Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. Federal University of Rio de Janeiro has released partial Zika sequences from Brazil cases infected via transfusions.
  2. Sequence Map Update https://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU
  3. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX262887.1|Zika virus isolate 103451, complete genome15321532100%0.0100%KX262887.1Select seq gb|KX173843.1|Zika virus isolate 16Z62 envelope protein gene, partial cds15321532100%0.0100%KX173843.1Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome15261526100%0.099%KX253996.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds15261526100%0.099%KX247632.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds15261526100%0.099%KX185891.1Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds15261526100%0.099%KU937936.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome15261526100%0.099%KX117076.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome15261526100%0.099%KX051563.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome15261526100%0.099%KU509998.3Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds15261526100%0.099%KU963796.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds15261526100%0.099%KU991811.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome15261526100%0.099%KU940228.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds15261526100%0.099%KU955589.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome15261526100%0.099%KU870645.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome15261526100%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome15261526100%0.099%KU922923.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds15261526100%0.099%KU866423.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome15261526100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome15261526100%0.099%KU853012.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome15261526100%0.099%KU820899.2Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds15261526100%0.099%KU729218.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome15261526100%0.099%KU527068.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds15261526100%0.099%KU646828.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds15261526100%0.099%KU647676.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds15261526100%0.099%KU365778.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds15261526100%0.099%KU312314.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds15261526100%0.099%KJ776791.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome15231523100%0.099%KX247646.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome15231523100%0.099%KX198135.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome15231523100%0.099%KX197192.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome15231523100%0.099%KX156776.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome15231523100%0.099%KX156775.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome15231523100%0.099%KX156774.1Select seq gb|KX101060.1|Zika virus isolate Bahia02, partial genome15231523100%0.099%KX101060.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome15231523100%0.099%KU926310.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome15231523100%0.099%KU926309.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds15231523100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds15231523100%0.099%KU501216.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds15231523100%0.099%KU312315.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome15231523100%0.099%KU321639.1Select seq gb|KX173844.1|Zika virus isolate 16Z62 envelope protein gene, partial cds1521152199%0.0100%KX173844.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome15191519100%0.099%KU940224.1Select seq gb|KU820897.2|Zika virus isolate FLR polyprotein gene, complete cds15171517100%0.099%KU820897.2Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome15171517100%0.099%KX087101.2Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome15171517100%0.099%KX087102.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds15171517100%0.099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds15171517100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds15171517100%0.099%KU761564.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome15171517100%0.099%KU681081.3Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome15171517100%0.099%KU497555.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome15171517100%0.099%KU707826.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome15171517100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds15171517100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds15171517100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds15171517100%0.099%KU365777.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds15171517100%0.099%KU312313.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds15171517100%0.099%KJ634273.1Select seq gb|KX173841.1|Zika virus isolate 16Z11 envelope protein gene, partial cds1516151699%0.099%KX173841.1Select seq gb|KX173840.1|Zika virus isolate 16Z10 envelope protein gene, partial cds1516151699%0.099%KX173840.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds15141514100%0.099%KX056898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds15141514100%0.099%KU955590.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds15141514100%0.099%KU729217.2Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds15141514100%0.099%KU646827.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds15141514100%0.099%KU312312.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome15051505100%0.099%KU744693.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome14991499100%0.099%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds14991499100%0.099%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds14961496100%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds14901490100%0.099%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome14721472100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds13791379100%0.096%HQ234499.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds11261126100%0.089%KF268950.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds11261126100%0.089%KF268948.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome1115111599%0.089%KU955595.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1115111599%0.089%KF383116.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome1110111099%0.089%KX198134.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome1110111099%0.089%KU955592.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome1110111099%0.089%KU955591.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds1110111099%0.089%HQ234501.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds10851085100%0.088%KU720415.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds10851085100%0.088%KF383121.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds10851085100%0.088%KF383119.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds10851085100%0.088%HQ234498.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1074107499%0.088%KF383117.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID10721072100%0.088%LC002520.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds10721072100%0.088%KF383115.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds10561056100%0.087%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome10501050100%0.087%KU955594.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome10501050100%0.087%AY632535.2Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1016101699%0.087%KF383118.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence91791799%0.084%KF383120.1Select seq gb|KX101061.1|Zika virus isolate Bahia03, partial genome888136589%0.099%KX101061.1Select seq gb|KX101066.1|Zika virus isolate Bahia01, partial genome884136789%0.099%KX101066.1Select seq gb|KF270886.1|Zika virus strain CCB-870 envelope glycoprotein gene, partial cds68468463%0.088%KF270886.1Select seq gb|KF383039.1|Zika virus strain HD78788 envelope protein gene, partial cds65565559%0.089%KF383039.1Select seq gb|KF383032.1|Zika virus strain ArD30101 envelope protein gene, partial cds65565559%0.089%KF383032.1Select seq gb|KF383022.1|Zika virus strain ArD127988 envelope protein gene, partial cds65565559%0.089%KF383022.1Select seq gb|KF383034.1|Zika virus strain ArD30156 envelope protein gene, partial cds65265259%0.089%KF383034.1Select seq gb|KF383026.1|Zika virus strain ArD127994 envelope protein gene, partial cds65265259%0.089%KF383026.1Select seq gb|KU985088.1|Zika virus isolate MEX/InDRE/Zika-2/2015 envelope protein gene, partial cds65065042%0.0100%KU985088.1
  4. LOCUS KX173843 849 bp RNA linear VRL 06-MAY-2016 DEFINITION Zika virus isolate 16Z62 envelope protein gene, partial cds. ACCESSION KX173843 VERSION KX173843.1 GI:1026288133 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 849) AUTHORS Roimicher,L., Tanuri,A., Ferreira,O.C. Jr., Brindeiro,R.M. and Arruda,M.B. TITLE Zika Virus in the Joints and Arthritis JOURNAL Unpublished REFERENCE 2 (bases 1 to 849) AUTHORS Roimicher,L., Tanuri,A., Ferreira,O.C. Jr., Brindeiro,R.M. and Arruda,M.B. TITLE Direct Submission JOURNAL Submitted (03-MAY-2016) Genetics Dept. and Clementino Fraga Filho University Hospital, Federal University of Rio de Janeiro, Rio de Janeiro, RJ 21942-901, Brazil COMMENT ##Assembly-Data-START## Assembly Method :: DNAstar v. 7.0.0; BioEdit v. 7.2.5 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..849 /organism="Zika virus" /mol_type="genomic RNA" /isolate="16Z62" /isolation_source="sinovial" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="16-Mar-2016" CDS <1..>849 /codon_start=1 /product="envelope protein" /protein_id="ANC90423.1" /db_xref="GI:1026288134" /translation="GGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYC YEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAK FACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHETDENRAKVEITPNSPRA EATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTP HWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCR LKMDKLR" ORIGIN 1 ggtgggactt gggttgatgt tgtcttggaa catggaggtt gtgtcaccgt aatggcacag 61 gacaaaccga ctgtcgacat agagctggtt acaacaacag tcagcaacat ggcggaggta 121 agatcctact gctatgaggc atcaatatca gacatggctt cggacagccg ctgcccaaca 181 caaggtgaag cctaccttga caagcaatca gacactcaat atgtctgcaa aagaacgtta 241 gtggacagag gctggggaaa tggatgtgga ctttttggca aagggagcct ggtgacatgc 301 gctaagtttg catgctccaa gaaaatgacc gggaagagca tccagccaga gaatctggag 361 taccggataa tgctgtcagt tcatggctcc cagcacagtg ggatgatcgt taatgacaca 421 ggacatgaaa ctgatgagaa tagagcgaag gttgagataa cgcccaattc accaagagcc 481 gaagccaccc tggggggttt tggaagccta ggacttgatt gtgaaccgag gacaggcctt 541 gacttttcag atttgtatta cttgactatg aataacaagc actggttggt tcacaaggag 601 tggttccacg acattccatt accttggcac gctggggcag acaccggaac tccacactgg 661 aacaacaaag aagcactggt agagttcaag gacgcacatg ccaaaaggca aactgtcgtg 721 gttctaggga gtcaagaagg agcagttcac acggcccttg ctggagctct ggaggctgag 781 atggatggtg caaagggaag gctgtcctct ggccacttga aatgtcgcct gaaaatggat 841 aaacttagahttp://www.ncbi.nlm.nih.gov/nuccore/KX173843
  5. Sequence map update https://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU
  6. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX262887.1|Zika virus isolate 103451, complete genome15211521100%0.0100%KX262887.1Select seq gb|KX173844.1|Zika virus isolate 16Z62 envelope protein gene, partial cds15211521100%0.0100%KX173844.1Select seq gb|KX173843.1|Zika virus isolate 16Z62 envelope protein gene, partial cds15211521100%0.0100%KX173843.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome1519151999%0.0100%KU870645.1Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome15161516100%0.099%KX253996.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds15161516100%0.099%KX247632.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds15161516100%0.099%KX185891.1Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds15161516100%0.099%KU937936.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome15161516100%0.099%KX117076.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome15161516100%0.099%KX051563.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome15161516100%0.099%KU509998.3Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds15161516100%0.099%KU963796.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds15161516100%0.099%KU991811.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome15161516100%0.099%KU940228.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds15161516100%0.099%KU955589.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome15161516100%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome15161516100%0.099%KU922923.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds15161516100%0.099%KU866423.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome15161516100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome15161516100%0.099%KU853012.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome15161516100%0.099%KU820899.2Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds15161516100%0.099%KU729218.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome15161516100%0.099%KU527068.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds15161516100%0.099%KU646828.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds15161516100%0.099%KU647676.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds15161516100%0.099%KU365778.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds15161516100%0.099%KU312314.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds15161516100%0.099%KJ776791.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome15121512100%0.099%KX247646.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome15121512100%0.099%KX198135.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome15121512100%0.099%KX197192.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome15121512100%0.099%KX156776.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome15121512100%0.099%KX156775.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome15121512100%0.099%KX156774.1Select seq gb|KX101060.1|Zika virus isolate Bahia02, partial genome15121512100%0.099%KX101060.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome15121512100%0.099%KU926310.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome15121512100%0.099%KU926309.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds15121512100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds15121512100%0.099%KU501216.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds15121512100%0.099%KU312315.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome15121512100%0.099%KU321639.1Select seq gb|KX173841.1|Zika virus isolate 16Z11 envelope protein gene, partial cds1510151099%0.099%KX173841.1Select seq gb|KX173840.1|Zika virus isolate 16Z10 envelope protein gene, partial cds1510151099%0.099%KX173840.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome15081508100%0.099%KU940224.1Select seq gb|KU820897.2|Zika virus isolate FLR polyprotein gene, complete cds15071507100%0.099%KU820897.2Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome15071507100%0.099%KX087101.2Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome15071507100%0.099%KX087102.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds15071507100%0.099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds15071507100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds15071507100%0.099%KU761564.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome15071507100%0.099%KU681081.3Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome15071507100%0.099%KU497555.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome15071507100%0.099%KU707826.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome15071507100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds15071507100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds15071507100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds15071507100%0.099%KU365777.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds15071507100%0.099%KU312313.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds15071507100%0.099%KJ634273.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds15031503100%0.099%KX056898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds15031503100%0.099%KU955590.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds15031503100%0.099%KU729217.2Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds15031503100%0.099%KU646827.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds15031503100%0.099%KU312312.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome14941494100%0.099%KU744693.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome14891489100%0.099%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds14891489100%0.099%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds14851485100%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds14801480100%0.099%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome14621462100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds13681368100%0.096%HQ234499.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds11151115100%0.089%KF268950.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds11151115100%0.089%KF268948.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome11061106100%0.089%KU955595.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds11061106100%0.089%KF383116.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome11011101100%0.089%KX198134.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome11011101100%0.089%KU955592.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome11011101100%0.089%KU955591.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds11011101100%0.089%HQ234501.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds10741074100%0.088%KU720415.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds10741074100%0.088%KF383121.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds10741074100%0.088%KF383119.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds10741074100%0.088%HQ234498.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds10651065100%0.088%KF383117.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID10611061100%0.088%LC002520.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds10611061100%0.087%KF383115.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds10451045100%0.087%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome10401040100%0.087%KU955594.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome10401040100%0.087%AY632535.2Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds10071007100%0.086%KF383118.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence908908100%0.084%KF383120.1Select seq gb|KX101061.1|Zika virus isolate Bahia03, partial genome883135589%0.099%KX101061.1Select seq gb|KX101066.1|Zika virus isolate Bahia01, partial genome879135689%0.099%KX101066.1Select seq gb|KF270886.1|Zika virus strain CCB-870 envelope glycoprotein gene, partial cds67967963%0.088%KF270886.1Select seq gb|KF383039.1|Zika virus strain HD78788 envelope protein gene, partial cds65265259%0.089%KF383039.1Select seq gb|KF383032.1|Zika virus strain ArD30101 envelope protein gene, partial cds65265259%0.089%KF383032.1Select seq gb|KF383022.1|Zika virus strain ArD127988 envelope protein gene, partial cds65265259%0.089%KF383022.1Select seq gb|KU985088.1|Zika virus isolate MEX/InDRE/Zika-2/2015 envelope protein gene, partial cds65065042%0.0100%KU985088.1
  7. LOCUS KX173844 843 bp RNA linear VRL 06-MAY-2016 DEFINITION Zika virus isolate 16Z62 envelope protein gene, partial cds. ACCESSION KX173844 VERSION KX173844.1 GI:1026288135 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 843) AUTHORS Roimicher,L., Tanuri,A., Ferreira,O.C. Jr., Brindeiro,R.M. and Arruda,M.B. TITLE Zika Virus in the Joints and Arthritis JOURNAL Unpublished REFERENCE 2 (bases 1 to 843) AUTHORS Roimicher,L., Tanuri,A., Ferreira,O.C. Jr., Brindeiro,R.M. and Arruda,M.B. TITLE Direct Submission JOURNAL Submitted (03-MAY-2016) Genetics Dept. and Clementino Fraga Filho University Hospital, Federal University of Rio de Janeiro, Rio de Janeiro, RJ 21942-901, Brazil COMMENT ##Assembly-Data-START## Assembly Method :: DNAstar v. 7.0.0; BioEdit v. 7.2.5 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..843 /organism="Zika virus" /mol_type="genomic RNA" /isolate="16Z62" /isolation_source="plasma" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="16-Mar-2016" CDS <1..>843 /codon_start=1 /product="envelope protein" /protein_id="ANC90424.1" /db_xref="GI:1026288136" /translation="GTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCY EASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKF ACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHETDENRAKVEITPNSPRAE ATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPH WNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRL KMDKL" ORIGIN 1 gggacttggg ttgatgttgt cttggaacat ggaggttgtg tcaccgtaat ggcacaggac 61 aaaccgactg tcgacataga gctggttaca acaacagtca gcaacatggc ggaggtaaga 121 tcctactgct atgaggcatc aatatcagac atggcttcgg acagccgctg cccaacacaa 181 ggtgaagcct accttgacaa gcaatcagac actcaatatg tctgcaaaag aacgttagtg 241 gacagaggct ggggaaatgg atgtggactt tttggcaaag ggagcctggt gacatgcgct 301 aagtttgcat gctccaagaa aatgaccggg aagagcatcc agccagagaa tctggagtac 361 cggataatgc tgtcagttca tggctcccag cacagtggga tgatcgttaa tgacacagga 421 catgaaactg atgagaatag agcgaaggtt gagataacgc ccaattcacc aagagccgaa 481 gccaccctgg ggggttttgg aagcctagga cttgattgtg aaccgaggac aggccttgac 541 ttttcagatt tgtattactt gactatgaat aacaagcact ggttggttca caaggagtgg 601 ttccacgaca ttccattacc ttggcacgct ggggcagaca ccggaactcc acactggaac 661 aacaaagaag cactggtaga gttcaaggac gcacatgcca aaaggcaaac tgtcgtggtt 721 ctagggagtc aagaaggagc agttcacacg gcccttgctg gagctctgga ggctgagatg 781 gatggtgcaa agggaaggct gtcctctggc cacttgaaat gtcgcctgaa aatggataaa 841 ctthttp://www.ncbi.nlm.nih.gov/nuccore/KX173844.1
  8. Federal University of Rio de Janeiro has released partial sequences from Brazil cases with arthritis.
  9. Pregnant Women with Any Laboratory Evidence of Possible Zika Virus Infection in the United States and Territories, 2016Language:EnglishEspañolPortuguêsRecommend on FacebookTweet Pregnant Women with Any Laboratory Evidence of Possible Zika Virus InfectionUS States and the District of Columbia Pregnant women with any laboratory evidence of possible Zika virus infection: 157**This update includes aggregated data reported to the US Zika Pregnancy Registry as of May 12, 2016. US Territories Pregnant women with any laboratory evidence of possible Zika virus infection: 122**This update includes data from the US territories reported to the US Zika Pregnancy Registry and data from Puerto Rico reported to the Zika Active Pregnancy Surveillance System as of May 12, 2016. About These NumbersWhat these updated numbers show These updated numbers reflect counts of pregnant women in the United States with any laboratory evidence of possible Zika virus infection, with or without symptoms. Pregnant women with laboratory evidence include those in whom viral particles have been detected and those with evidence of an immune reaction to a recent virus that is likely to be Zika.This information will help healthcare providers as they counsel pregnant women affected by Zika and is essential for planning at the federal, state, and local levels for clinical, public health, and other services needed to support pregnant women and families affected by Zika.What these new numbers do not show These new numbers are not comparable to the previous reports. These updated numbers reflect a different, broader population of pregnant women.These updated numbers are not real time estimates. They will reflect the number of pregnant women reported with any laboratory evidence of possible Zika virus infection as of 12 noon every Thursday the week prior; numbers will be delayed one week.Where do these numbers come from? These data reflect pregnant women in the US Zika Pregnancy Registry and the Zika Active Pregnancy Surveillance System in Puerto Rico. CDC, in collaboration with state, local, tribal and territorial health departments, established these registries for comprehensive monitoring of pregnancy and infant outcomes following Zika virus infection. The data collected through these registries will be used to update recommendations for clinical care, to plan for services and support for pregnant women and families affected by Zika virus, and to improve prevention of Zika virus infection during pregnancy. http://www.cdc.gov/zika/geo/pregwomen-uscases.html
  10. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  11. Zika Cases in New Jersey New Jersey County Confirmed Travel-Related Cases Bergen 7 Passaic 2 Morris 2 Hudson 1 Camden 1 Burlington 1 Union 1 Essex 1 TOTAL 16
  12. New Jersey has initiated a Zika tally page http://www.nj.gov/health/cd/zika/case_count.shtml
  13. 7 Confirmed Cases Of Zika Virus In Bergen County: State Health DepartmentState Department of Health has begun testing for Zika and other mosquito-transmitted viruses.Ridgewood-Glen Rock, NJ By DANIEL HUBBARD (Patch Staff) - May 25, 2016 1:06 pm ET ShareTweetGoogle PlusRedditEmailComments There have been seven confirmed travel-related cases of the Zika virus in Bergen County, more than triple that of any other New Jersey county, the Department of Health announced this week. The Zika virus is one of the mosquito-transmitting diseases the New Jersey Public Health and Environmental Laboratories (PHEL) began testing blood samples late last week, the state Department of Health announced. The PHEL can perform three diagnostic, CDC-developed tests to detect the Zika virus. The laboratories are also testing for dengue and chikungunya viruses, along with Zika. There have been no known reports of mosquitoes spreading the disease in the United States, but travelers have reported more than 500 cases, including the 16 in New Jersey, the Department of Health said. The PHEL conducts more than 5 million tests for diseases and chemical contaminants on a variety of environmental and clinical samples. The data generated close collaboration with epidemiologists, local health officials and multiple state agencies, federal partners and healthcare providers who use the laboratory information to protect the public. “The ability to test residents for Zika and similar viruses will further enhance New Jersey’s preparedness and response to this evolving health emergency unfolding in the Caribbean and Central and South Americas,” Acting Health Commissioner Cathleen Bennett said in a statement. “We continue working every day to prevent local transmission as mosquito season approaches in New Jersey.” Besides the seven confirmed Bergen cases, there have been two each in Passaic and Morris. Hudson, Camden, Burlington, Union, and Essex counties have each one reported case. Bergen County officialsreleased a school of Gambusia fish in a Wyckoff pond Friday as a natural, proactive approach to protecting residents from the Zika virus called “Bergen Bites Back.” The fish feed on mosquito larvae. State and federal officials have warned New Jersey residents that the virus could be a bigger threat and more harmful than originally thought. The government scientists said they have definitely determined that Zika causes severe defects in unborn children, including microcephaly, which leaves babies with abnormally small heads and brains that do not properly develop. State officials and Center for Disease Control officials previously said that the disease could be sexually transmitted, and that the mosquitoes that can transit the Zika virus may live in a much larger portion of the United States than previously thought, including all of New Jersey. Email: [email protected]. Sign up for Patch N.J. email newsletters here.
  14. Besides the seven confirmed Bergen cases, there have been two each in Passaic and Morris. Hudson, Camden, Burlington, Union, and Essex counties have each one reported case.http://patch.com/new-jersey/ridgewood/7-confirmed-cases-zika-virus-bergen-county-state-health-department-0
  15. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  16. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  17. May 25, 2016 DEPARTMENT OF HEALTH DAILY ZIKA UPDATE: FOUR NEW TRAVEL-RELATED CASES TODAY Contact:Communications [email protected](850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the Florida Department of Health will issue a Zika virus update each week day at 2 p.m. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. There are four new travel-related cases today with two in Miami-Dade, one in Lee and one in Orange counties. Of the cases confirmed in Florida, five cases are still exhibiting symptoms. According to CDC, symptoms associated with the Zika virus last between seven to 10 days. CDC recommends that women who are pregnant or thinking of becoming pregnant postpone travel to Zika affected areas. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms since January. The total number of pregnant women who have been monitored is 36, with 9 having met the previous CDC case definition. County Number of Cases (all travel related) Alachua 4 Brevard 3 Broward 17 Clay 2 Collier 1 Hillsborough 3 Lee 5 Martin 1 Miami-Dade 48 Orange 10 Osceola 5 Palm Beach 7 Pasco 1 Pinellas 4 Polk 3 Santa Rosa 1 Seminole 3 St. Johns 2 Volusia 2 Total cases not involving pregnant women 122 Cases involving pregnant women regardless of symptoms* 36 *Counties of pregnant women will not be shared. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 1,839 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. All cases are travel-associated. There have been no locally-acquired cases of Zika in Florida. For more information on the Zika virus, click here. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. More Information on DOH action on Zika: On Feb. 3, Governor Scott directed the State Surgeon General to issue a Declaration of Public Health Emergency for the counties of residents with travel-associated cases of Zika.There have been 19 counties included in the declaration– Alachua, Brevard, Broward, Clay, Collier, Hillsborough, Lee, Martin, Miami-Dade, Orange, Osceola, Palm Beach, Pasco, Pinellas, Polk, Santa Rosa, Seminole, St. Johns and Volusia – and will be updated as needed. DOH encourages Florida residents and visitors to protect themselves from all mosquito-borne illnesses by draining standing water; covering their skin with repellent and clothing; and covering windows with screens.DOH has a robust mosquito-borne illness surveillance system and is working with CDC, the Florida Department of Agriculture and Consumer Services and local county mosquito control boards to ensure that the proper precautions are being taken to protect Florida residents and visitors.On April 6, Governor Rick Scott and Interim State Surgeon General Dr. Celeste Philip hosted a conference call with Florida Mosquito Control Districts to discuss ongoing preparations to fight the possible spread of the Zika virus in Florida. There were 74 attendees on the call.On May 11, Governor Scott met with federal leaders on the importance of preparing for Zika as we would a hurricane. Governor Scott requested 5,000 Zika preparedness kits from HHS Secretary Sylvia Burwell as well as a plan from FEMA on how resources will be allocated to states in the event an emergency is declared.Florida currently has the capacity to test 6,234 people for active Zika virus and 1,918 for Zika antibodies.Federal Guidance on Zika: According to CDC, Zika illness is generally mild with a rash, fever and joint pain. CDC researchers have concluded that Zika virus is a cause of microcephaly and other birth defects.The FDA released guidance regarding donor screening, deferral and product management to reduce the risk of transfusion-transmission of Zika virus. Additional information is available on the FDA website here.CDC has put out guidance related to the sexual transmission of the Zika virus. This includes CDC recommendation that if you have traveled to a country with local transmission of Zika you should abstain from unprotected sex.Based on CDC guidance released Friday, DOH will now report pregnant women with evidence of Zika virus regardless of symptoms. Prior to Friday, CDC guidance was only to report cases of Zika if the pregnant women was symptomatic.For more information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov. http://www.floridahealth.gov/newsroom/2016/05/052516-zika-update.html
  18. County Number of Cases (all travel related) Alachua 4 Brevard 3 Broward 17 Clay 2 Collier 1 Hillsborough 3 Lee 5 Martin 1 Miami-Dade 48 Orange 10 Osceola 5 Palm Beach 7 Pasco 1 Pinellas 4 Polk 3 Santa Rosa 1 Seminole 3 St. Johns 2 Volusia 2 Total cases not involving pregnant women 122 Cases involving pregnant women regardless of symptoms* 36 *Counties of pregnant women will not be shared.
  19. TABLE I. Provisional cases of selected* infrequently reported notifiable diseases (<1,000 cases reported during the preceding year), United States, week ending May 21, 2016 (WEEK 20)†http://wonder.cdc.gov/mmwr/mmwr_2016.asp?mmwr_year=2016&mmwr_week=20&mmwr_table=1&request=Submit&mmwr_location= Disease Total cases reported for previous years Current weekCum 20165-year weekly average§20152014201320122011States reporting cases during current week (No.20) Anthrax-------1 Arboviral diseases ¶,**: Chikungunya virus ††-352896NNNNNNNN Eastern equine encephalitis virus--0688154 Jamestown Canyon virus §§--011112223 La Crosse virus §§--055808578130 Powassan virus-117812716 St. Louis encephalitis virus--02310136 Western equine encephalitis virus-------- Botulism, total-513193161152168153 foodborne-40371542724 infant-42213612713612397 other(wound & unspecified)-502019121832 Brucellosis1323124929911479FL (1 ) Chancroid-7012--158 Cholera--025141740 Cyclosporiasis **-134643388784123151 Diphtheria----1-1- Haemophilus influenzae, invasive disease (age <5 yrs) ¶¶: serotype b-712840313014 nontypeable serotype171414812814111593WA (1 ) other serotype-461127266233263230 unknown serotype487418939343748OH (1 ), FL (3 ) Hansen's disease **-1728788818282 Hantavirus Infections **: Hantavirus infection (non-HPS) ††---1NNNNNNNN Hantavirus pulmonary syndrome (HPS)-511732213023 Hemolytic uremic syndrome, post-diarrheal **1525265250329274290FL (1 ) Hepatitis B, virus infection perinatal-10136474840NP Influenza-associated pediatric mortality **, ***264213014116052118OK (1 ), NV (1 ) Leptospirosis **-1403838NNNNNN Listeriosis515612762769735727870NY (3 ), NYC (1 ), HI (1 ) Measles †††-171218666718755220 Meningococcal disease, invasive §§§: serogroup ACWY1393105123142161257WA (1 ) serogroup B-2921048999110159 other serogroup-502225172020 unknown serogroup3724141196298260323TX (2 ), AK (1 ) Novel influenza A virus infections ¶¶¶-2-632131314 Plague--01310443 Poliomyelitis, paralytic-----1-- Polio virus infection, nonparalytic **-------- Psittacosis **-2078622 Q fever total **:-224158168170135134 acute-183131132137113110 chronic-402736332224 Rabies, human--011216 SARS CoV-------- Smallpox-------- Streptococcal toxic shock syndrome **21155326259224194168RI (1 ), OH (1 ) Syphilis, congenital ****-1027489458348322360 Toxic shock syndrome (staphylococcal) **-1015959716578 Trichinellosis **-401114221815 Tularemia-195319180203149166 Typhoid fever-947371349338354390 Vancomycin-intermediate Staphylococcus aureus**-43318121224813482 Vancomycin-resistant Staphylococcus aureus **---1--2- Viral hemorrhagic Fevers ††††: Crimean-Congo hemorrhagic fever----NPNPNPNP Ebola hemorrhagic fever----4NPNPNP Guanarito hemorrhagic fever----NPNPNPNP Junin hemorrhagic fever----NPNPNPNP Lassa fever----1NPNPNP Lujo virus----NPNPNPNP Machupo hemorrhagic fever----NPNPNPNP Marburg fever----NPNPNPNP Sabia-associated hemorrhagic fever----NPNPNPNP Yellow fever-------- Zika ††,§§§§ Zika virus congenital infectionNANANANNNNNNNNNN Zika virus disease, non-congenital infection15370NNNNNNNNNNAZ (1 )[ Export This Table ] [ Next Part ] [ NNDSS Interactive Tables ] [ Mortality Interactive Tables ] -: No reported cases N: Not reportable. NA: Not Available NN: Not Nationally Notifiable. NP: Nationally notifiable but not published. Cum: Cumulative year-to-date counts. * Case counts for reporting years 2015 and 2016 are provisional and subject to change. Data for years 2011 through 2014 are finalized. For further information on interpretation of these data, seehttp://wwwn.cdc.gov/nndss/document/ProvisionalNationaNotifiableDiseasesSurveillanceData20100927.pdf. † This table does not include cases from the U.S. territories. Three low incidence conditions, rubella, rubella congenital, and tetanus, are in Table II to facilitate case count verification with reporting jurisdictions. § Calculated by summing the incidence counts for the current week, the 2 weeks preceding the current week, and the 2 weeks following the current week, for a total of 5 preceding years. Additional information is available athttp://wwwn.cdc.gov/nndss/document/5yearweeklyaverage.pdf. ¶ Includes both neuroinvasive and nonneuroinvasive. Updated weekly reports from the Division of Vector-Borne Diseases, National Center for Emerging and Zoonotic Infectious Diseases (ArboNET Surveillance). Data for West Nile virus are available in Table II. ** Not reportable in all reporting jurisdictions. Data from states where the condition is not reportable are excluded from this table, except for the arboviral diseases and influenza-associated pediatric mortality. Reporting exceptions are available athttp://wwwn.cdc.gov/nndss/downloads.html. †† Office of Management and Budget approval of the NNDSS Revision #0920-0728 on January 21, 2016, authorized CDC to receive data for these conditions. CDC is in the process of soliciting data for these conditions (except Zika virus, congenital infection). CDC and the U.S. states are still modifying the technical infrastructure needed to collect and transmit data for Zika virus congenital infections. §§ Jamestown Canyon virus and Lacrosse virus have replaced California serogroup diseases. ¶¶ Data for Haemophilus influenzae (all ages, all serotypes) are available in Table II. *** Please refer to the MMWR publication for weekly updates to the footnote for this condition. ††† Please refer to the MMWR publication for weekly updates to the footnote for this condition. §§§ Data for meningococcal disease (all serogroups) are available in Table II. ¶¶¶ Please refer to the MMWR publication for weekly updates to the footnote for this condition. **** Updated weekly from reports to the Division of STD Prevention, National Center for HIV/AIDS, Viral Hepatitis, STD, and TB Prevention. †††† Please refer to the MMWR publication for weekly updates to the footnote for this condition. §§§§ All cases reported have occurred in travelers returning from affected areas, with their sexual contacts, or infants infected in utero.
  20. Cases in 2015 = 52 in last update Zika ††,§§§§ Zika virus congenital infectionNANANANNNNNNNNNN Zika virus disease, non-congenital infection15370NNNNNNNNNNAZ (1 )
  21. Latest Facts and Advisories as of 5/25/2016 [ Español (PDF)]Reported cases of Zika in New York City: 10917 of the 109 cases were pregnant at the time of diagnosis;All cases contracted Zika while visiting other countries; andAll patients have recovered.

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.