Select item 91307519819.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO18/2014, complete genome 7,285 bp linear RNA Accession: KT347241.1 GI: 913075198GenBankFASTAGraphics Select item 91307520020.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO5/2014, complete genome 7,285 bp linear RNA Accession: KT347242.1 GI: 913075200GenBankFASTAGraphics Select item 91307520221.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO14/2014, complete genome 7,285 bp linear RNA Accession: KT347243.1 GI: 913075202GenBankFASTAGraphics Select item 91307520422.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO3/2014, complete genome 7,285 bp linear RNA Accession: KT347244.1 GI: 913075204GenBankFASTAGraphics Select item 91307520623.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO59/2014, complete genome 7,285 bp linear RNA Accession: KT347245.1 GI: 913075206GenBankFASTAGraphics Select item 91307520824.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO56/2014, complete genome 7,285 bp linear RNA Accession: KT347246.1 GI: 913075208GenBankFASTAGraphics Select item 91307521025.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO41/2014, complete genome 7,285 bp linear RNA Accession: KT347247.1 GI: 913075210GenBankFASTAGraphics Select item 91307521226.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO13/2014, complete genome 7,285 bp linear RNA Accession: KT347248.1 GI: 913075212GenBankFASTAGraphics Select item 91307521427.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO16/2014, complete genome 7,285 bp linear RNA Accession: KT347249.1 GI: 913075214GenBankFASTAGraphics Select item 91307521628.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO37/2014, complete genome 7,285 bp linear RNA Accession: KT347250.1 GI: 913075216GenBankFASTAGraphics Select item 91307521829.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO47/2014, complete genome 7,285 bp linear RNA Accession: KT347251.1 GI: 913075218GenBankFASTAGraphics Select item 91307522030.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO51/2014, complete genome 7,285 bp linear RNA Accession: KT347252.1 GI: 913075220GenBankFASTAGraphics Select item 91307522231.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO24/2014, complete genome 7,285 bp linear RNA Accession: KT347253.1 GI: 913075222GenBankFASTAGraphics Select item 91307522432.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO33/2014, complete genome 7,285 bp linear RNA Accession: KT347254.1 GI: 913075224GenBankFASTAGraphics Select item 91307522633.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO23/2014, complete genome 7,285 bp linear RNA Accession: KT347255.1 GI: 913075226GenBankFASTAGraphics Select item 91307522834.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO20/2014, complete genome 7,285 bp linear RNA Accession: KT347256.1 GI: 913075228GenBankFASTAGraphics Select item 91307523035.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO10/2014, complete genome 7,285 bp linear RNA Accession: KT347257.1 GI: 913075230GenBankFASTAGraphics Select item 91307523236.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO12/2014, complete genome 7,285 bp linear RNA Accession: KT347258.1 GI: 913075232GenBankFASTAGraphics Select item 91307523437.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO9/2014, complete genome 7,285 bp linear RNA Accession: KT347259.1 GI: 913075234GenBankFASTAGraphics Select item 91307523638.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO11/2014, complete genome 7,285 bp linear RNA Accession: KT347260.1 GI: 913075236GenBankFASTAGraphics Select item 91307523839.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO60/2014, complete genome 7,285 bp linear RNA Accession: KT347261.1 GI: 913075238GenBankFASTAGraphics Select item 91307524040.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO57/2014, complete genome 7,285 bp linear RNA Accession: KT347262.1 GI: 913075240GenBankFASTAGraphics Select item 91307524241.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO28/2014, complete genome 7,285 bp linear RNA Accession: KT347263.1 GI: 913075242GenBankFASTAGraphics Select item 91307524442.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO22/2014, complete genome 7,285 bp linear RNA Accession: KT347264.1 GI: 913075244GenBankFASTAGraphics Select item 91307524643.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO36/2014, complete genome 7,286 bp linear RNA Accession: KT347265.1 GI: 913075246GenBankFASTAGraphics Select item 91307524744.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO27/2014, complete genome 7,285 bp linear RNA Accession: KT347266.1 GI: 913075247GenBankFASTAGraphics Select item 91307524945.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO34/2014, complete genome 7,285 bp linear RNA Accession: KT347267.1 GI: 913075249GenBankFASTAGraphics Select item 91307525146.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO50/2014, complete genome 7,285 bp linear RNA Accession: KT347268.1 GI: 913075251GenBankFASTAGraphics Select item 91307525347.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO45/2014, complete genome 7,285 bp linear RNA Accession: KT347269.1 GI: 913075253GenBankFASTAGraphics Select item 91307525548.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO17/2014, complete genome 7,285 bp linear RNA Accession: KT347270.1 GI: 913075255GenBankFASTAGraphics Select item 91307525749.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO7/2014, complete genome 7,285 bp linear RNA Accession: KT347271.1 GI: 913075257GenBankFASTAGraphics Select item 91307525950.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO44/2014, complete genome 7,285 bp linear RNA Accession: KT347272.1 GI: 913075259GenBankFASTAGraphics Select item 91307526151.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO42/2014, complete genome 7,285 bp linear RNA Accession: KT347273.1 GI: 913075261GenBankFASTAGraphics Select item 91307526352.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO43/2014, complete genome 7,285 bp linear RNA Accession: KT347274.1 GI: 913075263GenBankFASTAGraphics Select item 91307526553.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO35/2014, complete genome 7,285 bp linear RNA Accession: KT347275.1 GI: 913075265GenBankFASTAGraphics Select item 91307526754.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO21/2014, complete genome 7,285 bp linear RNA Accession: KT347276.1 GI: 913075267GenBankFASTAGraphics Select item 91307526955.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO2/2014, complete genome 7,285 bp linear RNA Accession: KT347277.1 GI: 913075269GenBankFASTAGraphics Select item 91307527156.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO8/2014, complete genome 7,285 bp linear RNA Accession: KT347278.1 GI: 913075271GenBankFASTAGraphics Select item 91307527357.Enterovirus D68 strain EVD68/Homo sapiens/USA/MO38/2014, complete genome 7,285 bp linear RNA Accession: KT347279.1 GI: 913075273GenBankFASTAGraphics
-
2014 Missouri D68 Enterovirus Matches Novel Sub-clade Linked To AFP
JCVI has released 57 full D68 sequences from 2014 Missouri D68 collections and virtually all represent the novel sub-clade associated with acute flaccid paralysis.
-
MERS Outbreak Centered In Riyadh KSA
- MERS Outbreak Centered In Riyadh KSA
- MERS Outbreak Centered In Riyadh KSA
Saudi closes emergency ward after spike in MERS virus cases By ABDULLAH AL-SHIHRI6 hours ago RIYADH, Saudi Arabia (AP) — Saudi authorities closed an emergency ward in one of the kingdom's largest hospitals after at least 46 people, including hospital staff, contracted the potentially fatal Middle East respiratory syndrome, also known as MERS, a health official said Wednesday. Dr. Hanan Balkhi of the Health Ministry's department for infectious diseases said that of the 46 people infected at King Abdulaziz Medical City in the capital, Riyadh, 15 were medical staff. Another 20 people showing symptoms are being tested, she added. The patients from the ward, set to remain closed for two weeks, are being transferred to other hospitals, she said. The Health Ministry recorded three new MERS deaths in Riyadh on Wednesday. The victims were all Saudi males ranging in age from 65 to 86, according the ministry's website. That brings the total number of deaths to 483 since the virus was first identified in 2012. The ministry said that 1,118 cases have been registered nationwide; 592 have recovered and the rest — 43— are being treated. It appears the three who died are from among the 46 people diagnosed with MERS at the emergency ward that was closed. Most MERS cases have been diagnosed in the Middle East, primarily in Saudi Arabia. The MERS virus belongs to the family of viruses known as coronaviruses, which include both the common cold and SARS, or severe acute respiratory syndrome. SARS killed some 800 people in a global outbreak in 2003. The MERS virus can cause symptoms such as fever, breathing problems, pneumonia and kidney failure. ___ This story has been corrected to show Saudi officials issued statements Tuesday and Wednesday about the disease. http://news.yahoo.com/saudi-closes-emergency-ward-spike-mers-virus-cases-092008088.html- MERS Outbreak Centered In Riyadh KSA
KATIE M. PALMER SCIENCE DATE OF PUBLICATION: 08.18.15.08.18.15 TIME OF PUBLICATION: 1:25 PM.1:25 PMSAUDI ARABIA IS ON THE CUSP OF ANOTHER MERS OUTBREAKIN THE LAST 24 hours, Saudi Arabia’s Ministry of Health has reported ten new cases of MERS in the capital city of Riyadh, and one death from the virus. Those numbers follow reports of nine new cases yesterday, along with two deaths. According to Helen Branswell, one of WIRED’s favorite infectious disease reporters, the state hasn’t seen that many new infections in a day since theheight of the MERS outbreak last year. This is especially concerning as travelers begin to arrive for the hajj, the annual pilgrimage to Islam’s holy sites that falls between September 20 and 25 this year. Over the course of the pilgrimage, Saudia Arabia hosts more than 2 million people, who sleep in hot shared tents and travel barefoot toward their destinations. Those conditions make it extraordinarily easy for a virus like MERS to spread—especially devastating because MERS kills about 50 percent of the people it infects. The country has not yet posted itshealth regulations for 2015 hajj travelers. http://www.wired.com/2015/08/saudi-arabia-may-cusp-another-mers-outbreak/- MERS Outbreak Centered In Riyadh KSA
Surge in new MERS cases recorded in Saudi capital RiyadhWed, Aug 19 05:56 AM BSTRIYADH (Reuters) - Saudi Arabia's Health Ministry has confirmed 58 new cases of Middle East Respiratory Syndrome (MERS) in the country since the start of August, data on its website shows, the highest rise in recorded infections since February. The 10 new cases it announced late on Tuesday represented the biggest daily jump in confirmed new infections in Saudi Arabia since May 2014, a month in which 210 people were recorded contracting the disease at the height of its biggest outbreak. MERS, first identified in 2012 and mostly found so far in Saudi Arabia despite outbreaks elsewhere, is a SARS-like disease that causes fever and coughing in some. Although it does not pass easily between humans, the disease has a high mortality rate, with 480 of the 1,115 people Saudi Arabia has confirmed as having caught MERS since 2012 dying from it. Almost all the new cases of MERS confirmed over the past week have occurred in Riyadh, and included some health care workers. King Abdulaziz Medical City, a group of hospitals owned by the Saudi Arabian National Guard, has put its emergency and outpatient departments on alert after a surge in cases there, National Guard officials were quoted saying in Arab News daily. http://uk.mobile.reuters.com/article/idUKKCN0QO0B120150819?irpc=932 (Reporting By Angus McDowall; Editing by Shri Navaratnam)- MERS Outbreak Centered In Riyadh KSA
Published Date: 2015-08-17 21:42:52Subject: PRO/AH/EDR> MERS-CoV (108): Saudi Arabia, RFI Archive Number: 20150817.3584526 MERS-COV (108): SAUDI ARABIA, REQUEST FOR INFORMATION*****************************************************A ProMED-mail posthttp://www.promedmail.orgProMED-mail is a program of theInternational Society for Infectious Diseaseshttp://www.isid.orgIn this update:[1] Saudi Arabia - MOH 13-17 Aug 2015, RFI[2] Saudi Arabia - MOH press release - 17 Aug 2015, RFI[3] Saudi Arabia - MOH press release - 16 Aug 2015******[1] Saudi Arabia - MOH 13-17 Aug 2015, RFIDate: 17 Aug 2015Source: Saudi MOH [edited]http://www.moh.gov.sa/en/CCC/PressReleases/Pages/default.aspx?PageIndex=1[Sincere apologies for delays in some of this information due to serious technical difficulties (personal computer issues). - Mod.MPP]As of noon today, 17 Aug 2015, there have been a total of:1105 laboratory confirmed cases of MERS-CoV infection, including479 deaths,590 recoveries, and36 currently active cases including 3 on home isolation.Daily changes in case counts since the last update include:17 Aug 2015 http://www.moh.gov.sa/en/CCC/PressReleases/Pages/Statistics-2015-08-17-001.aspx9 newly confirmed cases - all in Riyadh, 1 healthcare worker, 4 in critical condition, 5 stable, all with history of contact with other known case(s)2 newly reported fatalities - both in Riyadh, both with history of co-morbidities1 newly reported recovery - in Riyadh, history of co-morbidities16 Aug 2015http://www.moh.gov.sa/en/CCC/PressReleases/Pages/Statistics-2015-08-16-001.aspx4 newly confirmed cases - 3 in Riyadh, in Najran (Expat - healthcare worker, denies contact with other known cases), 1 noted to be fatal at time of report, 3 stable, 3 with possible history of contact with other case(s) under review (all 3 from Riyadh), 2 newly reported fatalities - 1 in Riyadh (newly reported case), 1 in Abha1 newly reported recovery - in Riyadh15 Aug 2015http://www.moh.gov.sa/en/CCC/PressReleases/Pages/Statistics-2015-08-15-001.aspx1 newly confirmed case - in Riyadh, possible history of contact with other known case(s) under review0 newly reported fatalities and0 newly reported recoveries14 Aug 2015http://www.moh.gov.sa/en/CCC/PressReleases/Pages/Statistics-2015-08-14-001.aspx4 newly confirmed cases - all in Riyadh, includes 2-year-old child, 3 cases with history of contact with other known case(s), all stable1 newly reported fatality - in Riyadh, history of co-morbidities0 newly reported recoveries13 Aug 2015 [in Arabic]http://www.moh.gov.sa/ccc/pressreleases/pages/statistics-2015-08-13-001.aspx1 newly confirmed case - in Riyadh, in critical condition, possible history of contact with other known case(s) under review0 newly reported fatalities0 newly reported recoveries[reported case fatality rate 43.3 percent]--Communicated by:ProMED-mail<[email protected]>[There is clearly a major outbreak ongoing in Riyadh that appears to have started around 21 Jul 2015. Since 21 Jul 2015, there have been a total of 58 cases of MERS-CoV reported by Saudi Arabia of which 53 (91.4 percent) were from Riyadh. Since the beginning of August 2015, there have been a total of 48 cases reported in Saudi Arabia of which 45 cases (93.8 percent) were from Riyadh. I refer readers to section [2] below where the Saudi Press Agency report from the MOH discusses the ongoing outbreak in the King Abdul Aziz Medical City, involving exposures in the Emergency Department, other Outpatient Departments, and on the hospital wards, with overcrowding, including of outside visitors, and reduced isolation capabilities in these areas. It does appear as though the outbreak has been escalating, with the identification of 9 newly confirmed cases in the past 24 hours and the identification of 27 new cases in the past week.Of note is that on 16 Aug 2014 there was a single case in a healthcare worker from Najran who denied history of contact with known cases of MERS-CoV in the 2 weeks prior to onset of illness. It is noteworthy because on 4 Aug 2015 there was another case in a healthcare worker from Najran who also denied a history of contact with known case of MERS-CoV in the 2 weeks prior to onset of illness. One wonders if there is ongoing transmission in Najran that is being missed. ProMED-mail would greatly appreciate more information on the situation in Najran.A map showing the locations of the newly reported cases can be found at the source URL above. The HealthMap/ProMED-mail map of Saudi Arabia can be found at http://healthmap.org/promed/p/131. - Mod.MPP]******[2] Saudi Arabia - MOH press release, 17 Aug 2015, RFIDate: 17 Aug 2015Source: SPA - Saudi Press Agency [machine translation, edited]http://www.spa.gov.sa/details.php?id=1388728&lite=On [17 Aug 2015], the Preventive Medicine Management and Infection Control and Health Affairs at the Ministry of National Guard revealed the existence of 31 MERS-CoV infected individuals at the King Abdul Aziz Medical City in Riyadh, associated with patients who visited the Emergency Medicine departments in addition to 4 cases among healthcare practitioners during the period June 2015 through [14 Aug 2015].The Executive Director of the Department of Preventive Medicine and Infection Control and Health Affairs at the Ministry of National Guard [Dr. Hanan?] and a Member of the National Scientific Committee of Infectious Diseases at the Ministry of Health and the National team member explained that there is an ongoing epidemiology and infectious diseases investigation. They have been monitoring the number of suspected cases during the past 48 hours, and, currently, all the clinical and laboratory tests needed to follow their health status [have been] conducted. [To date - 14 Aug 2015] there have been 12 fatalities [associated with this outbreak]. This type of respiratory virus is the most deadly to those who suffer from chronic diseases such as diabetes, stress and failure kidney.Dr. Hanan reported that affected healthcare workers have not included fatalities, and the majority of them have been under home isolation.[Dr. Hanan] said: "Because of the latest developments about the increasing number of cases of MERS-CoV infection, and due to the large daily congestion [24/7] in the emergency medicine departments of King Abdulaziz Medical City in Riyadh, and the difficulty of isolation [of patients] in these overcrowded sections, the National Guard has implemented strict measures to reduce the number of patients in the emergency departments and outpatient clinics as well as to stop the operations of non-emergency and urgent care. In addition, there have been 3 isolation wings in the hospital designated to accommodate suspected and confirmed cases [of MERS-CoV infection] [suspected and confirmed in separate or the same wings? - Mod.MPP] and the allocation of an intensive case unit to accommodate and isolate those cases in critical condition as well as reducing and limiting visiting hours and the number of visitors.Dr. Hanan stressed that they emphasized that healthcare practitioners consistently adhered to infection control measures according to internationally established standards, policies and procedures recommended by the Command and Control Center [CCC] at the Ministry of Health, since they [healthcare workers] are the most vulnerable to infection as a result of contact with infected patients, indicating that the epidemiology plan will be evaluated on a daily basis and adjusted according to the need for new developments.Dr. Hanan showed that it is recorded that infected cases of MERS-CoV came from various health sectors and were presenting on a daily basis to the Ministry of Health system, and there was communication with the Command and Control Center at the Ministry of Health continuously in order to activate the procedures to be followed at the national level to fight infection and reduce the spread of infectious diseases. [Dr. Hanan] confirmed that the Ministry of Health of the National Guard Affairs was dealing with the current situation with complete transparency and high professional norms in the ongoing cooperation between them and the Ministry of Health and the concerned authorities.[Dr. Hanan] noted the importance of active cooperation by patients and clients and visitors to the civilian King Abdulaziz Medical City in Riyadh by following the awareness tips that are distributed across publications and presented through visual aids in the majority of media channels and social networking sites on the avoidance of going to emergency departments, except in critical situations or injuries that require ambulatory procedures, in addition to the reduction of visits to [hospitalized] inpatients as much as possible, and a commitment to apply the correct ways to avoid the spread of droplets caused by coughing and sneezing, as well as being careful to wear a mask in case of colds or flu and not mixing in public places.--Communicated by:ProMED-mail<[email protected]>[Reading the above press release is a deja vu of the press releases surrounding the outbreak in South Korea; it appears as though there has been significant transmission of the MERS-CoV in the emergency departments [EDs], outpatient departments [OPDs] and among visitors to individuals originally admitted to the hospital for other reasons. So a question that arises is have they (the public health system) in Riyadh identified superspreaders in this ongoing outbreak, similar to those identified in the recent outbreak in South Korea, and given the recent experience in South Korea, are we now seeing more superspreaders than in earlier outbreaks in 2012, 2013 and 2014? Has the virus changed? Or has the virus been "lucky" in finding the perfect storm situations and taking advantage of them (overcrowding of healthcare institutions with prolonged exposure in EDs, OPDs, and crowded hospital wards with multiple patients in rooms and multiple visitors in quasi residence with their hospitalized family members)?ProMED-mail would welcome information on the ongoing epidemiologic investigations in Riyadh from knowledgeable individuals in the area. - Mod.MPP]******[3] Saudi Arabia - MOH press release - 16 Aug 2015Date: 16 Aug 2015Source: Saudi MOH [edited]http://www.moh.gov.sa/en/Ministry/MediaCenter/News/Pages/News-2015-08-16-001.aspxMOH: "21 MERS-CoV Cases Reported Last Week" [16 Aug 2015]-----------------------------In its weekly press release, the Ministry of Health (MOH) announced that 20 confirmed cases of the Middle East respiratory syndrome coronavirus (MERS-CoV) have been reported in Riyadh and another case in Abha last week, from [9-15 Aug 2015], corresponding to Shawwal 24th to 30th, 1436H (the 33rd International Week)."During the same period, 844 samples were tested for coronavirus at the MOH laboratories across the Kingdom, including 5 cases at the MOH hospitals and 16 other cases at the other health sectors. The total number of visits by public health teams to persons in contact with positive cases was 21," the Ministry said, adding that the number of persons who were in contact with positive cases at homes was 119, and the number of visits by the Ministry of Agriculture (MOA) was one.The Ministry also announced that 588 cases out of the total of 1092 confirmed cases have been cured, at a rate of 54.8 percent. There are 25 other cases still receiving treatment, and 4 cases have been isolated at home.The Command and Control Center (CCC) keeps up its efforts around the clock by carrying out epidemiological surveillance tasks, making sure that all governmental and private health facilities abide by infection control measures, as well as coordinating with the relevant governmental sectors, international health organizations, including the World Health Organization (WHO), and think-tanks to follow up on all developments regarding coronavirus. Over and above, the Ministry keeps up its efforts and full coordination with the Ministry of Agriculture (MOA) to launch anti-coronavirus awareness campaigns at gathering places of camels to urge camel owners and shepherds to be careful and take protective measures when dealing with camels. Finally, the MOH highlighted that it will remain committed to the preset preparations and cooperative efforts with other parties, including the Saudi community and healthcare staff, who represent the cornerstone in this regard.--Communicated by:ProMED-mail<[email protected]>[The above overview of the week's experience demonstrates the intensive screening effort that has gone on (844 specimens were tested for evidence of MERS-CoV infection, and 21 cases were confirmed during the 7-day period from 9-15 Aug 2015).On an additional note, the situation in South Korea remains unchanged, with no new cases reported since 4 Jul 2015 and one individual still reported as not being MERS-CoV negative. (http://www.mw.go.kr/front_new/al/sal0301vw.jsp?PAR_MENU_ID=04&MENU_ID=0403&page=1&CONT_SEQ=324855). - Mod.MPP] See AlsoMERS-CoV (107): Saudi Arabia, South Korea, WHO 20150813.3575351MERS-CoV (106): Saudi Arabia, South Korea 20150811.3571792MERS-CoV (105): Saudi Arabia, RFI 20150810.3569375MERS-CoV (103): Saudi Arabia 20150809.3567654MERS-CoV (102): Saudi Arabia, South Korea 20150808.3566659MERS-CoV (101): Saudi Arabia, South Korea, WHO, RFI 20150807.3565074MERS-CoV (100): Saudi Arabia, South Korea 20150804.3558326MERS-CoV (99): South Korea, Saudi Arabia, MOH 20150804.3556273MERS-CoV (98): Saudi Arabia, South Korea, MOH, WHO 20150730.3545902MERS-CoV (90): South Korea, Saudi Arabia, Thailand, Philippines, WHO 20150713.3505516MERS-CoV (89): Philippines, South Korea, Saudi Arabia, WHO 20150709.3496123MERS-CoV (88): Philippines ex Middle East, South Korea, Saudi Arabia, RFI 20150706.3488115MERS-CoV (82): South Korea, Saudi Arabia, Thailand, RFI 20150629.3472461MERS-CoV (79): South Korea, Saudi Arabia, UAE, WHO, RFI 20150626.3467405MERS-CoV (76): South Korea, Saudi Arabia, Thailand, WHO 20150624.3459401MERS-CoV (75): South Korea, Saudi Arabia, Thailand 20150623.3457227MERS-CoV (74): South Korea, Saudi Arabia, Thailand ex Oman 20150621.3454450MERS-CoV (73): South Korea, Saudi Arabia, Thailand, WHO, RFI 20150620.3453094MERS-CoV (72): South Korea, Saudi Arabia, Thailand, WHO, RFI 20150619.3451230MERS-CoV (71): Thailand ex Oman, South Korea, Saudi Arabia, UAE 20150618.3447481MERS-CoV (70) - Thailand ex Oman, 1st report, RFI 20150618.3447631MERS-CoV (69): South Korea, Saudi Arabia, WHO NOT PHEIC 20150617.3445791MERS-CoV (68): South Korea, Saudi Arabia, UAE, WHO 20150616.3442296MERS-CoV (61): South Korea, Saudi Arabia, UAE, WHO 20150610.3426177MERS-CoV (59): South Korea, Saudi Arabia, WHO, viral sequencing 20150609.3420029MERS-CoV (57): South Korea, Saudi Arabia, viral sequencing, WHO 20150606.3416003MERS-CoV (56): South Korea, China, Saudi Arabia, Oman, WHO 20150605.3413986MERS-CoV (55): South Korea, Saudi Arabia, WHO, viral sequences 20150604.3411121MERS-CoV (53): South Korea, Saudi Arabia, Qatar, WHO, RFI 20150601.3402059MERS-CoV (52): Oman, Saudi Arabia, South Korea, WHO, RFI 20150531.3399248MERS-CoV (50): South Korea, China ex South Korea conf. Saudi Arabia 20150529.3395374MERS-CoV (49): South Korea, China ex South Korea susp, Saudi Arabia, Qatar 20150528.3393353MERS-CoV (47): South Korea, Saudi Arabia, United Arab Emirates, Qatar, WHO 20150526.3383778MERS-CoV (46): Qatar, Saudi Arabia, RFI 20150523.3381072MERS-CoV (44): S Korea ex Middle East, Saudi Arabia, UAE, WHO, RFI 20150520.3374579MERS-CoV (41): Saudi Arabia, Iran, WHO, RFI 20150508.3350889MERS-CoV (34): Saudi Arabia, Qatar, WHO, sequence, RFI 20150313.3222697MERS-CoV (33): Saudi Arabia, Germany ex UAE, WHO 20150309.3217977MERS-CoV (32): Qatar, Saudi Arabia, RFI 20150309.3216519MERS-CoV (31): Saudi Arabia, Germany ex UAE, RFI 20150308.3215456MERS-CoV (20): Saudi Arabia, Philippines, WHO, RFI 20150213.3165359MERS-CoV (19): Saudi Arabia, Qatar, UAE, Philippines, WHO, RFI 20150212.3160052MERS-CoV (16): Qatar, Saudi Arabia, RFI 20150203.3138313MERS-CoV (04): Oman, Saudi Arabia, RFI 20150108.3079584MERS-CoV (03): Saudi Arabia, new cases, new fatality, Jordan, WHO 20150107.3077259MERS-CoV (01): Saudi Arabia, new cases, new death 20150104.30693832014----MERS-CoV (69): Saudi Arabia, new case, RFI 20141230.3063059MERS-CoV (64): Saudi Arabia, new case, camel workers 2012 20141206.3014451MERS-CoV - Eastern Mediterranean (70): Iran, Saudi Arabia, UAE, RFI 20140527.25013832013----MERS-CoV - Eastern Mediterranean (25): Saudi Arabia, genome 20130612.1768944MERS-CoV - Eastern Mediterranean: Saudi Arabia, new case, RFI 20130518.1721601Novel coronavirus - Eastern Mediterranean (29): MERS-CoV, ICTV nomenclature 20130516.1717833Novel coronavirus - East. Med. (07): Saudi Arabia, UK, Germany 20130221.15541092012----Novel coronavirus - Saudi Arabia (18): WHO, new cases, cluster 20121123.1421664Novel coronavirus - Saudi Arabia: human isolate 20120920.1302733.................................................mpp/msp/mpp- MERS Outbreak Centered In Riyadh KSA
- MERS Outbreak Centered In Riyadh KSA
- MERS Outbreak Centered In Riyadh KSA
Kingdom of Saudi ArabiaMinistry of National GuardHealth AffairsEmail AccessMedia Centerعربي Medical CitieseServicesGeneral GuidelinesHealth AwarenessEducation-TrainingBusiness Centers Home Page > Media Center > News Preventive Measures Upgrade to Address Coronavirus in KAMC-RIn regards to the cases of MERS-Coronavirus at King Abdulaziz Medical City –Riyadh, the Executive Director of Infection Prevention and Control Department at MNG-HA, a member of the National Scientific Committee of Infectious Diseases at the Ministry of Health Dr. Hanan Balkhi, stated that since June 2015 to August 14th, 2015, 31 positive cases have been reported of patients who visited the ER in addition to 4 positive cases of health practitioners. A number of suspected cases have been reported in the last 24 hours as well, which are now subject to extensive clinical and laboratory tests. In addition, the number of confirmed MERS-Coronavirus deaths are 12 cases by the latest statistics, given that this type of respiratory virus is most deadly to those who suffer from chronic diseases such as diabetes, blood pressure and kidney failure. Dr. Hanan Balkhi also pointed out that the confirmed cases amongst health workers were discovered through the conducting an epidemiological investigation, who are now subject to Home Care Quarantine, and no record of death cases have been reported. Furthermore, Dr. Hanan explained that in view of the latest developments about the increasing number of cases of MERS-Coronavirus, and due to the around the clock large numbers of patients in the ER at KAMC-R and the difficulty of applying quarantine measures, preventive measures plans have been upgraded in order to deal with the epidemiology and to control the infection by taking the following measures: Reduce the numbers of patients / return patients in the ER. Reduce the numbers of patients / return patients in the outpatient clinics. Suspend all non-emergency and non-urgent operations and surgeries. Suspend all day case and short stay surgeries. Allocate three wings to accommodate the quarantine of suspected / confirmed cases. Allocate a quarantined Intensive Care Unit to accommodate critical cases. Reduce Visitation Hours and the number of visitors. In addition to the emphasis on health practitioners to comply with all the infection control procedures and standards, since they are the most vulnerable to be infected due to direct contact with infected patients. Note that this epidemiology plan will be evaluated on a daily basis and will be adjusted as required. Dr. Hanan, as a member of the National Scientific Committee of Infectious Diseases at the Ministry of Health pointed out that confirmed cases of MERS-Coronavirus will be recorded from various health sectors on a daily basis on to the Health Electronic Surveillances Network (HESN) at the Ministry of Health, and communication with the Command and Control Center at the Ministry of Health is continuous in order to activate the procedures to be followed at a national level to control infection and reduce the spread of infectious diseases. While confirming that the Ministry of National Guard - Health Affairs is deals with the current situation with complete transparency and high professionalism in collaboration with the Ministry of Health and the concerned authorities. Last but not least, Dr. Hanan highlighted the importance of active cooperation of the patients and visitors to King Abdulaziz Medical City - Riyadh by following the awareness tips that are distributed and presented across through visual aids and social media networks to avoid going to emergency departments, except in critical situations or injuries that require undergoing ambulatory procedures, and to reduce your visits to inpatients as much as possible, and to commit to applying the correct ways to stop the spread of the germs expelled from the mouth and nose through coughing and sneezing in addition to wearing a surgical mask in case of having a cold or a flu while not mixing in public places. http://ngha.med.sa/English/MediaCenter/News/Pages/XVAugVI.aspx- MERS Outbreak Centered In Riyadh KSA
Hospital emerges as epicenter of Riyadh MERS outbreakFiled Under: MERS-CoVLisa Schnirring | Staff Writer | CIDRAP News | Aug 18, 2015Share Tweet LinkedIn Email Print & PDFkingdom_tower_riyadh-peter_dowley.jpgPeter Dowley / Flickr ccThe iconic Kingdom Tower in Riyadh, a city that has seen dozens of recent MERS cases.A quickly growing MERS-CoV outbreak in Riyadh, Saudi Arabia, involves one main hospital, King Abdulaziz Medical City, with at least 31 illnesses since June linked to emergency department (ED) exposure, officials say, and indications of many more to come. Also, the country announced 10 new MERS-CoV (Middle East respiratory syndrome coronavirus) cases today, 9 in Riyadh likely linked to the hospital. Saudi Arabia's Ministry of Health (MOH) started announcing a steady stream of MERS cases at the end of July that has accelerated in recent days, with hints over the past several weeks that healthcare and family clusters are involved. Updates from the World Health Organization (WHO) over the past few weeks have fleshed out some of the hospital exposures, and an update today on 12 Saudi patients revealed that 4 got sick after visiting the ED and 9 acquired MERS-CoV during hospitalization for unrelated conditions at a facility undergoing an outbreak. Main hospital revealedPeter Ben Embarek, PhD, who leads the WHO's MERS response, told CIDRAP News that the vast majority of recent and current cases are related to one hospital, a national guard hospital in Riyadh. He added that there is a small outbreak at another hospital involving five cases, as well as sporadic cases not linked to the main hospital. Ben Embarek said the smaller hospital outbreak is under control. King Abdulaziz Medical City has about 690 beds and was established in 1983 to care for National Guard soldiers and their families. The government-funded hospital was combined with many other medical centers and inaugurated as a "medical city" in 2001. King Abdulaziz Medical City said in an Aug 15 press statement that 31 MERS-CoV infections have been reported in people who visited the facility's ED between June and Aug 14. Dr Hanan Balkhi, the hospital's director of infection prevention and control, said in the statement that, in addition, 4 healthcare workers have tested positive and are in home isolation. The hospital said a number of suspected MERS cases have also been reported and are under investigation. So far 12 deaths have been reported in connection to the outbreak, the hospital said. In announcing steps to curb the spread of the outbreak, the hospital hinted that overcrowding in the ED may be a contributing factor, a pattern that also helped fuel the large hospital-linked outbreak in South Korea this spring and summer. Balkhi said because of the rising number of MERS cases, along with around-the-clock large numbers of patients in the hospital's ED and difficulty applying quarantine measures, the facility will limit the number of patients in the ED and outpatient clinics. It will also suspend all surgeries that aren't urgent, suspend all same-day and short-day surgeries, and set aside special areas to quarantine suspected and isolate confirmed patients, including in the intensive care unit. The hospital has limited visiting hours and has restricted the number of visitors and said it will reassess its control steps as needed. It said it is collaborating with the MOH on handling the outbreak. Experts critique control measuresBen Embarek said the WHO is in regular contact with the hospital and that different ways of supporting the country are being discussed, including a possible joint mission. In February, a team of international health officials visited Saudi Arabia in response to a surge of infections in the country. They found critical data gaps on how and why MERS-CoV illnesses keep occurring in the community and how to improve prevention in hospitals and clinics. One of the conclusions was that infections were still occurring in some healthcare facilities, but not others, a sign that infection control measures were effective, but not broadly implemented. A similar joint mission to South Korea in June in the wake of its hospital-linked outbreak identified infection control lapses and complex dynamics, including ED crowding that was amplified by sick patients moving between hospitals. The team concluded, however, that overall the pattern resembled similar hospital-linked outbreaks in the Middle East. Latest 10 casesIn other developments, Saudi Arabia's MOH today reported 10 new lab-confirmed MERS-CoV cases, one of them fatal, all in Riyadh. Investigations found that all but one had contact with a suspected or confirmed MERS case. Two of the patients are foreign nationals, one of them a 35-year-old woman who is listed as a healthcare worker. The other is 71-year-old man who died from his infection. Overall, patient ages range from 28 to 86. Five are hospitalized in stable condition, and four are listed in critical condition. Also, the MOH said that an earlier announced patient died from his infection, a 71-year-old foreigner who had an underlying medical condition. The latest cases boost Saudi Arabia's MERS total to 1,115 cases, 480 of them fatal. Currently, 42 people are still being treated for their infections, and 590 have recovered. WHO on 12 recent casesMeanwhile, the WHO today filled in more details about 12 cases reported by Saudi Arabia from Aug 10 to Aug 12. One of the infections was fatal, involving a 73-year-old woman who got sick after visiting an ED for an unrelated medical condition. All but one of the cases is from Riyadh. The other case was reported in Abha in a 58-year-old man who has a history of contact with camels and consuming their raw milk. Of the Riyadh patients, four got sick after visiting the ED and nine contracted MERS-CoV while they were being treated for other conditions in a hospital that has been experiencing a MERS-CoV outbreak. One of them, a 65-year-old man, was a contact of an earlier reported case. Illness onsets for the 12 cases range from Jul 29 through Aug 8. Patient ages range from 45 to 99. Nine are men, and three are woman. Nine of them are hospitalized in critical condition, and two are listed as stable. The WHO also said that Saudi officials reported an additional death in an earlier reported case. Globally since September 2012 the WHO has received reports of 1,413 lab-confirmed MERS-CoV cases, with at least 502 deaths. See also: Aug 15 King Abdulaziz Medical City press release Aug 18 Saudi MOH statement Aug 18 WHO statement Feb 23 CIDRAP News story "WHO notes stubborn MERS puzzles as Saudi cases climb" http://www.cidrap.umn.edu/news-perspective/2015/08/hospital-emerges-epicenter-riyadh-mers-outbreak- MERS Outbreak Centered In Riyadh KSA
Middle East Respiratory Syndrome coronavirus (MERS-CoV) – Saudi ArabiaDisease outbreak news 18 August 2015 Between 10 and 12 August 2015, the National IHR Focal Point for the Kingdom of Saudi Arabia notified WHO of 12 additional cases of Middle East respiratory syndrome coronavirus (MERS-CoV) infection, including 1 death. Details of the casesA 57-year-old male from Riyadh city developed symptoms on 8 August while admitted to hospital for an unrelated medical condition since 2010. This hospital has been experiencing a MERS-CoV outbreak. The patient, who has comorbidities, tested positive for MERS-CoV on 11 August. Currently, he is in critical condition in ICU. Investigation of possible epidemiological links with the MERS-CoV cases admitted to his hospital or with shared health care workers is ongoing.A 56-year-old female from Riyadh city developed symptoms on 7 August while admitted to hospital for an unrelated medical condition since 29 July. This hospital has been experiencing a MERS-CoV outbreak. The patient, who has comorbidities, tested positive for MERS-CoV on 9 August. Currently, she is in critical condition in ICU. Investigation of possible epidemiological links with the MERS-CoV cases admitted to her hospital or with shared health care workers is ongoing.A 78-year-old female from Riyadh city developed symptoms on 7 August while admitted to hospital for an unrelated medical condition since 26 July. The patient, who has comorbidities, tested positive for MERS-CoV on 8 August. Currently, she is in critical condition in ICU. Investigation of possible epidemiological links with the MERS-CoV cases admitted to her hospital or with shared health care workers is ongoing.A 58-year-old male from Abha city developed symptoms on 6 August and was admitted to hospital on 10 August. The patient, who has comorbidities, tested positive for MERS-CoV on 12 August. He has a history of contact with camels and consumption of their raw milk. The patient has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms. Currently, he is in critical condition in ICU.A 63-year-old male from Riyadh city developed symptoms on 29 July and, on 3 August, was admitted to a hospital that has been experiencing a MERS-CoV outbreak. The patient, who has comorbidities, tested positive for MERS-CoV on 5 August. He visited the emergency room of the same hospital due to his chronic conditions in the 14 days prior to the onset of symptoms. The patient has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms. Investigation of possible epidemiological links with the MERS-CoV cases admitted to his hospital or with shared health care workers is ongoing. Currently, the patient is in critical condition in ICU.A 45-year-old male from Riyadh city developed symptoms on 4 August while admitted to hospital for an unrelated medical condition since 30 July. This hospital has been experiencing a MERS-CoV outbreak. The patient, who has comorbidities, tested positive for MERS-CoV on 6 August. Currently, he is in critical condition in ICU. Investigation of possible epidemiological links with the MERS-CoV cases admitted to his hospital or with shared health care workers is ongoing.A 56-year-old male national from Riyadh city developed symptoms on 4 August while admitted to hospital for an unrelated medical condition since 23 July. This hospital has been experiencing a MERS-CoV outbreak. The patient, who has comorbidities, tested positive for MERS-CoV on 5 August. Currently, he is in critical condition in ICU. Investigation of possible epidemiological links with the MERS-CoV cases admitted to his hospital or with shared health care workers is ongoing.A 99-year-old male from Riyadh city developed symptoms on 6 August while admitted to hospital for an unrelated medical condition since 23 May. This hospital has been experiencing a MERS-CoV outbreak. The patient, who has comorbidities, tested positive for MERS-CoV on 8 August. Currently, he is in critical condition in ICU. Investigation of possible epidemiological links with the MERS-CoV cases admitted to his hospital or with shared health care workers is ongoing.A 65-year-old male from Riyadh city developed symptoms on 8 August and, on the same day, was admitted to hospital. The patient, who has comorbidities, tested positive for MERS-CoV on 9 August. He is a contact of a laboratory-confirmed MERS-CoV case (see DON published on 12 August – case n. 3). Investigation of history of exposure to other known risk factors is ongoing. Currently, the patient is in stable condition admitted to a negative pressure isolation room on a ward.A 57-year-old male from Riyadh city developed symptoms on 1 August and, on 4 August, was admitted to hospital that has been experiencing a MERS-CoV outbreak. The patient visited the emergency room of the same hospital due to unrelated medical conditions in the 14 days prior to the onset of symptoms. He has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms. The patient, who has comorbidities, tested positive for MERS-CoV on 6 August. Currently, he is in critical condition in ICU. Investigation of possible epidemiological links with the MERS-CoV cases admitted to his hospital or with shared health care workers is ongoing.A 57-year-old male from Riyadh city developed symptoms on 29 July and, on 30 July, was admitted to a hospital that has been experiencing a MERS-CoV outbreak. The patient visited the emergency room of the same hospital due to unrelated medical conditions in the 14 days prior to the onset of symptoms. He has no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms. The patient, who has comorbidities, tested positive for MERS-CoV on 2 August. Currently, he is in stable condition in ICU. Investigation of possible epidemiological links with the MERS-CoV cases admitted to his hospital or with shared health care workers is ongoing.A 73-year-old female from Riyadh city developed symptoms on 31 July and, on 2 August, was admitted to a hospital that has been experiencing a MERS-CoV outbreak. The patient visited the emergency room of the same hospital due to unrelated medical conditions in the 14 days prior to the onset of symptoms. She had no history of exposure to other known risk factors in the 14 days prior to the onset of symptoms. The patient, who had comorbidities, tested positive for MERS-CoV on 4 August and passed away on 11 August. Investigation of possible epidemiological links with the MERS-CoV cases admitted to her hospital or with shared health care workers is ongoing.Contact tracing of household and healthcare contacts is ongoing for these cases. The National IHR Focal Point for the Kingdom of Saudi Arabia also notified WHO of the death of 1 MERS-CoV case that was reported in a previous DON on 12 August (case n. 14). Globally, since September 2012, WHO has been notified of 1,413 laboratory-confirmed cases of infection with MERS-CoV, including at least 502 related deaths. WHO adviceBased on the current situation and available information, WHO encourages all Member States to continue their surveillance for acute respiratory infections and to carefully review any unusual patterns. Infection prevention and control measures are critical to prevent the possible spread of MERS-CoV in health care facilities. It is not always possible to identify patients with MERS-CoV early because like other respiratory infections, the early symptoms of MERS-CoV are non-specific. Therefore, health-care workers should always apply standard precautions consistently with all patients, regardless of their diagnosis. Droplet precautions should be added to the standard precautions when providing care to patients with symptoms of acute respiratory infection; contact precautions and eye protection should be added when caring for probable or confirmed cases of MERS-CoV infection; airborne precautions should be applied when performing aerosol generating procedures. Until more is understood about MERS-CoV, people with diabetes, renal failure, chronic lung disease, and immunocompromised persons are considered to be at high risk of severe disease from MERS‐CoV infection. Therefore, these people should avoid close contact with animals, particularly camels, when visiting farms, markets, or barn areas where the virus is known to be potentially circulating. General hygiene measures, such as regular hand washing before and after touching animals and avoiding contact with sick animals, should be adhered to. Food hygiene practices should be observed. People should avoid drinking raw camel milk or camel urine, or eating meat that has not been properly cooked. WHO remains vigilant and is monitoring the situation. Given the lack of evidence of sustained human-to-human transmission in the community, WHO does not recommend travel or trade restrictions with regard to this event. Raising awareness about MERS-CoV among travellers to and from affected countries is good public health practice. Public health authorities in host countries preparing for mass gatherings should ensure that all recommendations and guidance issued by WHO with respect to MERS-CoV have been appropriately taken into consideration and made accessible to all concerned officials. Public health authorities should plan for surge capacity to ensure that visitors during the mass gathering can be accommodated by health systems. http://www.who.int/csr/don/18-august-2015-mers-saudi-arabia/en/- MERS Outbreak Centered In Riyadh KSA
WHO and media reports describe growing outbreak in Riyadh.- Vaccine Resistant 2015 H5N1 Sequence In Zagazig Egypt
AlignSegment-IDNameScoreE-ValueIdentityEPI628911A/chicken/F611/Egypt/2015(H5N1) (A/H5N1) segment 4 (HA)3029.60.000000e+001642/1642 (100%)EPI584778A/chicken/Egypt/A10351A/2014 (A/H5N1) segment 4 (HA)2990.80.000000e+001634/1642 (99%)EPI573250A/chicken/Egypt/AR234-FAOF8NLQP/2014 (A/H5N1) segment 4 (HA)2990.80.000000e+001634/1642 (99%)EPI573328A/chicken/Egypt/14168CA/2014 (A/H5N1) segment 4 (HA)2985.30.000000e+001631/1639 (99%)EPI573321A/chicken/Egypt/153AF/2015 (A/H5N1) segment 4 (HA)2985.30.000000e+001633/1642 (99%)EPI573252A/Turkey/Egypt/AR235-S240NLQP/2014 (A/H5N1) segment 4 (HA)2985.30.000000e+001633/1642 (99%)EPI573244A/chicken/Egypt/AR231-CA113NLQP/2014 (A/H5N1) segment 4 (HA)2985.30.000000e+001633/1642 (99%)EPI579006A/chicken/Egypt/CLEVB-1_N00215/2014 (A/H5N1) segment 4 (HA)2981.60.000000e+001632/1642 (99%)EPI573315A/duck/Egypt/BS-146RS-f6/2014 (A/H5N1) segment 4 (HA)2981.60.000000e+001631/1640 (99%)EPI579781A/duck/Egypt/CLEVB-25_N00239/2015 (A/H5N1) segment 4 (HA)2979.80.000000e+001632/1642 (99%)EPI579780A/duck/Egypt/CLEVB-24_N00238/2015 (A/H5N1) segment 4 (HA)2979.80.000000e+001632/1642 (99%)EPI574132A/Egypt/MOH-NRC-7305/2014 (A/H5N1) segment 4 (HA)2979.80.000000e+001632/1642 (99%)EPI573268A/Turkey/Egypt/AR238-SD177NLQP/2014 (A/H5N1) segment 4 (HA)2979.80.000000e+001632/1642 (99%)EPI573248A/chicken/Egypt/AR233-S283NLQP/2014 (A/H5N1) segment 4 (HA)2979.80.000000e+001632/1642 (99%)EPI557138A/Quail/Egypt/BSU5514-AR2219/2014 (A/H5N1) segment 4 (HA)2979.80.000000e+001632/1642 (99%)EPI579784A/chicken/Egypt/CLEVB-18_N00232/2015 (A/H5N1) segment 4 (HA)2974.20.000000e+001631/1642 (99%)EPI579783A/chicken/Egypt/CLEVB-21_N00235/2015 (A/H5N1) segment 4 (HA)2974.20.000000e+001631/1642 (99%)EPI579782A/chicken/Egypt/CLEVB-20_N00234/2015 (A/H5N1) segment 4 (HA)2974.20.000000e+001631/1642 (99%)EPI579520A/chicken/Egypt/CLEVB-17_N00231/2015 (A/H5N1) segment 4 (HA)2974.20.000000e+001631/1642 (99%)EPI579325A/chicken/Egypt/CLEVB-16_N00230/2014 (A/H5N1) segment 4 (HA)2974.20.000000e+001631/1642 (99%)EPI579324A/chicken/Egypt/CLEVB-19_N00233/2015 (A/H5N1) segment 4 (HA)2974.20.000000e+001631/1642 (99%)EPI573330A/chicken/Egypt/1476CA/2014 (A/H5N1) segment 4 (HA)2972.40.000000e+001630/1641 (99%)EPI573318A/chicken/Egypt/1478CAL/2014 (A/H5N1) segment 4 (HA)2968.70.000000e+001622/1630 (99%)EPI573260A/Duck/Egypt/AR236-A3NLQP/2015 (A/H5N1) segment 4 (HA)2968.70.000000e+001630/1642 (99%)EPI573322A/chicken/Egypt/152RS/2015 (A/H5N1) segment 4 (HA)2963.10.000000e+001628/1641 (99%)EPI608783A/turkey/Israel/188/2015 (A/H5N1) segment 4 (HA)2957.60.000000e+001616/1624 (99%)EPI608778A/chicken/Israel/88/2015 (A/H5N1) segment 4 (HA)2957.60.000000e+001616/1624 (99%)EPI608777A/turkey/Israel/107/2015 (A/H5N1) segment 4 (HA)2957.60.000000e+001616/1624 (99%)EPI574125A/Egypt/MOH-NRC-7271/2014 (A/H5N1) segment 4 (HA)2957.60.000000e+001628/1642 (99%)EPI573246A/Duck/Egypt/AR232-A13NLQP/2014 (A/H5N1) segment 4 (HA)2957.60.000000e+001628/1642 (99%)EPI573319A/chicken/Egypt/152/2015 (A/H5N1) segment 4 (HA)2955.80.000000e+001625/1638 (99%)EPI608786A/turkey/Israel/209/2015 (A/H5N1) segment 4 (HA)2952.10.000000e+001615/1624 (99%)EPI608781A/turkey/Israel/274/2015 (A/H5N1) segment 4 (HA)2952.10.000000e+001615/1624 (99%)EPI608780A/turkey/Jenin/39/2015 (A/H5N1) segment 4 (HA)2952.10.000000e+001615/1624 (99%)EPI608784A/chicken/Israel/333/2015 (A/H5N1) segment 4 (HA)2946.50.000000e+001614/1624 (99%)EPI608782A/turkey/Israel/174/2015 (A/H5N1) segment 4 (HA)2946.50.000000e+001614/1624 (99%)EPI608779A/chicken/Qalqilya/53/2015 (A/H5N1) segment 4 (HA)2946.50.000000e+001614/1624 (99%)EPI584783A/Egypt/MOH-NRC-8434/2014 (A/H5N1) segment 4 (HA)2946.50.000000e+001626/1642 (99%)EPI608787A/spur-winged lapwing/Israel/101/2015 (A/H5N1) segment 4 (HA)2941.00.000000e+001613/1624 (99%)EPI574389A/Turkey/Egypt/14240FAOS/2014 (A/H5N1) segment 4 (HA)2935.40.000000e+001616/1629 (99%)EPI550493A/duck/Egypt/14VIR784-4-133AD/2013 (A/H5N1) segment 4 (HA)2935.40.000000e+001624/1642 (98%)EPI557194A/Duck/Egypt/NLQP27SG-AR750/2013 (A/H5N1) segment 4 (HA)2924.40.000000e+001622/1642 (98%)EPI557178A/chicken/Egypt/NLQP33SD-AR748/2013 (A/H5N1) segment 4 (HA)2918.80.000000e+001622/1643 (98%)EPI608785A/chicken/Israel/156/2015 (A/H5N1) segment 4 (HA)2913.30.000000e+001608/1624 (99%)EPI500079A/goose/Egypt/M7221D/2013 (A/H5N1) segment 4 (HA)2913.30.000000e+001620/1642 (98%)EPI500078A/chicken/Egypt/M7217A/2013 (A/H5N1) segment 4 (HA)2913.30.000000e+001620/1642 (98%)EPI487342A/chicken/Egypt/M7217B/2013 (A/H5N1) segment 4 (HA)2913.30.000000e+001620/1642 (98%)EPI557218A/chicken/Egypt/NLQP139V-AR753/2013 (A/H5N1) segment 4 (HA)2907.70.000000e+001619/1642 (98%)EPI500109A/chicken/Egypt/Q5283C/2012 (A/H5N1) segment 4 (HA)2904.10.000000e+001618/1642 (98%)EPI603916A/duck/Egypt/154FAOFL/2015 (A/H5N1) segment 4 (HA)2902.20.000000e+001595/1607 (99%)EPI573314A/chicken/Egypt/14148CA/2014 (A/H5N1) segment 4 (HA)2902.20.000000e+001594/1606 (99%)EPI504991A/chicken/Egypt/BSU-BS-R24/2012 (A/H5N1) segment 4 (HA)2902.20.000000e+001618/1642 (98%)EPI504990A/chicken/Egypt/BSU-BS-F27/2012 (A/H5N1) segment 4 (HA)2902.20.000000e+001618/1642 (98%)EPI348153A/chicken/Egypt/11VIR4453-266/2010 (A/H5N1) segment 4 (HA)2898.50.000000e+001617/1642 (98%)EPI603915A/duck/Egypt/153AL/2015 (A/H5N1) segment 4 (HA)2896.70.000000e+001585/1594 (99%)EPI597822A/duck/Egypt/1471SG/2014 (A/H5N1) segment 4 (HA)2896.70.000000e+001618/1643 (98%)EPI573317A/chicken/Egypt/1575S/2015 (A/H5N1) segment 4 (HA)2896.70.000000e+001593/1606 (99%)EPI500082A/duck/Egypt/M7218B/2013 (A/H5N1) segment 4 (HA)2896.70.000000e+001618/1643 (98%)EPI340133A/goose/Egypt/1117SF/2011 (A/H5N1) segment 4 (HA)2896.70.000000e+001617/1642 (98%)EPI600754A/chicken/Egypt/N05832-CLEVB754/2011 (A/H5N1) segment 4 (HA)2891.10.000000e+001616/1642 (98%)EPI597815A/turkey/Egypt/1438S/2014 (A/H5N1) segment 4 (HA)2891.10.000000e+001616/1642 (98%)EPI538767A/chicken/Egypt/13VIR-2962-109/2013 (A/H5N1) segment 4 (HA)2891.10.000000e+001616/1642 (98%)EPI340135A/chicken/Egypt/1113/2011 (A/H5N1) segment 4 (HA)2891.10.000000e+001616/1642 (98%)EPI338733A/duck/Egypt/M2583B/2010 (A/H5N1) segment 4 (HA)2891.10.000000e+001617/1643 (98%)EPI338732A/duck/Egypt/M2583C/2010 (A/H5N1) segment 4 (HA)2891.10.000000e+001617/1643 (98%)EPI338616A/duck/Egypt/M2583D/2010 (A/H5N1) segment 4 (HA)2891.10.000000e+001617/1643 (98%)EPI573316A/duck/Egypt/1427SL/2014 (A/H5N1) segment 4 (HA)2887.40.000000e+001590/1604 (99%)EPI597818A/chicken/Egypt/1461S/2014 (A/H5N1) segment 4 (HA)2885.60.000000e+001615/1642 (98%)EPI597812A/chicken/Egypt/1422S/2014 (A/H5N1) segment 4 (HA)2885.60.000000e+001615/1642 (98%)EPI557136A/Turkey/Egypt/BSU5114-AR2218/2014 (A/H5N1) segment 4 (HA)2885.60.000000e+001615/1642 (98%)EPI372907A/Egypt/N7562/2011 (A/H5N1) segment 4 (HA)2885.60.000000e+001616/1643 (98%)EPI348152A/chicken/Egypt/11VIR4453-268/2010 (A/H5N1) segment 4 (HA)2885.60.000000e+001615/1642 (98%)EPI340138A/duck/Egypt/1125S/2011 (A/H5N1) segment 4 (HA)2885.60.000000e+001615/1642 (98%)EPI340101A/chicken/Egypt/1112AF/2011 (A/H5N1) segment 4 (HA)2885.60.000000e+001615/1642 (98%)EPI340087A/duck/Egypt/11193SF/2011 (A/H5N1) segment 4 (HA)2885.60.000000e+001615/1642 (98%)EPI340085A/chicken/Egypt/1118AF/2011 (A/H5N1) segment 4 (HA)2885.60.000000e+001615/1642 (98%)EPI338615A/duck/Egypt/Q2645C/2010 (A/H5N1) segment 4 (HA)2885.60.000000e+001615/1642 (98%)EPI538807A/chicken/Egypt/13VIR-2962-200/2013 (A/H5N1) segment 4 (HA)2883.70.000000e+001606/1629 (98%)EPI538791A/chicken/Egypt/13VIR-2962-198/2013 (A/H5N1) segment 4 (HA)2883.70.000000e+001606/1629 (98%)EPI603902A/chicken/Egypt/1439CAL/2014 (A/H5N1) segment 4 (HA)2880.00.000000e+001614/1642 (98%)EPI603901A/chicken/Egypt/1436CAL/2014 (A/H5N1) segment 4 (HA)2880.00.000000e+001614/1642 (98%)EPI597825A/turkey/Egypt/1414CAL/2014 (A/H5N1) segment 4 (HA)2880.00.000000e+001614/1642 (98%)EPI597823A/turkey/Egypt/14125S/2014 (A/H5N1) segment 4 (HA)2880.00.000000e+001614/1642 (98%)EPI597816A/duck/Egypt/1435CAS/2014 (A/H5N1) segment 4 (HA)2880.00.000000e+001615/1643 (98%)EPI550507A/duck/Egypt/14VIR784-8-1339S/2013 (A/H5N1) segment 4 (HA)2880.00.000000e+001614/1642 (98%)EPI537618A/Egypt/N01754/2014 (A/H5N1) segment 4 (HA)2880.00.000000e+001614/1642 (98%)EPI373013A/Egypt/N00166/2011 (A/H5N1) segment 4 (HA)2880.00.000000e+001615/1643 (98%)EPI348160A/chicken/Egypt/11VIR4453-267/2010 (A/H5N1) segment 4 (HA)2880.00.000000e+001614/1642 (98%)EPI348158A/chicken/Egypt/11VIR4453-109/VRLCU/2011 (A/H5N1) segment 4 (HA)2880.00.000000e+001614/1642 (98%)EPI348157A/chicken/Egypt/11VIR4453-15/VRLCU/2010 (A/H5N1) segment 4 (HA)2880.00.000000e+001614/1642 (98%)EPI348155A/chicken/Egypt/11VIR4453-68/VRLCU/2011 (A/H5N1) segment 4 (HA)2880.00.000000e+001614/1642 (98%)EPI340151A/chicken/Egypt/10513S/2010 (A/H5N1) segment 4 (HA)2880.00.000000e+001614/1642 (98%)EPI340106A/duck/Egypt/1110AF/2011 (A/H5N1) segment 4 (HA)2880.00.000000e+001614/1642 (98%)EPI340104A/chicken/Egypt/117AD/2011 (A/H5N1) segment 4 (HA)2880.00.000000e+001614/1642 (98%)EPI348156A/chicken/Egypt11VIR4453-269/2010 (A/H5N1) segment 4 (HA)2878.20.000000e+001613/1642 (98%)EPI373020A/Egypt/N08932/2010 (A/H5N1) segment 4 (HA)2876.40.000000e+001613/1642 (98%)EPI348151A/chicken/Egypt/11VIR4453-270/2010 (A/H5N1) segment 4 (HA)2876.40.000000e+001613/1642 (98%)EPI597817A/chicken/Egypt/1460S/2014 (A/H5N1) segment 4 (HA)2874.50.000000e+001614/1643 (98%)EPI597814A/chicken/Egypt/1429S/2014 (A/H5N1) segment 4 (HA)2874.50.000000e+001613/1642 (98%)EPI460395A/chicken/Egypt/1094/2010 (A/H5N1) segment 4 (HA)2874.50.000000e+001613/1642 (98%)- Vaccine Resistant 2015 H5N1 Sequence In Zagazig Egypt
Isolate name: A/chicken/F611/Egypt/2015(H5N1) Isolate ID: EPI_ISL_192547 Passage details/history: c1 Type: A / H5N1 Lineage: Sample information Collection date: 2015-01-07 Host Gallus gallus Additional host information: Domestic status: Domestic Is vaccinated: Y Location: Egypt / Sharqia Additional location information: Zagazig Health status: Dead Specimen source: Tracheal swab Strain or commercial product name used for vaccination: H5N2 vaccine (VOLVAC) Institute information Originating lab: National Laboratory for Veterinary Quality Control on Poultry production- Animal Health Research Inistitute Sample ID given by the sample provider: F611 Address: National Laboratory for Veterinary Quality Control on Poultry production- Animal Health Research Inistitute Nadi-Elsaid 12618 Dokki Egypt Submitting lab: Faculty of Veterinary - Zagazig University Sample ID given by the submitting laboratory: F611 Authors: Address: Faculty of Veterinary - Zagazig University Avian and Rabbit Diseases El-Shohada, Qesm Awal AZ Zagazig Egypt PublicationPublication In vivo antiviral resistance PhenotypeGenotypeUnspecifiedAntiviral resistance tested by experimental procedures Adamantanes: Unknown Oseltamivir: Unknown Zanamivir: Unknown Peramivir: Unknown Other: Unknown Sequence segmentidentifierlengthaccession #INSDCSequence HA A/chicken/F611/Egypt/2015(H5N1) 1642 EPI628911 Submitter information Submitter: El-Didamoney, Reham Mohamed Submission Date: 2015-08-07 Last modifier: El-Didamoney, Reham Mohamed Last modified: 2015-08-07 Address: Faculty of Veterinary - Zagazig University Avian and Rabbit Diseases El-Shohada, Qesm Awal AZ Zagazig Egypt- Vaccine Resistant 2015 H5N1 Sequence In Zagazig Egypt
NLCQCP releases H5 sequence from 2015 vaccine resistant fatal infection.- 2014 Haiti D68 Enterovirus VP1 Identical To NY153
Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KP745755.1|Enterovirus D68 isolate NY153, complete genome17121712100%0.0100%KP745755.1Select seq gb|KM851228.1|Enterovirus D68 strain US/MO/14-18950, partial genome17011701100%0.099%KM851228.1Select seq gb|KP745754.1|Enterovirus D68 isolate NY130 polyprotein gene, complete cds16961696100%0.099%KP745754.1Select seq gb|KP745751.1|Enterovirus D68 isolate NY120, complete genome16961696100%0.099%KP745751.1Select seq gb|KP745761.1|Enterovirus D68 isolate NY305 polyprotein gene, complete cds16901690100%0.099%KP745761.1Select seq gb|KP745757.1|Enterovirus D68 isolate NY210, complete genome16901690100%0.099%KP745757.1Select seq gb|KP322752.1|Enterovirus D68 strain US/CA/14-6089 polyprotein gene, partial cds16901690100%0.099%KP322752.1Select seq gb|KP100793.1|Enterovirus D68 strain US/CO/14-94 polyprotein gene, complete cds16901690100%0.099%KP100793.1Select seq gb|KP100792.1|Enterovirus D68 strain US/CA/14-6092 polyprotein gene, partial cds16901690100%0.099%KP100792.1Select seq gb|KP745758.1|Enterovirus D68 isolate NY263 polyprotein gene, complete cds1688168899%0.099%KP745758.1Select seq gb|KP114662.1|Enterovirus D68 isolate EV68_Alberta17390_2014 polyprotein gene, partial cds16851685100%0.099%KP114662.1Select seq gb|KP745770.1|Enterovirus D68 isolate NY77 polyprotein gene, complete cds16851685100%0.099%KP745770.1Select seq gb|KP745765.1|Enterovirus D68 isolate NY326 polyprotein gene, complete cds16851685100%0.099%KP745765.1Select seq gb|KP745760.1|Enterovirus D68 isolate NY278, complete genome16851685100%0.099%KP745760.1Select seq gb|KP745759.1|Enterovirus D68 isolate NY275 polyprotein gene, complete cds16851685100%0.099%KP745759.1Select seq gb|KP745753.1|Enterovirus D68 isolate NY126 polyprotein gene, complete cds16851685100%0.099%KP745753.1Select seq gb|KP126909.1|Enterovirus D68 strain US/CA/14-R1 polyprotein gene, partial cds16851685100%0.099%KP126909.1Select seq gb|KM892502.1|Enterovirus D68 isolate CA/AFP/v14T04344 VP1 capsid protein gene, partial cds16851685100%0.099%KM892502.1Select seq gb|KP745766.1|Enterovirus D68 isolate NY328, complete genome16791679100%0.099%KP745766.1Select seq gb|KP745764.1|Enterovirus D68 isolate NY316, complete genome16791679100%0.099%KP745764.1Select seq gb|KP100796.1|Enterovirus D68 strain US/CA/14-6100 polyprotein gene, partial cds16791679100%0.099%KP100796.1Select seq gb|KP100795.1|Enterovirus D68 strain US/CA/14-6103SIB polyprotein gene, complete cds16791679100%0.099%KP100795.1Select seq gb|KM851227.1|Enterovirus D68 strain US/MO/14-18949, partial genome16791679100%0.099%KM851227.1Select seq gb|KM851226.1|Enterovirus D68 strain US/MO/14-18948, partial genome16791679100%0.099%KM851226.1Select seq gb|KP745763.1|Enterovirus D68 isolate NY314 polyprotein gene, complete cds16741674100%0.099%KP745763.1Select seq gb|KP745752.1|Enterovirus D68 isolate NY124 polyprotein gene, complete cds16681668100%0.099%KP745752.1Select seq gb|KP126910.1|Enterovirus D68 strain US/CA/14-6067 polyprotein gene, partial cds16681668100%0.099%KP126910.1Select seq gb|KM851225.1|Enterovirus D68 strain US/MO/14-18947, partial genome16681668100%0.099%KM851225.1Select seq gb|KP745762.1|Enterovirus D68 isolate NY309 polyprotein gene, complete cds16631663100%0.099%KP745762.1Select seq gb|KM881710.2|Enterovirus D68 strain EV-D68_STL_2014_12 polyprotein gene, complete cds16571657100%0.099%KM881710.2Select seq gb|KP126908.1|Enterovirus D68 strain US/CA/14-R2 polyprotein gene, partial cds16571657100%0.099%KP126908.1Select seq gb|KP745767.1|Enterovirus D68 isolate NY329, complete genome16241624100%0.098%KP745767.1Select seq gb|KP153542.1|Enterovirus D68 strain ITA/25663/14 VP1 protein gene, partial cds16241624100%0.098%KP153542.1Select seq gb|KP126912.1|Enterovirus D68 strain US/CO/14-86 polyprotein gene, partial cds16241624100%0.098%KP126912.1Select seq gb|KP745756.1|Enterovirus D68 isolate NY160 polyprotein gene, complete cds16181618100%0.098%KP745756.1Select seq gb|KP153546.1|Enterovirus D68 strain ITA/25861/14 VP1 protein gene, partial cds16181618100%0.098%KP153546.1Select seq gb|KP153544.1|Enterovirus D68 strain ITA/25700/14 VP1 protein gene, partial cds16181618100%0.098%KP153544.1Select seq gb|KP153545.1|Enterovirus D68 strain ITA/25702/14 VP1 protein gene, partial cds16131613100%0.098%KP153545.1Select seq gb|KP153539.1|Enterovirus D68 strain ITA/23987/14 VP1 protein gene, partial cds16131613100%0.098%KP153539.1Select seq gb|KP114663.1|Enterovirus D68 isolate EV68_Alberta4693_2014 polyprotein gene, partial cds16071607100%0.098%KP114663.1Select seq gb|KP100794.1|Enterovirus D68 strain US/CO/13-60 polyprotein gene, complete cds16071607100%0.098%KP100794.1Select seq gb|KP153543.1|Enterovirus D68 strain ITA/25686/14 VP1 protein gene, partial cds16021602100%0.098%KP153543.1Select seq gb|KP153541.1|Enterovirus D68 strain ITA/25571/14 VP1 protein gene, partial cds16021602100%0.098%KP153541.1Select seq gb|KM892498.1|Enterovirus D68 isolate CA/AFP/v12T04950 VP1 capsid protein gene, partial cds15981598100%0.098%KM892498.1Select seq gb|KP153540.1|Enterovirus D68 strain ITA/25185/14 VP1 protein gene, partial cds15961596100%0.098%KP153540.1Select seq gb|KM892499.1|Enterovirus D68 isolate CA/AFP/v12T00346, partial genome15911591100%0.098%KM892499.1Select seq gb|KC763162.1|Human enterovirus 68 strain ITA/20528/12 VP1 gene, partial cds1591159199%0.098%KC763162.1Select seq gb|KM361523.1|Enterovirus sp. isolate CU134 polyprotein gene, partial cds15801580100%0.097%KM361523.1Select seq gb|KM361524.1|Enterovirus sp. isolate CU171 polyprotein gene, partial cds15741574100%0.097%KM361524.1Select seq gb|KM892501.1|Enterovirus D68 isolate CA/AFP/11-1767, complete genome15681568100%0.097%KM892501.1Select seq gb|KT280503.1|Enterovirus D68 isolate 2011-21186, complete genome1563156399%0.097%KT280503.1Select seq gb|KT280504.1|Enterovirus D68 isolate 2013-0720-6, complete genome1535153599%0.097%KT280504.1Select seq gb|KP729107.1|Enterovirus D68 isolate L2630003743 VP1 gene, partial cds1522152290%0.099%KP729107.1Select seq gb|KR108025.1|Enterovirus D68 isolate L2640016584 VP1 gene, partial cds1517151790%0.099%KR108025.1Select seq gb|KR108022.1|Enterovirus D68 isolate L2640002876 VP1 gene, partial cds1509150989%0.099%KR108022.1Select seq gb|KT280500.1|Enterovirus D68 isolate 2014-R0672, complete genome15071507100%0.096%KT280500.1Select seq gb|KT280496.1|Enterovirus D68 isolate 2014-R1357, complete genome15021502100%0.096%KT280496.1Select seq gb|KP114664.1|Enterovirus D68 isolate EV68_Alberta2985_2014 polyprotein gene, partial cds15021502100%0.096%KP114664.1Select seq gb|KP240936.1|Enterovirus D68 isolate Beijing-R0132, complete genome14961496100%0.096%KP240936.1Select seq gb|KT280499.1|Enterovirus D68 isolate 2014-R970, complete genome14911491100%0.096%KT280499.1Select seq gb|KT280498.1|Enterovirus D68 isolate 2014-R1011, complete genome14741474100%0.095%KT280498.1Select seq emb|LN681327.1|Enterovirus D68 partial 1D gene for VP1 protein, isolate CF287062_FRA141474147488%0.099%LN681327.1Select seq dbj|AB614427.1|Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2035-Yamagata-20101467146799%0.095%AB614427.1Select seq gb|KR108023.1|Enterovirus D68 isolate L2640003884 VP1 gene, partial cds1458145887%0.099%KR108023.1Select seq dbj|AB614430.1|Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2082-Yamagata-20101456145699%0.095%AB614430.1Select seq dbj|AB614409.1|Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 1975-Yamagata-20101456145699%0.095%AB614409.1Select seq emb|LN681337.1|Enterovirus D68 partial 1D gene for VP1 protein, isolate CF311065_FRA141454145487%0.099%LN681337.1Select seq gb|KT280497.1|Enterovirus D68 isolate 2014-R1153, complete genome14521452100%0.095%KT280497.1Select seq dbj|AB861414.1|Enterovirus D68 VP1 gene for VP1 polyprotein, partial cds, isolate: TTa-11-Ph344_VP11450145099%0.095%AB861414.1Select seq dbj|AB614433.1|Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2086-Yamagata-20101450145099%0.095%AB614433.1Select seq gb|KC763167.1|Human enterovirus 68 strain ITA/23695/12 VP1 gene, partial cds1445144598%0.095%KC763167.1Select seq dbj|AB614437.1|Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2161-Yamagata-20101445144599%0.095%AB614437.1Select seq gb|KM851230.1|Enterovirus D68 strain US/IL/14-18952, partial genome1439143999%0.095%KM851230.1Select seq gb|KM851229.1|Enterovirus D68 strain US/KY/14-18951, partial genome1439143999%0.095%KM851229.1Select seq gb|KP114665.1|Enterovirus D68 isolate EV68_Alberta17789_2014 polyprotein gene, partial cds1434143499%0.095%KP114665.1Select seq gb|KP745769.1|Enterovirus D68 isolate NY74 polyprotein gene, partial cds1434143499%0.095%KP745769.1Select seq gb|KP745768.1|Enterovirus D68 isolate NY73 polyprotein gene, complete cds1434143499%0.095%KP745768.1Select seq gb|KC763164.1|Human enterovirus 68 strain ITA/22516/12 VP1 gene, partial cds1423142398%0.095%KC763164.1Select seq gb|KC763169.1|Human enterovirus 68 strain ITA/24518/12 VP1 gene, partial cds1411141198%0.094%KC763169.1Select seq gb|JX101799.1|Human enterovirus 68 strain SA563 from South Africa VP1 gene, partial cds1406140699%0.094%JX101799.1Select seq gb|AY426493.1|Human enterovirus 68 strain MO00 polyprotein gene, partial cds1400140099%0.094%AY426493.1Select seq emb|LN681332.1|Enterovirus D68 partial 1D gene for VP1 protein, isolate CF298032_FRA141395139588%0.097%LN681332.1Select seq gb|AY426495.1|Human enterovirus 68 strain TX02-1 polyprotein gene, partial cds1389138999%0.094%AY426495.1Select seq gb|AY426494.1|Human enterovirus 68 strain WI00 polyprotein gene, partial cds1389138999%0.094%AY426494.1Select seq gb|JX101795.1|Human enterovirus 68 strain SA402 from South Africa VP1 gene, partial cds1384138499%0.094%JX101795.1Select seq gb|KJ472886.1|Enterovirus D68 isolate HEV196011 VP1 gene, partial cds1352135296%0.094%KJ472886.1Select seq gb|AY426496.1|Human enterovirus 68 strain TX02-2 polyprotein gene, partial cds1349134999%0.093%AY426496.1Select seq gb|AY426491.1|Human enterovirus 68 strain MD02-1 polyprotein gene, partial cds1345134599%0.093%AY426491.1Select seq gb|AY426492.1|Human enterovirus 68 strain MD02-2 polyprotein gene, partial cds1339133999%0.093%AY426492.1Select seq emb|LN681324.1|Enterovirus D68 partial 1D gene for VP1 protein, isolate CF276018_FRA141328132892%0.095%LN681324.1Select seq gb|JX101800.1|Human enterovirus 68 strain SA792 from South Africa VP1 gene, partial cds1327132793%0.094%JX101800.1Select seq dbj|AB667894.1|Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 2251-Yamagata-20051323132399%0.092%AB667894.1Select seq emb|LN681325.1|Enterovirus D68 partial 1D gene for VP1 protein, isolate CF279027_FRA141321132192%0.094%LN681325.1Select seq dbj|AB667893.1|Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 2218-Yamagata-20051315131599%0.092%AB667893.1Select seq emb|LN681319.1|Enterovirus D68 partial 1D gene for VP1 protein, isolate CF219068_FRA141314131492%0.094%LN681319.1Select seq emb|LN626610.1|Human enterovirus partial 1D gene for polyprotein, VP1 region, isolate CF267090_FRA141312131292%0.094%LN626610.1Select seq gb|KC763157.1|Human enterovirus 68 strain ITA/18641/08 VP1 gene, partial cds1312131298%0.092%KC763157.1Select seq dbj|AB667891.1|Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 2062-Yamagata-20051312131299%0.092%AB667891.1Select seq dbj|AB667895.1|Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 1703-Yamagata-20071306130699%0.092%AB667895.1Select seq dbj|AB667892.1|Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 2124-Yamagata-20051306130699%0.092%AB667892.1- 2014 Haiti D68 Enterovirus VP1 Identical To NY153
LOCUS KT266905 7332 bp ss-RNA linear VRL 04-AUG-2015 DEFINITION Enterovirus D68 isolate EV-D68/Haiti/1/2014, complete genome. ACCESSION KT266905 VERSION KT266905.1 GI:908273950 KEYWORDS . SOURCE Enterovirus D68 (EV-D68) ORGANISM Enterovirus D68 Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; Picornaviridae; Enterovirus; Enterovirus D. REFERENCE 1 (bases 1 to 7332) AUTHORS Lednicky,J.A., Okech,B.A., Morris,J.G. Jr., Beau De Rochars,V.M., Elbadry,M.A., White,S.K. and Loeb,J.C. TITLE Enterovirus D68 strain Haiti 1-2014 from the blood of a Haitian child with febrile illness JOURNAL Unpublished REFERENCE 2 (bases 1 to 7332) AUTHORS Lednicky,J.A., Okech,B.A., Morris,J.G. Jr., Beau De Rochars,V.M., Elbadry,M.A., White,S.K. and Loeb,J.C. TITLE Direct Submission JOURNAL Submitted (09-JUL-2015) Environmental and Global Health, University of Florida - Gainesville, 1225 Center Drive, Room 2146, Gainesville, FL 32610, USA COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..7332 /organism="Enterovirus D68" /mol_type="genomic RNA" /isolate="EV-D68/Haiti/1/2014" /host="Homo sapiens" /db_xref="taxon:42789" /country="Haiti" /collection_date="01-Dec-2014" /note="passage details: A549 and Vero E6 cells" 5'UTR 1..697 CDS 698..7264 /codon_start=1 /product="polyprotein" /protein_id="AKT07950.1" /db_xref="GI:908273951" /translation="MGAQVTRQQTGTHENANIATNGSHITYNQINFYKDSYAASASKQ DFSQDPSKFTEPVVEGLKAGAPVLKSPSAEACGYSDRVLQLKLGNSAIVTQEAANYCC AYGEWPNYLPDHEAVAIDKPTQPETATDRFYTLKSVKWETGSTGWWWKLPDALNNIGM FGQNVQHHYLYRSGFLIHVQCNATKFHQGALLVVAIPEHQRGAHNTNTSPGFDDIMKG EEGGTFNHPYVLDDGTSLACATIFPHQWINLRTNNSATIVLPWMNAAPMDFPLRHNQW TLAIIPVVPLGTRTTSSMVPITVSIAPMCCEFNGLRHAITQGVPTYLLPGSGQFLTTD DHSSAPALPCFNPTPEMHIPGQVRNMLEVVQVESMMEINNTESAVGMERLKVDISALT DVDQLLFNIPLDIQLDGPLRNTLVGNISRYYTHWSGSLEMTFMFCGSFMATGKLILCY TPPGGSCPTTRETAMLGTHIVWDFGLQSSVTLIIPWISGSHYRMFNNDAKSTNANVGY VTCFMQTNLIVPSESSDTCSLIGFIAAKDDFSLRLMRDSPDIGQLDHLHAAEAAYQIE SIIKTATDTVKSEINAELGVVPSLNAVETGATSNTEPEEAIQTRTVINQHGVSETLVE NFLSRAALVSKRSFEYKDHTSSAAQADKNFFKWTINTRSFVQLRRKLELFTYLRFDAE ITILTTVAVNGSSNNTYVGLPDLTLQAMFVPTGALTPEKQDSFHWQSGSNASVFFKIS DPPARITIPFMCINSAYSVFYDGFAGFEKNGLYGINPADTIGNLCVRIVNEHQPVGFT VTVRVYMKPKHIKAWAPRPPRTLPYMSIANANYKGKERAPNALSAIIGNRDSVKTMPH NIVNTGPGFGGVFVGSFKIINYHLATTEERQSAIYVDWQSDVLVTPIAAHGRHQIARC KCNTGVYYCRHKNRSYPICFEGPGIQWIEQNEYYPARYQTNVLLAVGPAEAGDCGGLL VCPHGVIGLLTAGGGGIVAFTDIRNLLWLDTDAMEQGITDYIQNLGNAFGAGFTETIS NKAKEVQDMLIGESSLLEKLLKALIKIISALVIVIRNSEDLVTVTATLALLGCHDSPW SYLKQKVCSYLGIPYVPRQGESWLKKFTEACNALRGLDWLSQKIDKFINWLKTKILPE AREKYEFVQRLKQLPVIENQVSTIEHSCPTTEQQQALFNNVQYYSHYCRKYAPLYAVE AKRVVALEKKINNYIQFKSKSRIEPVCLIIHGSPGTGKSVASNLIARAITEKLGGDIY SLPPDPKYFDGYKQQTVVLMDDLMQNPDGNDISMFCQMVSTVDFIPPMASLEEKGTLY TSPFLIATTNAGSIHAPTVSDSKALSRRFKFDVDIEVTDSYKDSNKLDMSRAVEMCKP DGCAPTNYRRCCPLICGKAIQFRDRRTNARSTIDMLVTDIIKEYRTRNSTQDKLEALF QGPPQFKEIKISVTPDTPAPDAINDLLRSVDSQEVRDYCQKKGWIVVHPSNELIVEKH ISRAFITLQAIATFVSIAGVVYVIYKLFAGIQGPYTGIPNPKPKVPSLRTAKVQGPGF DFAQAIMKKNTVIARTEKGEFTMLGVYDRVAVIPTHASVGETIYINDVETKVLDACAL RDLTDTNLEITIVKLDRNQKFRDIRHFLPRYEDDYNDAVLSVHTSKFPNMYIPVGQVT NYGFLNLGGTPTHRILMYNFPTRAGQCGGVVTTTGKVIGIHVGGNGAQGFAAMLLHSY FTDTQGEIVSSEKSGVCINAPAKTKLQPSVFHQVFEGSKEPAVLNPKDPRLKTDFEEA IFSKYTGNKIMLMDEYMEEAVDHYVGCLEPLDISVDPIPLESAMYGMDGLEALDLTTS AGFPYLLQGKKKRDIFNRHTRDTSEMTKMLEKYGVDLPFVTFVKDELRSREKVEKGKS RLIEASSLNDSVAMRVAFGNLYATFHNNPGTATGSAVGCDPDIFWSKIPILLDGEIFA FDYTGYDASLSPVWFACLKKVLIKLGYTHQTSFIDYLCHSVHLYKDKKYIVNGGMPSG SSGTSIFNTMINNIIIRTLLIRVYKGIDLDQFKMIAYGDDVIASYPHKIDPGLLAEAG KQYGLVMTPADKGTSFIDTNWENVTFLKRYFRADDQYPFLIHPVMPMKEIHESIRWTK DPRNTQDHVRSLCYPAWHNGEEAYNEFCRKIRSVPVGRALTLPAYSSLRRKWLDSF" mat_peptide 698..904 /product="VP4 polyprotein" mat_peptide 905..1648 /product="VP2 polypeptide" mat_peptide 1649..2371 /product="VP3 polypeptide" mat_peptide 2372..3274 /product="VP1 polypeptide" mat_peptide 3275..3721 /product="P2A protease" mat_peptide 3722..4018 /product="p2B polypeptide" mat_peptide 4019..5011 /product="p2C polypeptide" mat_peptide 5012..5275 /product="p3A polypeptide" mat_peptide 5276..5341 /product="VPg polypeptide" mat_peptide 5342..5881 /product="p3C protease" mat_peptide 5882..7261 /product="p3D RNA polymerase" 3'UTR 7265..7332 ORIGIN 1 taaaacagcc ttggggttgt tcccactcca agggcccacg tggcggctag tactctggta 61 cttcggtacc tttgtacgcc tgttttatct cccttcccaa tgtaacttag aagttcttaa 121 atcaatgctc aataggtggg gcgcaaacca gcgctctcat gagcaagcac tcctgtctcc 181 ccggtgaggt tgtataaact gttcccacgg ttgaaaacaa cctatccgtt atccgctata 241 gtacttcgag aaacctagta ccacctttgg attgttgacg cgttgcgttc agcacactaa 301 cccgtgtgta gcttgggtcg atgagtctgg acatacctca ctggcgacag tggtccaggc 361 tgcgttggcg gcctactcat ggtgaaagcc atgagacgct agacatgaac aaggtgtgaa 421 gagtctattg agctactata gagtcctccg gcccctgaat gcggctaatc ctaaccatgg 481 agcaagtgct cacaggccag tgagttgctt gtcgtaatgc gcaagtccgt ggcggaaccg 541 actactttgg gtgtccgtgt ttcacttttt acttttatga ctgcttatgg tgacaatttg 601 atattgttac catttagctt gtcaaatcaa ttgcaaaaga tcctaaatct tatttatcaa 661 cttgcatctt gataacttta atttgaaaat tttaacaatg ggagctcagg ttactagaca 721 acaaactggc actcatgaaa atgccaacat tgccacaaat ggatctcata tcacatacaa 781 tcagataaac ttttacaagg atagttatgc ggcttcagcc agcaagcagg atttttcaca 841 ggacccatca aaattcactg aaccagtagt ggaaggttta aaagcagggg cgccagtttt 901 gaaatctcct agtgctgagg catgtggcta cagtgataga gtattacagc tcaaattagg 961 aaattcagct attgtcaccc aggaagcagc gaactactgc tgcgcttatg gtgaatggcc 1021 caattactta ccagaccatg aagcagtagc cattgataaa cctacacaac cagaaactgc 1081 tacagataga ttctacactt tgaaatcagt caaatgggaa actggaagca caggatggtg 1141 gtggaaacta cccgatgcac taaataatat aggcatgttt ggacagaatg tacagcatca 1201 ctacctatat agatctggtt tcttgattca tgtgcagtgt aatgccacaa aattccatca 1261 aggtgcctta ttagtggtag caattccaga acatcagagg ggagcgcaca acaccaacac 1321 tagcccaggg tttgatgata taatgaaagg tgaagaagga gggaccttca atcatccata 1381 tgtccttgat gatggaacat cattggcttg tgcgacgata tttccacatc agtggataaa 1441 tctgagaacc aacaattcag caacaattgt tcttccctgg atgaatgctg ctccaatgga 1501 tttcccactt agacataatc agtggacgct agcaataata ccagtggtgc cattaggcac 1561 acgtacaaca tcaagtatgg tcccaataac agtttcaatc gctccaatgt gttgtgagtt 1621 taatggactt agacacgcca ttactcaagg tgtcccaaca taccttttac ccggctcggg 1681 acaattccta acaactgatg atcatagctc tgcaccagct ctcccgtgtt tcaacccaac 1741 tccagaaatg catatcccag ggcaggtccg taacatgcta gaagtggtcc aagtggaatc 1801 aatgatggag attaataaca cagaaagtgc agttggcatg gagcgtctta aggttgacat 1861 atcagcattg acagatgtcg atcaattgtt attcaacatt ccactggaca tacagttgga 1921 tgggccactt agaaacactt tagtaggaaa catatctaga tattacactc attggtctgg 1981 atccctagaa atgacgttta tgttttgtgg cagcttcatg gcaacgggaa aattaatcct 2041 gtgctatact cctccaggtg gatcatgccc gacaaccaga gagaccgcca tgttaggtac 2101 acatattgtt tgggattttg gattacaatc tagtgtaacc ctgataatac cttggattag 2161 tggatcccac tacaggatgt ttaataatga tgctaagtca actaatgcca acgttggcta 2221 tgtcacttgt tttatgcaga ccaatctgat agtccccagt gaatcctctg acacgtgttc 2281 tttgataggg ttcatagcag caaaagatga tttctccctc agattaatga gagacagccc 2341 tgacattgga caactagacc atttacatgc agcagaggca gcctaccaga tcgagagcat 2401 tatcaaaaca gcaaccgaca ctgtgaaaag tgagattaat gctgaacttg gtgtggtccc 2461 tagcttaaat gcagttgaaa caggtgcaac ctctaacact gaaccagaag aagccataca 2521 aactcgcaca gtgataaatc agcacggtgt atccgagact ctagtggaga attttctcag 2581 tagagcagct ttggtatcaa agagaagttt tgaatacaaa gatcatactt cgtctgcagc 2641 acaagcagac aagaactttt tcaaatggac aattaacacc agatcctttg tacagttaag 2701 aagaaaatta gaattattca cataccttag atttgatgct gagatcacta tactcacaac 2761 tgtagcagtg aatggtagta gtaataatac atacgtgggt cttcctgact tgacacttca 2821 agcaatgttt gtacccactg gtgctcttac cccagaaaag caggactcat tccactggca 2881 gtcaggcagt aatgctagtg tattctttaa aatctctgac cccccagcca gaataaccat 2941 accttttatg tgcattaact cagcatactc agttttttat gatggctttg ccggatttga 3001 gaaaaacggt ctgtatggaa taaatccagc tgatactatt ggtaacttat gtgttagaat 3061 agtgaatgaa caccaaccag ttggtttcac agtgaccgtt agggtttaca tgaagcctaa 3121 acacataaaa gcatgggcac cacgaccacc acgaactctg ccatatatga gtattgcaaa 3181 tgcaaattac aaaggtaaag aaagagcacc aaatgcgctc agtgctataa ttggcaatag 3241 agacagtgtc aaaaccatgc ctcataatat agtgaacact ggtccaggct tcggaggggt 3301 ttttgtaggg tctttcaaaa taatcaacta tcacttggcc actacagaag agagacagtc 3361 agctatctat gtggattggc aatcagacgt cttggttacc cccattgctg ctcatggaag 3421 gcaccaaata gcaagatgca agtgcaacac aggggtttac tattgtaggc acaaaaacag 3481 aagttacccg atttgctttg aaggcccagg gattcaatgg attgaacaaa atgaatatta 3541 cccagcaagg taccagacca atgtactttt ggcagttggt cctgcggaag caggagattg 3601 cggtggttta ctagtttgtc cgcatggggt aatcggtctt cttacagcag gagggggtgg 3661 aattgtagct ttcactgata tcaggaattt gctatggtta gatactgatg ctatggaaca 3721 aggcattact gattatattc aaaatcttgg taatgccttt ggagcaggat ttacagaaac 3781 aatctctaat aaagccaagg aagtgcaaga tatgctaatt ggagagagtt cactattaga 3841 aaaattgtta aaagctctaa tcaaaatcat atcagcatta gtaattgtaa tcagaaactc 3901 agaagattta gtcacagtca cagccacact agcattgttg ggatgccatg attcaccatg 3961 gagctacttg aaacagaagg tatgttcata cttaggtatt ccttatgtac ctagacaggg 4021 tgaatcgtgg cttaagaagt tcacagaggc atgcaatgct cttagaggtc tggattggct 4081 atcgcaaaag atagataaat tcatcaactg gcttaaaacc aaaatattac cagaagctag 4141 ggagaaatat gaatttgtgc aaaggctcaa acagttaccg gtgatagaaa accaagttag 4201 tacaatcgag catagctgcc caacaacaga acaacaacag gccttattca acaatgtcca 4261 atactattca cactactgta gaaagtacgc accactttac gcagtggaag caaagagggt 4321 agtagctctt gaaaagaaaa taaacaacta catccagttc aagtccaaat ctcgcattga 4381 accggtttgt ttaataatac atggctctcc aggaactggc aagtcagtgg cttcaaattt 4441 aattgccagg gctatcacag agaaattggg gggggacatt tattccttgc ctccagaccc 4501 taaatatttt gatggataca aacagcaaac agtggtcctc atggatgatt taatgcaaaa 4561 tccagatggg aatgacatat ctatgttctg ccaaatggtc tccactgtag atttcatacc 4621 cccaatggct agtttggagg aaaaaggaac tctttacacc agtccatttt taatagctac 4681 taccaatgct ggttcaatac atgcaccaac tgtatcagac tcaaaggctt tgtcacgcag 4741 atttaaattt gacgtggaca ttgaagtcac agattcatac aaggactcaa ataaattgga 4801 tatgtcaagg gcagtcgaga tgtgcaaacc agacggctgt gcccccacca attacagaag 4861 atgctgccca ttgatctgtg gaaaggctat ccaattcaga gatcgcagaa ctaatgcaag 4921 atccactatt gatatgctag taactgatat tataaaggaa tatagaacca gaaacagtac 4981 acaggacaag ctagaggctc tgtttcaggg gcctccacag tttaaagaga tcaaaatttc 5041 agtcacccca gatacaccag ctcctgatgc tataaatgac cttcttaggt cagtggattc 5101 tcaagaagtt agggattatt gccaaaagaa aggatggatt gtagtacacc catcaaatga 5161 gctaatagta gaaaaacaca ttagtagagc ttttatcact ctacaagcca ttgccacctt 5221 tgtatcaata gctggtgtag tttatgttat atacaaactt tttgctggca ttcagggtcc 5281 atacacagga atccccaatc ctaaacctaa agtaccctct ctcagaacag ctaaagtgca 5341 aggaccaggg ttcgattttg cacaagccat aatgaagaaa aataccgtca ttgcaaggac 5401 tgaaaagggt gagttcacca tgctgggtgt atatgatagg gtagcggtca tccccacaca 5461 cgcatctgtt ggagaaacca tttacattaa tgatgtagag actaaagttt tagatgcgtg 5521 tgcacttaga gacttgactg atacaaactt agagataacc atagtcaaat tagaccgtaa 5581 ccaaaaattt agagatatca gacattttct gcccagatat gaggatgatt acaatgacgc 5641 tgtgcttagc gtacatacat caaaattccc aaatatgtat atcccagttg gacaagtcac 5701 caattatggc ttcttgaacc taggtggtac accgacgcac cgcattttaa tgtataactt 5761 cccaacaaga gctggtcagt gtggtggtgt ggtgacaact acaggtaagg tgataggaat 5821 acatgtaggt ggaaatggag ctcaaggatt tgcagcaatg ctactacact cttactttac 5881 cgatacacaa ggtgagatag ttagtagtga aaagagtggg gtgtgcatta acgcaccggc 5941 aaagactaaa ctccaaccca gtgttttcca tcaagttttt gaaggttcaa aggaaccagc 6001 agttctcaat ccaaaagatc ctaggcttaa aacagatttc gaggaggcca ttttctcaaa 6061 gtacacaggt aacaaaatca tgttaatgga tgagtacatg gaagaggcag tggatcatta 6121 tgtggggtgt ttagaaccat tagacatcag tgtggatccc atacccctgg aaagtgccat 6181 gtatggaatg gatggccttg aggcattaga cttaactacc agtgcaggat tcccttactt 6241 actacaaggg aagaagaaaa gggatatatt taatagacat actagagaca ccagtgaaat 6301 gacaaaaatg ttagagaaat atggagttga cctacctttt gtaacctttg taaaagatga 6361 gcttagatca agagaaaaag ttgaaaaagg gaaatcacgc ctgattgagg ccagttcctt 6421 gaatgactca gttgctatga gagttgcctt tggaaacctt tacgccacat ttcacaacaa 6481 tccaggtaca gcaactggta gtgcagttgg ttgtgatcca gatatatttt ggtcaaagat 6541 ccctattttg ttagatggag aaatctttgc ttttgactac actggttatg atgctagttt 6601 gtcaccagtg tggtttgcct gtttaaagaa agttctaatt aagttaggtt acacacatca 6661 aacgtctttt atagattatt tgtgtcattc agtacattta tataaggaca aaaagtacat 6721 agttaatggt ggaatgccct ctggttcttc aggcaccagc atattcaaca ctatgatcaa 6781 caatataatc ataagaactt tattaattag ggtttacaaa ggcatagacc tggaccagtt 6841 caaaatgatt gcctatgggg atgatgttat tgctagctac ccacataaga ttgatccagg 6901 tttgctggca gaagcaggta aacagtatgg attagtaatg acaccagcag acaaaggaac 6961 cagttttatt gacacaaatt gggaaaatgt aactttctta aaaagatatt tcagagcaga 7021 tgatcaatac ccctttctca tacatccagt gatgccaatg aaagagatac atgaatctat 7081 tagatggact aaagatccca gaaacacaca ggatcatgtt aggtctttgt gctaccccgc 7141 atggcataat ggagaggagg cttataatga attttgcaga aaaatcagaa gtgtgcctgt 7201 gggaagagca ttgacactac ctgcatactc tagtcttaga cggaaatggt tagattcgtt 7261 ctagacaact ctaattgaaa cccaagttat agttactttc atttagaggt aaattttggc 7321 ccccaagtgg cc- 2014 Haiti D68 Enterovirus VP1 Identical To NY153
University of Florida released full D68 sequence from December 1, 2014 Haiti collection, which matched novel sub-clade linked to acute flaccid paralysis. VP1 sequence identical to NY153.- Novel H3N2v Sequence From 2015 Case In Minnesota
AlignSegment-IDNameScoreE-ValueIdentityEPI625702A/Minnesota/38/2015 (A/H3N2) segment 8 (NS)1548.60.000000e+00838/838 (100%)EPI492229A/swine/Oklahoma/02083/2008 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI490718A/swine/Oklahoma/02530/2009 (A/H3N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI490574A/swine/Oklahoma/02722/2009 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI488822A/swine/Oklahoma/02056/2008 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI488815A/swine/Oklahoma/02107/2008 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI220928A/swine/Texas/050593/2008 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI220895A/swine/Oklahoma/032726/2008 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI220887A/swine/Oklahoma/020736-2/2008 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI220879A/swine/Oklahoma/020736-1/2008 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI220871A/swine/Oklahoma/020734-3/2008 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI220855A/swine/Oklahoma/016179-9/2008 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI220839A/swine/Oklahoma/011521-5/2008 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI220831A/swine/Oklahoma/011521-4/2008 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI220823A/swine/Oklahoma/011289-9/2008 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI220815A/swine/Oklahoma/011289-8/2008 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI220807A/swine/Oklahoma/011289-10/2008 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI220791A/swine/Oklahoma/010710-8/2008 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI220775A/swine/Oklahoma/010226-16/2008 (A/H1N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI219372A/swine/Oklahoma/001142/2009 (A/H3N2) segment 8 (NS)1487.70.000000e+00827/838 (98%)EPI492026A/swine/Arkansas/02404/2008 (A/H1N2) segment 8 (NS)1482.10.000000e+00826/838 (98%)EPI490734A/swine/Oklahoma/02985/2010 (A/H3N2) segment 8 (NS)1482.10.000000e+00826/838 (98%)EPI220911A/swine/Oklahoma/053259/2008 (A/H1N2) segment 8 (NS)1482.10.000000e+00826/838 (98%)EPI220903A/swine/Oklahoma/042169/2008 (A/H1N2) segment 8 (NS)1482.10.000000e+00826/838 (98%)EPI220863A/swine/Oklahoma/020734-2/2008 (A/H1N2) segment 8 (NS)1482.10.000000e+00826/838 (98%)EPI220847A/swine/Oklahoma/016179-8/2008 (A/H1N2) segment 8 (NS)1482.10.000000e+00826/838 (98%)EPI610100A/swine/Minnesota/D09-21052-3/2009 (A/H1N2) segment 8 (NS)1476.60.000000e+00825/838 (98%)EPI490632A/swine/Texas/SG1501/2010 (A/H3N2) segment 8 (NS)1476.60.000000e+00825/838 (98%)EPI488920A/swine/Oklahoma/SG1325/2009 (A/H1N1) segment 8 (NS)1476.60.000000e+00825/838 (98%)EPI488906A/swine/Colorado/SG1322/2009 (A/H1N1) segment 8 (NS)1476.60.000000e+00825/838 (98%)EPI382636A/swine/Minnesota/0745/2010 (A/H1N2) segment 8 (NS)1476.60.000000e+00825/838 (98%)EPI220783A/swine/Oklahoma/010226-17/2008 (A/H1N2) segment 8 (NS)1476.60.000000e+00825/838 (98%)EPI615469A/swine/Minnesota/D09-28266-4/2009 (A/H1N2) segment 8 (NS)1465.50.000000e+00823/838 (98%)EPI610144A/swine/Kansas/A01076181/2009 (A/H1N2) segment 8 (NS)1465.50.000000e+00823/838 (98%)EPI610104A/swine/Minnesota/A01076197/2010 (A/H1N2) segment 8 (NS)1465.50.000000e+00823/838 (98%)EPI610006A/swine/Minnesota/D09-28266-2/2009 (A/H1N2) segment 8 (NS)1465.50.000000e+00823/838 (98%)EPI603591A/swine/Iowa/A01202421/2011 (A/H1N1) segment 8 (NS)1465.50.000000e+00823/838 (98%)EPI528485A/swine/Ohio/13TOSU0735/2013 (A/H1N1) segment 8 (NS)1465.50.000000e+00823/838 (98%)EPI527997A/swine/Ohio/13TOSU0736/2013 (A/H1N1) segment 8 (NS)1465.50.000000e+00823/838 (98%)EPI527957A/swine/Ohio/13TOSU0733/2013 (A/H1N1) segment 8 (NS)1465.50.000000e+00823/838 (98%)EPI491845A/swine/Minnesota/02852/2009 (A/H1N2) segment 8 (NS)1465.50.000000e+00823/838 (98%)EPI468241A/swine/Illinois/A01327868/2012 (A/H3N2) segment 8 (NS)1465.50.000000e+00823/838 (98%)EPI393181A/swine/Illinois/A01240774/2011 (A/H3N2) segment 8 (NS)1465.50.000000e+00823/838 (98%)EPI389987A/swine/Illinois/A01240784/2011 (A/H3N2) segment 8 (NS)1465.50.000000e+00823/838 (98%)EPI337509A/swine/Minnesota/02324/2008 (A/H1N2) segment 8 (NS)1465.50.000000e+00823/838 (98%)EPI337477A/swine/Minnesota/SG1133/2008 (A/H1N2) segment 8 (NS)1465.50.000000e+00823/838 (98%)EPI219364A/swine/Kansas/015252/2009 (A/H3N2) segment 8 (NS)1465.50.000000e+00823/838 (98%)EPI589882A/swine/Iowa/A01049368/2011 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI550274A/swine/Indiana/13TOSU4957/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI550260A/swine/Indiana/13TOSU4361/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI550246A/swine/Indiana/13TOSU5885/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI550209A/swine/Indiana/13TOSU5708/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI550132A/swine/Indiana/13TOSU5147/2013 (A/H3N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI550111A/swine/Indiana/13TOSU5671/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI550090A/swine/Indiana/13TOSU5675/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI550048A/swine/Indiana/13TOSU3988/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI550041A/swine/Indiana/13TOSU4944/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI550020A/swine/Indiana/13TOSU4194/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI549985A/swine/Indiana/13TOSU4995/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI546882A/swine/Ohio/13TOSU1560/2013 (A/H0) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI544931A/swine/Iowa/13H098/2013 (A/H3N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI544924A/swine/Iowa/13H090/2013 (A/H3N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI538986A/swine/Iowa/13H092/2013 (A/H3N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI538979A/swine/Iowa/13H073/2013 (A/H3N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI538972A/swine/Iowa/13H076/2013 (A/H3N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI538965A/swine/Iowa/13H065/2013 (A/H3N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI528434A/swine/Indiana/13TOSU1042/2013 (A/H3N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI528004A/swine/Ohio/13TOSU1221/2013 (A/H3N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI527966A/swine/Indiana/13TOSU0802/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI527931A/swine/Indiana/13TOSU0782/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI527914A/swine/Indiana/13TOSU1051/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI527909A/swine/Indiana/13TOSU1154/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI527869A/swine/Indiana/13TOSU1050/2013 (A/H3N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI527214A/swine/Indiana/13TOSU0820/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI527169A/swine/Indiana/13TOSU1048/2013 (A/H1N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI527165A/swine/Indiana/13TOSU1058/2013 (A/H1N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI527078A/swine/Indiana/13TOSU1060/2013 (A/H1N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI527035A/swine/Indiana/13TOSU1056/2013 (A/H1N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI526944A/swine/Indiana/13TOSU1053/2013 (A/H1N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI526908A/swine/Indiana/13TOSU1159/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI507421A/swine/Illinois/A01427335/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI493684A/swine/Iowa/13E078/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI493659A/swine/Iowa/13E100/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI490420A/swine/Iowa/SG1469/2004 (A/H3N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI468237A/swine/Illinois/A01327396/2012 (A/H3N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI465149A/swine/Ilinois/A01240775/2011 (A/H3N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI441161A/swine/California/A00968789/2013 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI441153A/swine/South Dakota/A01267895/2012 (A/H1N1) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI351676A/swine/Iowa/A01202709/2011 (A/H3N2) segment 8 (NS)1460.00.000000e+00822/838 (98%)EPI615674A/swine/Oklahoma/A01202414/2011 (A/H1N2) segment 8 (NS)1454.40.000000e+00821/838 (97%)EPI615452A/swine/Oklahoma/A01202417/2011 (A/H1N2) segment 8 (NS)1454.40.000000e+00821/838 (97%)EPI615434A/swine/Missouri/00563/2005 (A/H3N2) segment 8 (NS)1454.40.000000e+00821/838 (97%)EPI610141A/swine/Minnesota/A01076180/2009 (A/H1N1) segment 8 (NS)1454.40.000000e+00821/838 (97%)EPI603672A/swine/Iowa/A01076157/2010 (A/H1N2) segment 8 (NS)1454.40.000000e+00821/838 (97%)EPI589969A/swine/Iowa/A01049859/2011 (A/H1N1) segment 8 (NS)1454.40.000000e+00821/838 (97%)EPI589915A/swine/Iowa/A01049643/2011 (A/H1N2) segment 8 (NS)1454.40.000000e+00821/838 (97%)EPI585706A/swine/Illinois/A01049872/2011 (A/H1N2) segment 8 (NS)1454.40.000000e+00821/838 (97%)EPI585145A/swine/Nebraska/A01049648/2011 (A/H1N2) segment 8 (NS)1454.40.000000e+00821/838 (97%)EPI585124A/swine/Minnesota/A01202453/2011 (A/H1N2) segment 8 (NS)1454.40.000000e+00821/838 (97%)EPI585117A/swine/Minnesota/A01202454/2011 (A/H1N2) segment 8 (NS)1454.40.000000e+00821/838 (97%)- Novel H3N2v Sequence From 2015 Case In Minnesota
AlignSegment-IDNameScoreE-ValueIdentityEPI625701A/Minnesota/38/2015 (A/H3N2) segment 5 (NP)2752.60.000000e+001490/1490 (100%)EPI398493A/swine/Maryland/A01104048/2012 (A/H3N2) segment 5 (NP)2669.50.000000e+001475/1490 (98%)EPI398485A/swine/Maryland/A01104040/2012 (A/H3N2) segment 5 (NP)2669.50.000000e+001475/1490 (98%)EPI397655A/Maryland/28/2012 (A/H3N2) segment 5 (NP)2669.50.000000e+001475/1490 (98%)EPI396292A/Maryland/23/2012 (A/H3N2) segment 5 (NP)2669.50.000000e+001475/1490 (98%)EPI394938A/Maryland/22/2012 (A/H3N2) segment 5 (NP)2669.50.000000e+001475/1490 (98%)EPI392919A/Maryland/20/2012 (A/H3N2) segment 5 (NP)2669.50.000000e+001475/1490 (98%)EPI395288A/Maryland/25/2012 (A/H3N2) segment 5 (NP)2665.80.000000e+001474/1490 (98%)EPI467759A/swine/North Carolina/A01203272/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI433541A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI433534A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI414187A/swine/Indiana/A00968394/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI414179A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI414171A/swine/Indiana/A00968398/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI401714A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI401673A/swine/Ohio/A00138552/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI401658A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI401624A/swine/Ohio/12TOSU522/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI401622A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI401618A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI401614A/swine/Minnesota/A01301908/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI398543A/swine/Ohio/A00152576/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI398535A/swine/Ohio/A01208457/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI398527A/swine/Wisconsin/A00677500/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI398501A/swine/Ohio/A01133466/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397963A/Wisconsin/34/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397955A/Ohio/88/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397932A/Ohio/41/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397901A/Hawaii/03/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397556A/Wisconsin/29/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397549A/Ohio/86/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397541A/Ohio/83/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397533A/Ohio/56/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397525A/Ohio/47/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397517A/Ohio/44/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397510A/Ohio/36/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397440A/Wisconsin/31/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397433A/Wisconsin/30/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397427A/Ohio/81/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397419A/Minnesota/15/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397357A/Ohio/79/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI397205A/Ohio/34/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI396285A/Ohio/57/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI396278A/Indiana/144/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI396271A/Indiana/135/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI396247A/Indiana/126/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI396185A/Ohio/77/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI396170A/Ohio/80/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI395949A/swine/Indiana/A00968376/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI395941A/swine/Indiana/A00968373/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI395933A/swine/Indiana/A00968370/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI395884A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI395875A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI395867A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI395741A/swine/Indiana/A00968386/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI395352A/Pennsylvania/17/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI395345A/Michigan/20/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI395338A/Wisconsin/28/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI395286A/Illinois/11/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI395283A/Ohio/69/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI395271A/Ohio/75/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI395260A/Ohio/65/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI394926A/Wisconsin/23/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI393775A/Ohio/74/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI393697A/Ohio/64/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI393689A/West Virginia/16/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI393675A/West Virginia/10/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI393312A/Ohio/38/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI393307A/West Virginia/09/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI393300A/Indiana/18/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI392741A/Wisconsin/22/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI392728A/Pennsylvania/13/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI388283A/Indiana/17/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI388275A/Indiana/13/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI381866A/Hawaii/03/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI378516A/Indiana/09/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI378508A/Indiana/07/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI378503A/Indiana/07/2012 (A/H3N2) segment 5 (NP)2664.00.000000e+001474/1490 (98%)EPI394070A/Wisconsin/27/2012 (A/H3N2) segment 5 (NP)2660.30.000000e+001473/1490 (98%)EPI509735A/swine/Iowa/13H075/2013 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI472210A/swine/Indiana/A01260313/2013 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI468660A/swine/Ohio/A01349305/2013 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI467900A/swine/Ohio/A01349485/2013 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI467755A/swine/Iowa/A01244302/2012 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI465358A/Illinois/03/2013 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI465134A/swine/Iowa/A01202878/2011 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI460743A/Indiana/04/2013 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI459163A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI451229A/swine/Ohio/A01208181/2012 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI451223A/swine/Ohio/A01208180/2012 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI451203A/swine/Alabama/A01104056/2012 (A/H0) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI433521A/swine/Iowa/A01267939/2012 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI424074A/swine/Michigan/A01259003/2012 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI407272A/Minnesota/18/2012 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI407264A/Minnesota/18/2012 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI398519A/swine/Ohio/A01133464/2012 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI397947A/Ohio/85/2012 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI397941A/Ohio/84/2012 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI397926A/Ohio/19/2012 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)EPI397919A/Ohio/18/2012 (A/H3N2) segment 5 (NP)2658.40.000000e+001473/1490 (98%)- Novel H3N2v Sequence From 2015 Case In Minnesota
AlignSegment-IDNameScoreE-ValueIdentityEPI625704A/Minnesota/38/2015 (A/H3N2) segment 3 (PA)3855.10.000000e+002087/2087 (100%)EPI490024A/swine/Texas/SG1501/2010 (A/H3N2) segment 3 (PA)3594.70.000000e+002040/2087 (97%)EPI291878A/South Dakota/03/2008 (A/H1N1) segment 3 (PA)3555.90.000000e+002033/2087 (97%)EPI490073A/swine/Oklahoma/SG1498/2010 (A/H3N2) segment 3 (PA)3533.80.000000e+002029/2087 (97%)EPI291808A/Iowa/05/2007 (A/H1N1) segment 3 (PA)3533.80.000000e+002029/2087 (97%)EPI347224A/swine/Kansas/10-91088/2010 (A/H3N2) segment 3 (PA)3528.20.000000e+002028/2087 (97%)EPI347231A/swine/Kansas/11-101926/2011 (A/H3N2) segment 3 (PA)3522.70.000000e+002027/2087 (97%)EPI353852A/swine/Iowa/A01049750/2011 (A/H3N2) segment 3 (PA)3517.10.000000e+002026/2087 (97%)EPI347271A/swine/Kansas/11-110529/2011 (A/H3N2) segment 3 (PA)3517.10.000000e+002026/2087 (97%)EPI347263A/swine/Kansas/11-109700/2011 (A/H3N2) segment 3 (PA)3517.10.000000e+002026/2087 (97%)EPI347239A/swine/Kansas/11-104465/2011 (A/H3N2) segment 3 (PA)3517.10.000000e+002026/2087 (97%)EPI424040A/swine/Illinois/A01201077/2011 (A/H3N2) segment 3 (PA)3506.10.000000e+002024/2087 (96%)EPI347247A/swine/Kansas/11-104467/2011 (A/H3N2) segment 3 (PA)3506.10.000000e+002024/2087 (96%)EPI603673A/swine/Iowa/A01202742/2011 (A/H1N2) segment 3 (PA)3500.50.000000e+002023/2087 (96%)EPI384093A/swine/Illinois/A01201076/2011 (A/H3N2) segment 3 (PA)3500.50.000000e+002023/2087 (96%)EPI353862A/swine/Texas/A01049915/2011 (A/H3N2) segment 3 (PA)3500.50.000000e+002023/2087 (96%)EPI353857A/swine/Texas/A01049914/2011 (A/H3N2) segment 3 (PA)3500.50.000000e+002023/2087 (96%)EPI353847A/swine/Texas/A01049556/2011 (A/H3N2) segment 3 (PA)3500.50.000000e+002023/2087 (96%)EPI353842A/swine/Texas/A01049555/2011 (A/H3N2) segment 3 (PA)3500.50.000000e+002023/2087 (96%)EPI475530A/swine/Missouri/A01327551/2012 (A/H3N2) segment 3 (PA)3495.00.000000e+002022/2087 (96%)EPI443455A/swine/Illinois/A01240868/2012 (A/H1N2) segment 3 (PA)3495.00.000000e+002022/2087 (96%)EPI441174A/swine/Michigan/A01203498/2012 (A/H3N2) segment 3 (PA)3495.00.000000e+002022/2087 (96%)EPI393184A/swine/Nebraska/A01240867/2011 (A/H3N2) segment 3 (PA)3495.00.000000e+002022/2087 (96%)EPI385909A/swine/Missouri/A01241619/2012 (A/H3N2) segment 3 (PA)3495.00.000000e+002022/2087 (96%)EPI384224A/swine/Nebraska/A01241114/2012 (A/H3N2) segment 3 (PA)3495.00.000000e+002022/2087 (96%)EPI384214A/swine/Minnesota/A01125995/2012 (A/H3N2) segment 3 (PA)3495.00.000000e+002022/2087 (96%)EPI361479A/swine/NE/A01101010/2011 (A/H3N2) segment 3 (PA)3495.00.000000e+002022/2087 (96%)EPI475553A/swine/Missouri/A01327552/2012 (A/H3N2) segment 3 (PA)3489.40.000000e+002021/2087 (96%)EPI465171A/swine/Iowa/A01202658/2011 (A/H3N2) segment 3 (PA)3489.40.000000e+002021/2087 (96%)EPI465161A/swine/Nebraska/A01240337/2011 (A/H3N2) segment 3 (PA)3489.40.000000e+002021/2087 (96%)EPI384149A/swine/Iowa/A01202657/2011 (A/H3N2) segment 3 (PA)3489.40.000000e+002021/2087 (96%)EPI383831A/swine/Illinois/A01240578/2011 (A/H3N2) segment 3 (PA)3485.70.000000e+002020/2087 (96%)EPI488495A/swine/Iowa/SG1401/2011 (A/H1N1) segment 3 (PA)3483.90.000000e+002020/2087 (96%)EPI488338A/swine/Minnesota/00991/2006 (A/H1N1) segment 3 (PA)3483.90.000000e+002021/2088 (96%)EPI443460A/swine/Illinois/A01241212/2012 (A/H3N2) segment 3 (PA)3483.90.000000e+002020/2087 (96%)EPI433479A/swine/Illinois/A01241208/2012 (A/H3N2) segment 3 (PA)3483.90.000000e+002020/2087 (96%)EPI488327A/swine/Minnesota/00938/2005 (A/H1N1) segment 3 (PA)3478.40.000000e+002020/2088 (96%)EPI487291A/swine/Nebraska/A01327581/2012 (A/H3N2) segment 3 (PA)3478.40.000000e+002019/2087 (96%)EPI337526A/swine/Minnesota/001581/2007 (A/H1N1) segment 3 (PA)3478.40.000000e+002020/2088 (96%)EPI499754A/swine/Illinois/A00857322/2012 (A/H1N2) segment 3 (PA)3472.80.000000e+002018/2087 (96%)EPI489862A/swine/Texas/SG1380/2011 (A/H1N1) segment 3 (PA)3472.80.000000e+002018/2087 (96%)EPI468633A/swine/Nebraska/A01241785/2012 (A/H3N2) segment 3 (PA)3472.80.000000e+002018/2087 (96%)EPI467509A/swine/Illinois/A00857325/2012 (A/H1N2) segment 3 (PA)3472.80.000000e+002018/2087 (96%)EPI467506A/swine/Illinois/A00857328/2012 (A/H1N2) segment 3 (PA)3472.80.000000e+002018/2087 (96%)EPI465138A/swine/Iowa/A01203121/2012 (A/H3N2) segment 3 (PA)3472.80.000000e+002018/2087 (96%)EPI433465A/swine/Illinois/A01203226/2012 (A/H1N1) segment 3 (PA)3472.80.000000e+002018/2087 (96%)EPI424062A/swine/Minnesota/A01240557/2011 (A/H3N2) segment 3 (PA)3472.80.000000e+002018/2087 (96%)EPI384204A/swine/Missouri/A01241610/2012 (A/H3N2) segment 3 (PA)3472.80.000000e+002018/2087 (96%)EPI323255A/swine/Minnesota/1300/2007 (A/H3N2) segment 3 (PA)3467.30.000000e+002018/2088 (96%)EPI166271A/swine/Minnesota/SG-00240/2007 (A/H1N1) segment 3 (PA)3467.30.000000e+002012/2079 (96%)EPI489852A/swine/Minnesota/SG1261/2006 (A/H1N1) segment 3 (PA)3461.70.000000e+002017/2088 (96%)EPI488336A/swine/Minnesota/SG1261/2006 (A/H1N1) segment 3 (PA)3461.70.000000e+002017/2088 (96%)EPI488328A/swine/Arkansas/SG1241/2006 (A/H1N1) segment 3 (PA)3461.70.000000e+002017/2088 (96%)EPI337534A/swine/Minnesota/001332/2006 (A/H3N2) segment 3 (PA)3461.70.000000e+002017/2088 (96%)EPI337380A/swine/Minnesota/001200/2006 (A/H1N1) segment 3 (PA)3461.70.000000e+002017/2088 (96%)EPI337354A/swine/Minnesota/01146/2006 (A/H3N2) segment 3 (PA)3461.70.000000e+002017/2088 (96%)EPI488367A/swine/Kentucky/SG1277/2007 (A/H1N1) segment 3 (PA)3456.20.000000e+002016/2088 (96%)EPI489969A/swine/North Carolina/01469/2007 (A/H3N2) segment 3 (PA)3450.70.000000e+002015/2088 (96%)EPI489936A/swine/North Carolina/SG1464/2004 (A/H3N2) segment 3 (PA)3450.70.000000e+002015/2088 (96%)EPI488371A/swine/North Carolina/01930/2007 (A/H3N2) segment 3 (PA)3450.70.000000e+002015/2088 (96%)EPI468224A/swine/Nebraska/A01327747/2012 (A/H3N2) segment 3 (PA)3450.70.000000e+002014/2087 (96%)EPI465060A/swine/Illinois/A01215870/2013 (A/H1N2) segment 3 (PA)3450.70.000000e+002014/2087 (96%)EPI388378A/Michigan/09/2007 (A/H1N2) segment 3 (PA)3450.70.000000e+002015/2088 (96%)EPI158875A/turkey/MN/366767/2005 (A/H3N2) segment 3 (PA)3450.70.000000e+002015/2088 (96%)EPI615024A/swine/Minnesota/01601/2007 (A/H1N2) segment 3 (PA)3445.10.000000e+002014/2088 (96%)EPI492005A/swine/Minnesota/00574/2005 (A/H1N1) segment 3 (PA)3445.10.000000e+002014/2088 (96%)EPI491820A/swine/Minnesota/00574/2005 (A/H1N1) segment 3 (PA)3445.10.000000e+002014/2088 (96%)EPI489968A/swine/Oklahoma/01382/2006 (A/H1N2) segment 3 (PA)3445.10.000000e+002014/2088 (96%)EPI488379A/swine/Arkansas/01460/2007 (A/H1N1) segment 3 (PA)3445.10.000000e+002015/2089 (96%)EPI337414A/swine/Minnesota/01862/2007 (A/H3N2) segment 3 (PA)3445.10.000000e+002014/2088 (96%)EPI323264A/swine/Minnesota/66853/2006 (A/H3N2) segment 3 (PA)3445.10.000000e+002014/2088 (96%)EPI615035A/swine/Ohio/01499/2007 (A/H3N2) segment 3 (PA)3439.60.000000e+002013/2088 (96%)EPI615034A/swine/Ohio/02089/2008 (A/H3N2) segment 3 (PA)3439.60.000000e+002013/2088 (96%)EPI615018A/swine/North Carolina/00271/2004 (A/H3N2) segment 3 (PA)3439.60.000000e+002013/2088 (96%)EPI584326A/swine/Minnesota/00584/2005 (A/H1) segment 3 (PA)3439.60.000000e+002013/2088 (96%)EPI491817A/swine/North Carolina/SG1232/2005 (A/H1N2) segment 3 (PA)3439.60.000000e+002013/2088 (96%)EPI490014A/swine/Iowa/02204/2008 (A/H3N2) segment 3 (PA)3439.60.000000e+002013/2088 (96%)EPI488384A/swine/Kentucky/01569/2007 (A/H1N1) segment 3 (PA)3439.60.000000e+002013/2088 (96%)EPI323261A/swine/Minnesota/578/2007 (A/H3N2) segment 3 (PA)3439.60.000000e+002013/2088 (96%)EPI229377A/turkey/OH/313053/2004 (A/H3N2) segment 3 (PA)3439.60.000000e+002013/2088 (96%)EPI615029A/swine/Oklahoma/00557/2005 (A/H3N2) segment 3 (PA)3434.00.000000e+002012/2088 (96%)EPI489960A/swine/Oklahoma/SG1473/2005 (A/H3N2) segment 3 (PA)3434.00.000000e+002012/2088 (96%)EPI488369A/swine/North Carolina/SG1282/2007 (A/H0) segment 3 (PA)3434.00.000000e+002012/2088 (96%)EPI347203A/swine/Ohio/FAH2-1/2008 (A/H1N1) segment 3 (PA)3434.00.000000e+002014/2090 (96%)EPI337367A/swine/Minnesota/00709/2005 (A/H3N2) segment 3 (PA)3434.00.000000e+002012/2088 (96%)EPI302686A/swine/Pennsylvania/62170-4/2010 (A/H3N2) segment 3 (PA)3434.00.000000e+002014/2090 (96%)EPI302679A/swine/Pennsylvania/62170-3/2010 (A/H3N2) segment 3 (PA)3434.00.000000e+002014/2090 (96%)EPI302667A/swine/Pennsylvania/62170-1/2010 (A/H3N2) segment 3 (PA)3434.00.000000e+002014/2090 (96%)EPI291866A/Pennsylvania/14/2010 (A/H3N2) segment 3 (PA)3434.00.000000e+002014/2090 (96%)EPI291823A/Michigan/09/2007 (A/H1N2) segment 3 (PA)3434.00.000000e+002012/2088 (96%)EPI166280A/swine/Minnesota/SG-00243/2006 (A/H3N2) segment 3 (PA)3430.30.000000e+001998/2068 (96%)EPI615026A/swine/Illinois/A01047044/2010 (A/H1N2) segment 3 (PA)3428.50.000000e+002012/2089 (96%)EPI593703A/swine/Illinois/A01047518/2010 (A/H1N2) segment 3 (PA)3428.50.000000e+002012/2089 (96%)EPI593702A/swine/Illinois/A01047149/2010 (A/H1N2) segment 3 (PA)3428.50.000000e+002012/2089 (96%)EPI593696A/swine/Illinois/A01047155/2010 (A/H1N2) segment 3 (PA)3428.50.000000e+002012/2089 (96%)EPI593695A/swine/Illinois/A01047172/2010 (A/H1N2) segment 3 (PA)3428.50.000000e+002012/2089 (96%)EPI593691A/swine/Illinois/A01047145/2010 (A/H1N2) segment 3 (PA)3428.50.000000e+002012/2089 (96%)EPI593687A/swine/Illinois/A01047112/2010 (A/H1N2) segment 3 (PA)3428.50.000000e+002012/2089 (96%)EPI593686A/swine/Illinois/A01047089/2010 (A/H1N2) segment 3 (PA)3428.50.000000e+002012/2089 (96%)EPI593684A/swine/Illinois/A01047097/2010 (A/H1N2) segment 3 (PA)3428.50.000000e+002012/2089 (96%)- Novel H3N2v Sequence From 2015 Case In Minnesota
AlignSegment-IDNameScoreE-ValueIdentityEPI625706A/Minnesota/38/2015 (A/H3N2) segment 2 (PB1)4193.00.000000e+002270/2270 (100%)EPI490219A/swine/Texas/SG1380/2011 (A/H1N1) segment 2 (PB1)3999.10.000000e+002235/2270 (98%)EPI347223A/swine/Kansas/10-91088/2010 (A/H3N2) segment 2 (PB1)3988.00.000000e+002233/2270 (98%)EPI353846A/swine/Texas/A01049556/2011 (A/H3N2) segment 2 (PB1)3982.50.000000e+002232/2270 (98%)EPI490863A/swine/Oklahoma/SG1498/2010 (A/H3N2) segment 2 (PB1)3977.00.000000e+002231/2270 (98%)EPI353851A/swine/Iowa/A01049750/2011 (A/H3N2) segment 2 (PB1)3977.00.000000e+002231/2270 (98%)EPI353841A/swine/Texas/A01049555/2011 (A/H3N2) segment 2 (PB1)3977.00.000000e+002231/2270 (98%)EPI424041A/swine/Illinois/A01201077/2011 (A/H3N2) segment 2 (PB1)3971.40.000000e+002230/2270 (98%)EPI347238A/swine/Kansas/11-104465/2011 (A/H3N2) segment 2 (PB1)3971.40.000000e+002230/2270 (98%)EPI347230A/swine/Kansas/11-101926/2011 (A/H3N2) segment 2 (PB1)3971.40.000000e+002230/2270 (98%)EPI489166A/swine/Iowa/SG1401/2011 (A/H1N1) segment 2 (PB1)3965.90.000000e+002229/2270 (98%)EPI384092A/swine/Illinois/A01201076/2011 (A/H3N2) segment 2 (PB1)3965.90.000000e+002229/2270 (98%)EPI347270A/swine/Kansas/11-110529/2011 (A/H3N2) segment 2 (PB1)3965.90.000000e+002229/2270 (98%)EPI347246A/swine/Kansas/11-104467/2011 (A/H3N2) segment 2 (PB1)3965.90.000000e+002229/2270 (98%)EPI465170A/swine/Iowa/A01202658/2011 (A/H3N2) segment 2 (PB1)3964.00.000000e+002228/2270 (98%)EPI384148A/swine/Iowa/A01202657/2011 (A/H3N2) segment 2 (PB1)3960.30.000000e+002228/2270 (98%)EPI353861A/swine/Texas/A01049915/2011 (A/H3N2) segment 2 (PB1)3960.30.000000e+002228/2270 (98%)EPI353856A/swine/Texas/A01049914/2011 (A/H3N2) segment 2 (PB1)3960.30.000000e+002228/2270 (98%)EPI465137A/swine/Iowa/A01203121/2012 (A/H3N2) segment 2 (PB1)3954.80.000000e+002227/2270 (98%)EPI347262A/swine/Kansas/11-109700/2011 (A/H3N2) segment 2 (PB1)3954.80.000000e+002227/2270 (98%)EPI468632A/swine/Nebraska/A01241785/2012 (A/H3N2) segment 2 (PB1)3949.30.000000e+002226/2270 (98%)EPI384203A/swine/Missouri/A01241610/2012 (A/H3N2) segment 2 (PB1)3949.30.000000e+002226/2270 (98%)EPI441173A/swine/Michigan/A01203498/2012 (A/H3N2) segment 2 (PB1)3943.70.000000e+002225/2270 (98%)EPI393183A/swine/Nebraska/A01240867/2011 (A/H3N2) segment 2 (PB1)3943.70.000000e+002225/2270 (98%)EPI384223A/swine/Nebraska/A01241114/2012 (A/H3N2) segment 2 (PB1)3943.70.000000e+002225/2270 (98%)EPI361478A/swine/NE/A01101010/2011 (A/H3N2) segment 2 (PB1)3943.70.000000e+002225/2270 (98%)EPI465160A/swine/Nebraska/A01240337/2011 (A/H3N2) segment 2 (PB1)3938.20.000000e+002224/2270 (97%)EPI443454A/swine/Illinois/A01240868/2012 (A/H1N2) segment 2 (PB1)3938.20.000000e+002224/2270 (97%)EPI499721A/swine/Illinois/A00857322/2012 (A/H1N2) segment 2 (PB1)3932.60.000000e+002223/2270 (97%)EPI467497A/swine/Illinois/A00857325/2012 (A/H1N2) segment 2 (PB1)3932.60.000000e+002223/2270 (97%)EPI467489A/swine/Illinois/A00857328/2012 (A/H1N2) segment 2 (PB1)3932.60.000000e+002223/2270 (97%)EPI424061A/swine/Minnesota/A01240557/2011 (A/H3N2) segment 2 (PB1)3932.60.000000e+002223/2270 (97%)EPI468223A/swine/Nebraska/A01327747/2012 (A/H3N2) segment 2 (PB1)3927.10.000000e+002222/2270 (97%)EPI506455A/swine/Nebraska/A01300023/2012 (A/H3N2) segment 2 (PB1)3921.60.000000e+002221/2270 (97%)EPI443465A/swine/Nebraska/A01300022/2012 (A/H3N2) segment 2 (PB1)3921.60.000000e+002221/2270 (97%)EPI443459A/swine/Illinois/A01241212/2012 (A/H3N2) segment 2 (PB1)3921.60.000000e+002221/2270 (97%)EPI433478A/swine/Illinois/A01241208/2012 (A/H3N2) segment 2 (PB1)3921.60.000000e+002221/2270 (97%)EPI384213A/swine/Minnesota/A01125995/2012 (A/H3N2) segment 2 (PB1)3921.60.000000e+002221/2270 (97%)EPI475525A/swine/Missouri/A01327552/2012 (A/H3N2) segment 2 (PB1)3916.00.000000e+002220/2270 (97%)EPI475504A/swine/Missouri/A01327551/2012 (A/H3N2) segment 2 (PB1)3916.00.000000e+002220/2270 (97%)EPI385908A/swine/Missouri/A01241619/2012 (A/H3N2) segment 2 (PB1)3916.00.000000e+002220/2270 (97%)EPI219358A/swine/Kansas/015252/2009 (A/H3N2) segment 2 (PB1)3910.50.000000e+002220/2271 (97%)EPI433463A/swine/Illinois/A01203226/2012 (A/H1N1) segment 2 (PB1)3908.60.000000e+002218/2270 (97%)EPI383830A/swine/Illinois/A01240578/2011 (A/H3N2) segment 2 (PB1)3906.80.000000e+002218/2270 (97%)EPI487290A/swine/Nebraska/A01327581/2012 (A/H3N2) segment 2 (PB1)3904.90.000000e+002218/2270 (97%)EPI506418A/swine/South Dakota/A01349341/2013 (A/H1N2) segment 2 (PB1)3899.40.000000e+002217/2270 (97%)EPI465017A/swine/Illinois/A01215870/2013 (A/H1N2) segment 2 (PB1)3899.40.000000e+002217/2270 (97%)EPI424066A/swine/Minnesota/A01267122/2012 (A/H3N2) segment 2 (PB1)3899.40.000000e+002217/2270 (97%)EPI489642A/swine/Iowa/13B093/2013 (A/H1N2) segment 2 (PB1)3888.30.000000e+002216/2271 (97%)EPI485946A/swine/Iowa/13B092/2013 (A/H1N2) segment 2 (PB1)3888.30.000000e+002216/2271 (97%)EPI459224A/swine/Nebraska/A01270879/2012 (A/H3N2) segment 2 (PB1)3888.30.000000e+002215/2270 (97%)EPI219366A/swine/Oklahoma/001142/2009 (A/H3N2) segment 2 (PB1)3888.30.000000e+002216/2271 (97%)EPI487872A/swine/Minnesota/A01349281/2013 (A/H1N2) segment 2 (PB1)3882.80.000000e+002214/2270 (97%)EPI459189A/swine/Oklahoma/A01203865/2012 (A/H1N2) segment 2 (PB1)3838.50.000000e+002206/2270 (97%)EPI492012A/swine/Oklahoma/01452/2007 (A/H1N2) segment 2 (PB1)3821.80.000000e+002203/2270 (97%)EPI488604A/swine/Texas/01308/2006 (A/H1N2) segment 2 (PB1)3816.30.000000e+002202/2270 (97%)EPI490421A/swine/Iowa/SG1469/2004 (A/H3N2) segment 2 (PB1)3744.30.000000e+002190/2271 (96%)EPI101401A/turkey/Ohio/313053/04 (A/H3N2) segment 2 (PB1)3738.70.000000e+002189/2271 (96%)EPI490386A/swine/North Carolina/SG1464/2004 (A/H3N2) segment 2 (PB1)3733.20.000000e+002188/2271 (96%)EPI229378A/turkey/OH/313053/2004 (A/H3N2) segment 2 (PB1)3733.20.000000e+002188/2271 (96%)EPI337347A/swine/Iowa/01700/2007 (A/H3N2) segment 2 (PB1)3727.70.000000e+002187/2271 (96%)EPI490365A/swine/North Carolina/00371/2004 (A/H1N1) segment 2 (PB1)3722.10.000000e+002186/2271 (96%)EPI488527A/swine/Illinois/00303/2004 (A/H3N2) segment 2 (PB1)3720.30.000000e+002185/2270 (96%)EPI98708A/swine/MI/PU243/04 (A/H3N1) segment 2 (PB1)3716.60.000000e+002185/2271 (96%)EPI491982A/swine/Minnesota/00574/2005 (A/H1N1) segment 2 (PB1)3711.00.000000e+002184/2271 (96%)EPI491795A/swine/Minnesota/00574/2005 (A/H1N1) segment 2 (PB1)3711.00.000000e+002184/2271 (96%)EPI491779A/swine/North Carolina/SG1226/2005 (A/H1N1) segment 2 (PB1)3711.00.000000e+002184/2271 (96%)EPI488788A/swine/Minnesota/SG1294/2007 (A/H3N2) segment 2 (PB1)3711.00.000000e+002184/2271 (96%)EPI488562A/swine/Minnesota/SG1236/2005 (A/H3N2) segment 2 (PB1)3711.00.000000e+002184/2271 (96%)EPI488173A/swine/North Carolina/SG1197/2004 (A/H3N2) segment 2 (PB1)3711.00.000000e+002184/2271 (96%)EPI337957A/swine/Illinois/02450/2008 (A/H0) segment 2 (PB1)3711.00.000000e+002184/2271 (96%)EPI182822A/swine/Quebec/4001/2005 (A/H3N2) segment 2 (PB1)3707.30.000000e+002183/2271 (96%)EPI491787A/swine/North Carolina/SG1232/2005 (A/H1N2) segment 2 (PB1)3705.50.000000e+002183/2271 (96%)EPI489187A/swine/Manitoba/00446/2005 (A/H3N2) segment 2 (PB1)3705.50.000000e+002183/2271 (96%)EPI227580A/turkey/NC/353568/2005 (A/H3N2) segment 2 (PB1)3705.50.000000e+002183/2271 (96%)EPI222680A/swine/Oklahoma/011506/2007 (A/H3N2) segment 2 (PB1)3705.50.000000e+002185/2273 (96%)EPI158874A/turkey/MN/366767/2005 (A/H3N2) segment 2 (PB1)3705.50.000000e+002183/2271 (96%)EPI103131A/swine/Alberta/14722/2005 (A/H3N2) segment 2 (PB1)3705.50.000000e+002183/2271 (96%)EPI228920A/turkey/Illinois/2004 (A/H3N2) segment 2 (PB1)3703.70.000000e+002182/2270 (96%)EPI615430A/swine/Missouri/00563/2005 (A/H3N2) segment 2 (PB1)3700.00.000000e+002183/2272 (96%)EPI490477A/swine/North Carolina/SG1478/2005 (A/H1N1) segment 2 (PB1)3700.00.000000e+002182/2271 (96%)EPI490246A/swine/Manitoba/00446/2005 (A/H3N2) segment 2 (PB1)3700.00.000000e+002182/2271 (96%)EPI488590A/swine/Oklahoma/SG1243/2006 (A/H1N1) segment 2 (PB1)3700.00.000000e+002182/2271 (96%)EPI488576A/swine/Minnesota/00938/2005 (A/H1N1) segment 2 (PB1)3700.00.000000e+002182/2271 (96%)EPI337447A/swine/Minnesota/00611/2005 (A/H3N2) segment 2 (PB1)3700.00.000000e+002182/2271 (96%)EPI337368A/swine/Minnesota/00709/2005 (A/H3N2) segment 2 (PB1)3700.00.000000e+002183/2272 (96%)EPI103185A/swine/Ontario/33853/2005 (A/H3N2) segment 2 (PB1)3700.00.000000e+002182/2271 (96%)EPI103113A/Ontario/RV1273/2005 (A/H3N2) segment 2 (PB1)3700.00.000000e+002182/2271 (96%)EPI610195A/swine/Indiana/01101/2006 (A/H1N1) segment 2 (PB1)3694.40.000000e+002182/2272 (96%)EPI490449A/swine/Oklahoma/SG1473/2005 (A/H3N2) segment 2 (PB1)3694.40.000000e+002181/2271 (96%)EPI490127A/swine/Oklahoma/00518/2005 (A/H3N2) segment 2 (PB1)3694.40.000000e+002181/2271 (96%)EPI489194A/swine/British Columbia/00633/2005 (A/H3N2) segment 2 (PB1)3694.40.000000e+002181/2271 (96%)EPI488583A/swine/Arkansas/SG1241/2006 (A/H1N1) segment 2 (PB1)3694.40.000000e+002182/2272 (96%)EPI488569A/swine/Minnesota/SG1238/2005 (A/H3N2) segment 2 (PB1)3694.40.000000e+002181/2271 (96%)EPI488534A/swine/Oklahoma/00518/2005 (A/H3N2) segment 2 (PB1)3694.40.000000e+002181/2271 (96%)EPI335030A/swine/North Carolina/38448-1/2005 (A/H1N1) segment 2 (PB1)3694.40.000000e+002181/2271 (96%)EPI314337A/turkey/BC/1529-3/2005 (A/H3N2) segment 2 (PB1)3694.40.000000e+002181/2271 (96%)EPI488660A/swine/Minnesota/00991/2006 (A/H1N1) segment 2 (PB1)3688.90.000000e+002180/2271 (95%)EPI488625A/swine/North Carolina/01169/2006 (A/H1N2) segment 2 (PB1)3688.90.000000e+002180/2271 (95%)EPI166251A/swine/Minnesota/SG-00234/2005 (A/H3N2) segment 2 (PB1)3687.00.000000e+002176/2265 (96%)- Novel H3N2v Sequence From 2015 Case In Minnesota
AlignSegment-IDNameScoreE-ValueIdentityEPI625705A/Minnesota/38/2015 (A/H3N2) segment 1 (PB2)4180.10.000000e+002263/2263 (100%)EPI490634A/swine/Texas/SG1501/2010 (A/H3N2) segment 1 (PB2)3908.60.000000e+002215/2264 (97%)EPI475503A/swine/Missouri/A01327551/2012 (A/H3N2) segment 1 (PB2)3853.20.000000e+002206/2265 (97%)EPI219357A/swine/Kansas/015252/2009 (A/H3N2) segment 1 (PB2)3847.70.000000e+002205/2265 (97%)EPI475524A/swine/Missouri/A01327552/2012 (A/H3N2) segment 1 (PB2)3842.20.000000e+002204/2265 (97%)EPI443464A/swine/Illinois/A01241212/2012 (A/H3N2) segment 1 (PB2)3842.20.000000e+002204/2265 (97%)EPI385907A/swine/Missouri/A01241619/2012 (A/H3N2) segment 1 (PB2)3842.20.000000e+002204/2265 (97%)EPI384212A/swine/Minnesota/A01125995/2012 (A/H3N2) segment 1 (PB2)3842.20.000000e+002204/2265 (97%)EPI383829A/swine/Illinois/A01240578/2011 (A/H3N2) segment 1 (PB2)3842.20.000000e+002204/2265 (97%)EPI433477A/swine/Illinois/A01241208/2012 (A/H3N2) segment 1 (PB2)3836.60.000000e+002203/2265 (97%)EPI219365A/swine/Oklahoma/001142/2009 (A/H3N2) segment 1 (PB2)3836.60.000000e+002203/2265 (97%)EPI490735A/swine/Oklahoma/02985/2010 (A/H3N2) segment 1 (PB2)3808.90.000000e+002198/2265 (97%)EPI490450A/swine/Oklahoma/SG1473/2005 (A/H3N2) segment 1 (PB2)3759.10.000000e+002192/2268 (96%)EPI615640A/swine/North Carolina/00271/2004 (A/H3N2) segment 1 (PB2)3753.50.000000e+002190/2267 (96%)EPI490422A/swine/Iowa/SG1469/2004 (A/H3N2) segment 1 (PB2)3753.50.000000e+002190/2267 (96%)EPI490387A/swine/North Carolina/SG1464/2004 (A/H3N2) segment 1 (PB2)3753.50.000000e+002190/2267 (96%)EPI490142A/swine/Georgia/SG1251/2006 (A/H1N1) segment 1 (PB2)3753.50.000000e+002189/2266 (96%)EPI229379A/turkey/OH/313053/2004 (A/H3N2) segment 1 (PB2)3753.50.000000e+002190/2267 (96%)EPI101403A/turkey/Ohio/313053/04 (A/H3N2) segment 1 (PB2)3753.50.000000e+002190/2267 (96%)EPI490858A/swine/North Carolina/00950/2006 (A/H3N2) segment 1 (PB2)3742.40.000000e+002188/2267 (96%)EPI490128A/swine/Oklahoma/00518/2005 (A/H3N2) segment 1 (PB2)3742.40.000000e+002188/2267 (96%)EPI488535A/swine/Oklahoma/00518/2005 (A/H3N2) segment 1 (PB2)3742.40.000000e+002188/2267 (96%)EPI227581A/turkey/NC/353568/2005 (A/H3N2) segment 1 (PB2)3742.40.000000e+002188/2267 (96%)EPI490408A/swine/Minnesota/00352/2004 (A/H1N1) segment 1 (PB2)3736.90.000000e+002186/2266 (96%)EPI490366A/swine/North Carolina/00371/2004 (A/H1N1) segment 1 (PB2)3736.90.000000e+002187/2267 (96%)EPI488570A/swine/Minnesota/SG1238/2005 (A/H3N2) segment 1 (PB2)3736.90.000000e+002186/2266 (96%)EPI488528A/swine/Illinois/00303/2004 (A/H3N2) segment 1 (PB2)3736.90.000000e+002186/2266 (96%)EPI584509A/swine/Minnesota/01082/2006 (A/H1N2) segment 1 (PB2)3731.40.000000e+002186/2267 (96%)EPI491788A/swine/North Carolina/SG1232/2005 (A/H1N2) segment 1 (PB2)3731.40.000000e+002186/2267 (96%)EPI488724A/swine/Kentucky/SG1277/2007 (A/H1N1) segment 1 (PB2)3731.40.000000e+002186/2267 (96%)EPI337392A/swine/Nebraska/00722/2005 (A/H0) segment 1 (PB2)3731.40.000000e+002185/2266 (96%)EPI337348A/swine/Iowa/01700/2007 (A/H3N2) segment 1 (PB2)3731.40.000000e+002186/2267 (96%)EPI103201A/turkey/Ontario/31232/2005 (A/H3N2) segment 1 (PB2)3731.40.000000e+002185/2266 (96%)EPI103183A/swine/Ontario/33853/2005 (A/H3N2) segment 1 (PB2)3731.40.000000e+002185/2266 (96%)EPI103147A/swine/British Columbia/28103/2005 (A/H3N2) segment 1 (PB2)3731.40.000000e+002185/2266 (96%)EPI103111A/Ontario/RV1273/2005 (A/H3N2) segment 1 (PB2)3731.40.000000e+002185/2266 (96%)EPI490247A/swine/Manitoba/00446/2005 (A/H3N2) segment 1 (PB2)3725.80.000000e+002185/2267 (96%)EPI489188A/swine/Manitoba/00446/2005 (A/H3N2) segment 1 (PB2)3725.80.000000e+002185/2267 (96%)EPI488174A/swine/North Carolina/SG1197/2004 (A/H3N2) segment 1 (PB2)3725.80.000000e+002185/2267 (96%)EPI337448A/swine/Minnesota/00611/2005 (A/H3N2) segment 1 (PB2)3725.80.000000e+002185/2267 (96%)EPI491983A/swine/Minnesota/00574/2005 (A/H1N1) segment 1 (PB2)3720.30.000000e+002184/2267 (96%)EPI491796A/swine/Minnesota/00574/2005 (A/H1N1) segment 1 (PB2)3720.30.000000e+002184/2267 (96%)EPI490814A/swine/Quebec/01002/2006 (A/H3N2) segment 1 (PB2)3720.30.000000e+002183/2266 (96%)EPI490661A/swine/Oklahoma/00606/2005 (A/H3N2) segment 1 (PB2)3720.30.000000e+002183/2266 (96%)EPI489209A/swine/Alberta/00805/2005 (A/H3N2) segment 1 (PB2)3720.30.000000e+002184/2267 (96%)EPI489195A/swine/British Columbia/00633/2005 (A/H3N2) segment 1 (PB2)3720.30.000000e+002184/2267 (96%)EPI488563A/swine/Minnesota/SG1236/2005 (A/H3N2) segment 1 (PB2)3720.30.000000e+002184/2267 (96%)EPI488556A/swine/North Carolina/SG1230/2005 (A/H3N2) segment 1 (PB2)3720.30.000000e+002184/2267 (96%)EPI158873A/turkey/MN/366767/2005 (A/H3N2) segment 1 (PB2)3720.30.000000e+002185/2268 (96%)EPI615429A/swine/Missouri/00563/2005 (A/H3N2) segment 1 (PB2)3714.70.000000e+002183/2267 (96%)EPI491780A/swine/North Carolina/SG1226/2005 (A/H1N1) segment 1 (PB2)3714.70.000000e+002183/2267 (96%)EPI490478A/swine/North Carolina/SG1478/2005 (A/H1N1) segment 1 (PB2)3714.70.000000e+002183/2267 (96%)EPI490254A/swine/Alberta/SG1415/2006 (A/H1N1) segment 1 (PB2)3714.70.000000e+002183/2267 (96%)EPI489202A/swine/Alberta/SG1405/2005 (A/H3N2) segment 1 (PB2)3714.70.000000e+002183/2267 (96%)EPI488754A/swine/Kentucky/01569/2007 (A/H1N1) segment 1 (PB2)3714.70.000000e+002183/2267 (96%)EPI337958A/swine/Illinois/02450/2008 (A/H0) segment 1 (PB2)3714.70.000000e+002183/2267 (96%)EPI337552A/swine/Minnesota/00484/2005 (A/H3N2) segment 1 (PB2)3714.70.000000e+002182/2266 (96%)EPI337355A/swine/Minnesota/01146/2006 (A/H3N2) segment 1 (PB2)3714.70.000000e+002182/2266 (96%)EPI228919A/turkey/Illinois/2004 (A/H3N2) segment 1 (PB2)3714.70.000000e+002182/2266 (96%)EPI182823A/swine/Quebec/4001/2005 (A/H3N2) segment 1 (PB2)3714.70.000000e+002182/2266 (96%)EPI103165A/swine/Manitoba/12707/2005 (A/H3N2) segment 1 (PB2)3714.70.000000e+002183/2267 (96%)EPI98706A/swine/MI/PU243/04 (A/H3N1) segment 1 (PB2)3714.70.000000e+002183/2267 (96%)EPI584532A/swine/Minnesota/01076/2006 (A/H1N1) segment 1 (PB2)3709.20.000000e+002181/2266 (96%)EPI490513A/swine/North Carolina/01506/2006 (A/H3N2) segment 1 (PB2)3709.20.000000e+002184/2269 (96%)EPI489216A/swine/Quebec/01001/2006 (A/H3N2) segment 1 (PB2)3709.20.000000e+002181/2266 (96%)EPI488761A/swine/Minnesota/01882/2007 (A/H1N1) segment 1 (PB2)3709.20.000000e+002181/2266 (96%)EPI488577A/swine/Minnesota/00938/2005 (A/H1N1) segment 1 (PB2)3709.20.000000e+002181/2266 (96%)EPI492092A/swine/North Carolina/SG1175/2003 (A/H1N1) segment 1 (PB2)3703.70.000000e+002180/2266 (96%)EPI488873A/swine/North Carolina/02403/2008 (A/H1N1) segment 1 (PB2)3703.70.000000e+002181/2267 (96%)EPI488740A/swine/North Carolina/SG1282/2007 (A/H0) segment 1 (PB2)3703.70.000000e+002181/2267 (96%)EPI488731A/swine/North Carolina/SG1278/2007 (A/H1N1) segment 1 (PB2)3703.70.000000e+002181/2267 (96%)EPI388379A/Michigan/09/2007 (A/H1N2) segment 1 (PB2)3700.00.000000e+002180/2267 (96%)EPI291825A/Michigan/09/2007 (A/H1N2) segment 1 (PB2)3700.00.000000e+002180/2267 (96%)EPI615615A/swine/Minnesota/01601/2007 (A/H1N2) segment 1 (PB2)3698.10.000000e+002180/2267 (96%)EPI492152A/swine/North Carolina/SG1202/2004 (A/H1N1) segment 1 (PB2)3698.10.000000e+002178/2265 (96%)EPI491678A/swine/Nebraska/SG1178/2003 (A/H3N2) segment 1 (PB2)3698.10.000000e+002179/2266 (96%)EPI491654A/swine/North Carolina/SG1170/2003 (A/H1N1) segment 1 (PB2)3698.10.000000e+002179/2266 (96%)EPI490548A/swine/North Carolina/01469/2007 (A/H3N2) segment 1 (PB2)3698.10.000000e+002180/2267 (96%)EPI488747A/swine/North Carolina/01930/2007 (A/H3N2) segment 1 (PB2)3698.10.000000e+002180/2267 (96%)EPI337480A/swine/Minnesota/SG1133/2008 (A/H1N2) segment 1 (PB2)3698.10.000000e+002179/2266 (96%)EPI337369A/swine/Minnesota/00709/2005 (A/H3N2) segment 1 (PB2)3698.10.000000e+002180/2267 (96%)EPI291791A/Illinois/09/2007 (A/H1N1) segment 1 (PB2)3698.10.000000e+002180/2267 (96%)EPI610194A/swine/Indiana/01101/2006 (A/H1N1) segment 1 (PB2)3692.60.000000e+002179/2267 (96%)EPI491967A/swine/North Carolina/SG1202/2004 (A/H1N1) segment 1 (PB2)3692.60.000000e+002177/2265 (96%)EPI490683A/swine/North Carolina/SG1255/2006 (A/H1N1) segment 1 (PB2)3692.60.000000e+002179/2267 (96%)EPI489223A/swine/Saskatchewan/01114/2006 (A/H3N2) segment 1 (PB2)3692.60.000000e+002178/2266 (96%)EPI488668A/swine/Illinois/01131/2006 (A/H3N2) segment 1 (PB2)3692.60.000000e+002181/2269 (96%)EPI488661A/swine/Minnesota/00991/2006 (A/H1N1) segment 1 (PB2)3692.60.000000e+002179/2267 (96%)EPI488626A/swine/North Carolina/01169/2006 (A/H1N2) segment 1 (PB2)3692.60.000000e+002179/2267 (96%)EPI323265A/swine/Minnesota/66853/2006 (A/H3N2) segment 1 (PB2)3692.60.000000e+002179/2267 (96%)EPI323254A/swine/Minnesota/1300/2007 (A/H3N2) segment 1 (PB2)3692.60.000000e+002179/2267 (96%)EPI291853A/Missouri/04/2006 (A/H1N1) segment 1 (PB2)3692.60.000000e+002179/2267 (96%)EPI291794A/Iowa/01/2006 (A/H1N1) segment 1 (PB2)3692.60.000000e+002178/2266 (96%)EPI185085A/swine/Minnesota/SG-00239/2007 (A/H1N2) segment 1 (PB2)3692.60.000000e+002179/2267 (96%)EPI491832A/swine/Minnesota/SG1237/2005 (A/H1N1) segment 1 (PB2)3687.00.000000e+002178/2267 (96%)EPI490555A/swine/North Carolina/01855/2007 (A/H1N1) segment 1 (PB2)3687.00.000000e+002178/2267 (96%)EPI490149A/swine/Minnesota/SG1261/2006 (A/H1N1) segment 1 (PB2)3687.00.000000e+002177/2266 (96%)EPI488647A/swine/Minnesota/SG1261/2006 (A/H1N1) segment 1 (PB2)3687.00.000000e+002177/2266 (96%)EPI488584A/swine/Arkansas/SG1241/2006 (A/H1N1) segment 1 (PB2)3687.00.000000e+002178/2267 (96%)EPI337536A/swine/Minnesota/001332/2006 (A/H3N2) segment 1 (PB2)3687.00.000000e+002179/2268 (96%) - MERS Outbreak Centered In Riyadh KSA
Account
Navigation
Search
Configure browser push notifications
Chrome (Android)
- Tap the lock icon next to the address bar.
- Tap Permissions → Notifications.
- Adjust your preference.
Chrome (Desktop)
- Click the padlock icon in the address bar.
- Select Site settings.
- Find Notifications and adjust your preference.
Safari (iOS 16.4+)
- Ensure the site is installed via Add to Home Screen.
- Open Settings App → Notifications.
- Find your app name and adjust your preference.
Safari (macOS)
- Go to Safari → Preferences.
- Click the Websites tab.
- Select Notifications in the sidebar.
- Find this website and adjust your preference.
Edge (Android)
- Tap the lock icon next to the address bar.
- Tap Permissions.
- Find Notifications and adjust your preference.
Edge (Desktop)
- Click the padlock icon in the address bar.
- Click Permissions for this site.
- Find Notifications and adjust your preference.
Firefox (Android)
- Go to Settings → Site permissions.
- Tap Notifications.
- Find this site in the list and adjust your preference.
Firefox (Desktop)
- Open Firefox Settings.
- Search for Notifications.
- Find this site in the list and adjust your preference.