niman

The level 3 warning for travel to Wuhan has been expanded to the entire country. https://wwwnc.cdc.gov/travel/notices/warning/novel-coronavirus-china

Patient 1 showed symptoms on Dec 1. Partial sequence was described as novel coronavirus at end of December

19 people under observation for possible coronavirus infection; second 'presumptive' case found A man wears a masks as a precaution due to the coronavirus outbreak as people arrive from the International terminal at Toronto Pearson International Airport in Toronto on Saturday, January 25, 2020. Canadian health officials announced a first presumed case in Ontario after the illness has sickened more than 1,200 people and killed at least 41 in China, the epicentre of the outbreak. THE CANADIAN PRESS/Nathan Denette He remains at Sunnybrook Hospital in stable condition. Elliott told CP24 that his wife remains in self-isolation at her home, while “next steps are determined.” Toronto Medical Officer of Health Dr. Eileen de Villa said the woman in her mid-50s, is “asymptomatic” at this point and they are checking in with her regularly, with no plans to transfer her to hospital. “She is staying at home, because she is sick – this is good practice – if you’re sick and you have respiratory symptoms – a cough, sore throat or fever, the best advice is to stay at home.” The National Microbiology Lab in Winnipeg has offered a double-confirmation for the man’s case, while they are still analyzing the data from his wife. The wife’s sample tested positive at Public Health Ontario’s laboratory in Toronto. Dr. Barbara Yaffe, Ontario Associate Chief Medical Officer of Health, said that since last week, public health officials have come into contact with 36 people who feared they were infected with 2019 novel coronavirus, the official name of the virus. Of those, 15 people have been cleared entirely through testing, one is absolutely confirmed to have the virus, one is a presumptive positive case of the virus, and 19 others are under observation while they await test results. Ontario Chief Medical Officer of Health Dr. David Williams said “quite a few” of those 19 are under isolation at Toronto-area hospitals. He said that given patterns emerging abroad, it is unlikely all 19 people under observation will be medically cleared. “I would guess we are going to see some other cases reported in other parts of Ontario perhaps,” he said. But Dr. Yaffe was more optimistic, saying it could be possible all of them would be cleared. “If I were to predict, probably all of them have something else, but we are being extra, extra cautious,” she told reporters assembled at Queen’s Park. She also said that all of the cases being reported outside of China originated from people who travelled to Hubei province. All 19 of those still under investigation in Ontario travelled to the Hubei province, which contains the most-heavily impacted city of Wuhan, in the last several weeks. Dr. De Villa said Toronto health workers have been able to make contact “with a few” people who were aboard the China Southern Airlines Flight CZ311 that has so far produced the country’s only confirmed cases, but may need to make a public appeal in the future to get in contact with more passengers. But she said passengers who were on that flight, or others from China this week, and are not suffering any symptoms, should not panic. “What we’re asking them to do is continue about regular business should they develop signs and symptoms and to stay home,” adding that Toronto Public Health had beefed up the team it is devoting to conducting investigations into possible cases. The global spread of the virus has infected nearly 2,800 people and so far claimed 81 lives, all in China. https://www.cp24.com/news/19-people-under-observation-for-possible-coronavirus-infection-second-presumptive-case-found-1.4784787

Not my area, but for SARS, US only had a handful of mild cases.

They answered today. Said virus didn't survive on surfaces and there was no problem with SARS CoV

People Under Investigation (PUI) in the United States*† As of 1/27/2020 People under Investigation (PUI) in the United States Positive 5 Negative 32 Pending§ 73 Total 110 *Cumulative since January 21, 2020. † Numbers closed out at 7 p.m. the night before reporting. §Includes specimens received and awaiting testing, as well as specimens in route to CDC. Number of states with PUI: 26 https://www.cdc.gov/coronavirus/2019-ncov/cases-in-us.html

Ontario Confirms Second Presumptive Case of Wuhan Novel Coronavirus Wife of First Case, Now Confirmed Positive, has been in Self-Isolation January 27, 2020 7:00 A.M. Ministry of Health TORONTO — Today, Dr. David Williams, Chief Medical Officer of Health, confirmed that the wife of the province's first case of Wuhan novel coronavirus has tested positive for the virus at Ontario's public health laboratory. Since arriving in Toronto with her husband, this individual has been in self-isolation. "We are working alongside Toronto Public Health, who has been in regular contact with the individual during their self-isolation period," said Dr. Williams. "Given the fact that she has been in self-isolation, the risk to Ontarians remains low." Dr. Williams, joined by Dr. Barbara Yaffe, Associate Chief Medical Officer of Health, and Dr. Eileen de Villa, Medical Officer of Health for the City of Toronto, will provide an update on the emerging situation at 11:30 a.m. at Queen's Park. A media advisory will be issued shortly with further details. Media Contacts Travis Kann Director, Communications [email protected] 647-388-5845 David Jensen Communications Branch [email protected] 416-314-6197 https://news.ontario.ca/mohltc/en/2020/01/ontario-confirms-second-presumptive-case-of-wuhan-novel-coronavirus.html

Status of cases in Ontario Every week day at 10:30 a.m. ET, this web page will be updated with the most up-to-date information on the status of cases in Ontario. The symptoms of Wuhan novel coronavirus, which can include fever and cough, are similar to other respiratory infections, including influenza. As a result, individuals who may simply have the flu are being tested out of an abundance of caution and in line with Ontario’s robust detection protocols. This means that most individuals who are tested are unlikely to be infected with Wuhan novel coronavirus. Cases currently under investigation Confirmed cases 19 2 (presumptive) Last updated: January 27, 2020 at 10:30 a.m. ET

Decision on screening changes in next day

2-14 days incubation still evolving

screened 2400 so far Wuhan numbers declining Screen returning travelers Considering broadening screening

110 pui's in 26 states 5 positives 32 negative protocol for test posted online plan is to test at other sites sequences at Genbank Claim no mutations in US sequences both have mutation in orf 8 Avoid non-essential travel to Hubei Other areas use caution Report symptoms when return

Media Advisory For Immediate Release Monday, January 27, 2020 Contact: CDC Media Relations (404) 639-3286 CDC Telebriefing: Update on 2019 Novel Coronavirus (2019-nCoV) What The Centers for Disease Control and Prevention (CDC) will provide an update on the 2019 Novel Coronavirus response. Who Nancy Messonnier, M.D., Director, National Center for Immunization and Respiratory Diseases When 11:30 a.m. ET Monday, January 27, 2020 Dial-In Media: 800-857-9756 International Media: 1-212-287-1647 PASSCODE: CDC Media Non-Media: 888-795-0855 International Non-Media: 1-630-395-0498 PASSCODE: 1792134 Important Instructions Due to anticipated high volume, please plan to dial in to the telebriefing 15 minutes before the start time. If you would like to ask a question during the call, press *1 on your touchtone phone. Press *2 to withdraw your question. You may queue up at any time. You will hear a tone to indicate your question is pending. TRANSCRIPT

CDC Telebriefing: Update on 2019 Novel Coronavirus (2019-nCoV)

Thank you. Unfortunately, the current outbreak is orders of magnitude worse than SARS.

Today's update from the China CDC indicated that the number of PCR confirmed cases (8,538), which represent a jump of 3,879 cases over yesterday's total, exceeded the total for confirmed cases in the SARS 2002/2003 outbreak , which lasted 6 months. The exponential growth went largely unnoticed. Media reports focused on confirmed cases, which are those that test positive twice. The first test is done locally at regional centers. The positives are then sent to the National Lab, in Wuhan, for confirmation. Confirmations have showed a steady rise in the past three days (1287-->1975-->2794). In contrast, the rise is suspect (presumptive positive) cases has been much more dramatic (1965-->2684-->5794) to generate alarming totals for lab confirmed (1X) cases (3252-->4659-->8538). The above numbers are also published by WHO in their situation reports, which lag China CDC updates by a day. This epic failure to communication the significance of the increases in the suspect cases by these two organizations (and reporters who theoretically read them) remains remarkable. http://www.chinacdc.cn/jkzt/crb/zl/szkb_11803/jszl_11809/202001/t20200127_211470.html

Cases currently under investigation: Confirmed cases: 9 1 (presumptive) Last updated: January 26, 2020 at 10:30 a.m. ET https://www.ontario.ca/page/wuhan-novel-coronavirus-2019-ncov#section-0

Chris Herhalt, CP24.com Published Monday, January 27, 2020 7:09AM EST Last Updated Monday, January 27, 2020 8:07AM EST The Province’s Chief Medical Officer of Health says officials have confirmed a second case of coronavirus in Toronto. "Since arriving in Toronto with her husband, this individual has been in self-isolation," a statement from the provincial government says. Ontario Health Minister Christine Elliott says the second patient is the wife of the first Canadian patient, who federal officials said departed Wuhan, China and boarded China Southern Airlines Flight CZ311, which landed at Pearson from Guangzhou, China on Jan. 22. RELATED STORIES Should you buy a mask? Health experts weigh on coronavirus worries PHOTOS A man wears a masks as a precaution due to the coronavirus outbreak as people arrive from the International terminal at Toronto Pearson International Airport in Toronto on Saturday, January 25, 2020. Canadian health officials announced a first presumed case in Ontario after the illness has sickened more than 1,200 people and killed at least 41 in China, the epicentre of the outbreak. THE CANADIAN PRESS/Nathan Denette Federal officials said Sunday that the first patient, a man in his 50s, showed mild symptoms aboard the flight, and public health workers were seeking to make contact with anyone who sat near him on the plane. He remains at Sunnybrook Hospital in stable condition. “The message we want all Ontarians to know is that the system is working — we are containing this virus,” Elliott said. She told CP24 the wife remains in self-isolation at her home, while “next steps are determined.” The National Microbiology Lab in Winnipeg has not yet offered a double-confirmation for either of the two cases, which is why Ontario officials are referring to them as “presumptive positive” cases for the time being. “Ontario does have testing facilities which gives us an advance ability to react to this case 36 to 48 hrs ahead of Winnipeg,” Elliott said. The global spread of the virus has so far claimed 81 lives, all in China. Health officials from the province and the City of Toronto are set to speak about this second case at a news conference at Queen’s Park at 11:30 a.m. Monday. https://t.co/I7RmBYU2kT?amp=1

Public health officials in Ontario say the wife of a man who is the country's first case of the new coronavirus has tested positive for the virus. They say the woman has been in self-isolation since arriving in Toronto with her husband. This is the second case of the coronavirus reported in Canada.

Wife of 1st confirmed nCoV case in Canada has tested positive.

Sorry for the delay. The 2019-nCoV is a bat virus, so it would be expected to match bat sequences. The two best matches at Genbank were deposited by the same lab. An even closer match was released on Saturday at GISAID. The 100% match with the bat sequence above is not a surprise, since the protein used is so small (75 amino acids), The virus sequence is about 30,000 nucleotides long, which codes for 10,000 amino acids,so 75 amino acids is a short stretch and coronavruses recombine so some areas are closer than others. Bat sequences have been studied because bats have many coronaviruses,and labs across the world focused on bat sequences after SARS. Bats also have MERS related sequences and a couple additional human coronviruses that produce mild disease were also discovered in bats. The 100% match above provides no data to suspect that the nCoV was genetically manipulated. A match of a bat virus with a bat virus is expected. nCoV is a bat vrius that is has jumped to humans, but it will match at a level >99% with some bat nCoV (the above sequence is from an isolate that matches around 92% for the full 30,000 positions.

LOCUS MN970003 290 bp RNA linear VRL 23-JAN-2020 DEFINITION Wuhan seafood market pneumonia virus isolate SI200040-SP orf1ab polyprotein, RdRP region, (orf1ab) gene, partial cds. ACCESSION MN970003 VERSION MN970003.1 KEYWORDS . SOURCE Wuhan seafood market pneumonia virus ORGANISM Wuhan seafood market pneumonia virus Viruses; Riboviria; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; unclassified Betacoronavirus. REFERENCE 1 (bases 1 to 290) AUTHORS Buathong,R., Wacharapluesadee,S., Lamsirithawon,S., Chaifoo,W., Ponpinit,T., Joyjinda,Y., Ruchisrisarod,C., Rodpan,A., Sirivichatakul,S., Vachiraphan,A., Plipat,T. and Hemachudha,T. TITLE Direct Submission JOURNAL Submitted (19-JAN-2020) Faculty of Medicine, Chulalongkorn University, Rama IV Rd, Bangkok 10330, Thailand COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..290 /organism="Wuhan seafood market pneumonia virus" /mol_type="genomic RNA" /isolate="SI200040-SP" /isolation_source="sputum" /host="Homo sapiens" /db_xref="taxon:2697049" /country="Thailand" /collection_date="08-Jan-2020" gene <1..>290 /gene="orf1ab" CDS <1..>290 /gene="orf1ab" /note="pp1ab" /codon_start=2 /product="orf1ab polyprotein" /protein_id="QHN69982.1" /translation="KHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGF ELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI" mat_peptide <1..>290 /gene="orf1ab" /product="RdRP" ORIGIN 1 taaacacctc ataccactta tgtacaaagg acttccttgg aatgtagtgc gtataaagat 61 tgtacaaatg ttaagtgaca cacttaaaaa tctctctgac agagtcgtat ttgtcttatg 121 ggcacatggc tttgagttga catctatgaa gtattttgtg aaaataggac ctgagcgcac 181 ctgttgtcta tgtgatagac gtgccacatg cttttccact gcttcagaca cttatgcctg 241 ttggcatcat tctattggat ttgattacgt ctataatccg tttatgattg

LOCUS MN970004 290 bp RNA linear VRL 23-JAN-2020 DEFINITION Wuhan seafood market pneumonia virus isolate SI200121-SP orf1ab polyprotein, RdRP region, (orf1ab) gene, partial cds. ACCESSION MN970004 VERSION MN970004.1 KEYWORDS . SOURCE Wuhan seafood market pneumonia virus ORGANISM Wuhan seafood market pneumonia virus Viruses; Riboviria; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; unclassified Betacoronavirus. REFERENCE 1 (bases 1 to 290) AUTHORS Buathong,R., Wacharapluesadee,S., Lamsirithawon,S., Chaifoo,W., Ponpinit,T., Joyjinda,Y., Ruchisrisarod,C., Rodpan,A., Sirivichatakul,S., Vachiraphan,A., Plipat,T. and Hemachudha,T. TITLE Direct Submission JOURNAL Submitted (19-JAN-2020) Faculty of Medicine, Chulalongkorn University, Rama IV Rd, Bangkok 10330, Thailand COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..290 /organism="Wuhan seafood market pneumonia virus" /mol_type="genomic RNA" /isolate="SI200121-SP" /isolation_source="sputum" /host="Homo sapiens" /db_xref="taxon:2697049" /country="Thailand" /collection_date="13-Jan-2020" gene <1..>290 /gene="orf1ab" CDS <1..>290 /gene="orf1ab" /note="pp1ab" /codon_start=2 /product="orf1ab polyprotein" /protein_id="QHN69983.1" /translation="KHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGF ELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMI" mat_peptide <1..>290 /gene="orf1ab" /product="RdRP" ORIGIN 1 taaacacctc ataccactta tgtacaaagg acttccttgg aatgtagtgc gtataaagat 61 tgtacaaatg ttaagtgaca cacttaaaaa tctctctgac agagtcgtat ttgtcttatg 121 ggcacatggc tttgagttga catctatgaa gtattttgtg aaaataggac ctgagcgcac 181 ctgttgtcta tgtgatagac gtgccacatg cttttccact gcttcagaca cttatgcctg 241 ttggcatcat tctattggat ttgattacgt ctataatccg tttatgattg

Partial sequences from orf1ab from Thailand patients released at Genbank.

Update on pneumonia of new coronavirus infection as of 24:00 on January 26 2020-01-27 　 At 02:00 on January 26, 30 provinces (autonomous regions and municipalities) reported 769 new confirmed cases, 137 severe cases, 24 new deaths (24 cases in Hubei Province), and new cured cases. 2 cases, 3806 suspected cases were newly added. 　　As of 24:00 on January 26, the National Health and Health Commission had received a total of 2,744 confirmed cases in 30 provinces (autonomous regions and municipalities), 461 cases of severe cases, 80 cases of deaths, and 51 cases of hospitalized cures. There are 5794 suspected cases. 　　At present, 32,799 close contacts have been traced, 583 people were released from medical observation on the same day, and 30,453 people are currently receiving medical observation. 　　A total of confirmed cases were reported from Hong Kong, Macao and Taiwan: 8 cases from Hong Kong Special Administrative Region, 5 cases from Macao Special Administrative Region, and 4 cases from Taiwan. 　　In addition, accumulative confirmed cases were reported from abroad: 7 in Thailand, 3 in Japan, 3 in South Korea, 3 in the United States, 2 in Vietnam, 4 in Singapore, 3 in Malaysia, 1 in Nepal, 3 in France, and 4 in Australia.