Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  2. SHERMAN OAKS (CBSLA.com) — Concerns about the Zika virus are rising in the Southland. According to the LA County Health Department, several women have contracted the virus while traveling. KCAL9’s Rachel Kim looks at the numbers. The number of pregnant women with Zika in America now stands at more than 150. In Los Angeles, our numbers are growing too. The LA County Health Department says we now have 13 Zika cases in the county and four of those are pregnant women. http://losangeles.cbslocal.com/2016/05/20/more-cases-of-zika-virus-being-recorded-in-la-county/
  3. CDPH Weekly Update on Number of Zika Cases in California May 20, 2016 The following table provides the number of travel-associated cases of Zika in California residents in 2015 and 2016. CDPH is following CDC testing guidelines. This table is updated every Friday. As of May 20, 2016, there have been 49 travel-associated cases of Zika in California.  Total: 49  Pregnant: 10*  Sexually transmitted: 1 Cases of Zika in California, 2015-2016§ (as of May 20, 2016) County Travel-associated cases¥ Locally acquired cases† Alameda 4 0 Contra Costa 3 0 Los Angeles 13 0 Marin 1 0 Napa 1 0 Orange 2 0 San Bernardino 3 0 San Diego 12** 0 San Francisco 2 0 San Joaquin 2 0 San Mateo 2 0 Santa Clara 1 0 Sonoma 1 0 Yolo 2 0 Total 49 0 *Local Health Departments and CDPH are monitoring all pregnant women and their infants §Total number of cases includes laboratory-confirmed and probable cases as defined by the CSTE Position Statement ¥ Travelers returning from affected areas or their sexual contacts † Presumed local mosquito-borne transmission **Includes one non-resident
  4. On May 20 the CDC indicated they would begin reporting asymptomatic pregnant cases with lab evidence of Zika infection, raising the total of reported pregnant Zika cases in the United States from 48 to 157. Prior to this announcement, California began including a running tally of symptomatic pregnant California Zika cases in the May 6 report, where 8 pregnant cases were cited (out of 45 cases). In the May 13 report 1 new case was reported (in Marin County) and the number of pregnant cases rose to 9, strongly suggesting the Marin case was pregnant (not noted in Marin County press release). In the May 20 report, the number of pregnant cases rose to 10 (with one new cases added for Los Angeles, San Diego, and San Bernardino counties). raising the state Zika case total to 49.
  5. Map Updated with pregnant case https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  6. CDPH Weekly Update on Number of Zika Cases in California May 13, 2016 The following table provides the number of travel-associated cases of Zika in California residents in 2015 and 2016. CDPH is following CDC testing guidelines. This table is updated every Friday. As of May 13, 2016, there have been 46 travel-associated cases of Zika in California. • Total: 46 • Pregnant: 9* • Sexually transmitted: 1 Cases of Zika in California, 2015-2016§ (as of May 13, 2016) County Travel-associated cases¥ Locally acquired cases† Alameda 4 0 Contra Costa 3 0 Los Angeles 12 0 Marin 1 Napa 1 0 Orange 2 0 San Bernardino 2 0 San Diego 11** 0 San Francisco 2 0 San Joaquin 2 0 San Mateo 2 0 Santa Clara 1 0 Sonoma 1 0 Yolo 2 0 Total 46 0 *Local Health Departments and CDPH are monitoring all pregnant women and their infants §Total number of cases includes laboratory-confirmed and probable cases as defined by the CSTE Position Statement ¥ Travelers returning from affected areas or their sexual contacts † Presumed local mosquito-borne transmission **Includes one non-resident https://www.cdph.ca.gov/HealthInfo/discond/Documents/TravelAssociatedCasesofZikaVirusinCA.pdf
  7. Match update Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome1852518525100%0.0100%KX247646.1Select seq gb|KU820897.2|Zika virus isolate FLR polyprotein gene, complete cds1851618516100%0.099%KU820897.2Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome1851618516100%0.099%KX087102.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome1847118471100%0.099%KX156776.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome1846518465100%0.099%KX156774.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome1846218462100%0.099%KX198135.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome1846218462100%0.099%KX156775.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1843818438100%0.099%KU647676.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome1842018420100%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome1841718417100%0.099%KU922923.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds1840218402100%0.099%KU991811.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome1839918399100%0.099%KU509998.3Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1839318393100%0.099%KJ776791.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1838418384100%0.099%KU321639.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome1838118381100%0.099%KX051563.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1837518375100%0.099%KU729218.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1837518375100%0.099%KU707826.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1837518375100%0.099%KU365779.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome1837218372100%0.099%KX197192.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome183681836899%0.099%KU497555.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome1836318363100%0.099%KU926309.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1836318363100%0.099%KU365780.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome1835718357100%0.099%KU940228.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1835718357100%0.099%KU365777.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1835418354100%0.099%KU501217.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1835418354100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1835418354100%0.099%KU312312.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1834818348100%0.099%KU729217.2Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1834818348100%0.099%KU527068.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1834818348100%0.099%KU501216.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds1834518345100%0.099%KX247632.1Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds1834518345100%0.099%KU937936.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome1834518345100%0.099%KU926310.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1834518345100%0.099%KU501215.1Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome1833918339100%0.099%KX087101.2Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds1833618336100%0.099%KU820898.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome1833018330100%0.099%KU870645.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome1832718327100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome1832518325100%0.099%KU853012.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds1832118321100%0.099%KX056898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds1832118321100%0.099%KU955590.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds1831818318100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1831818318100%0.099%KU761564.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome1830318303100%0.099%KX117076.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds1829418294100%0.099%KX185891.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds1829418294100%0.099%KU963796.1Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome1829118291100%0.099%KX253996.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds1829118291100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1829118291100%0.099%KU820899.2Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome182641826499%0.099%KU940224.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds1818218182100%0.099%KU866423.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1815018150100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1806018060100%0.099%KU681081.3Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome1775317753100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177531775399%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds177211772198%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1759817598100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1744317443100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164241642499%0.095%HQ234499.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1331513315100%0.089%KF383115.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1331113311100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1331113311100%0.089%KF268948.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1330813308100%0.089%KU720415.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1330413304100%0.089%KF268950.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds133021330299%0.089%HQ234498.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome1329913299100%0.089%KU955595.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome1329013290100%0.089%KU955592.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1329013290100%0.089%KF383119.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1328613286100%0.089%LC002520.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1328413284100%0.089%DQ859059.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome1327713760100%0.089%KX198134.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome1327213272100%0.089%KU955591.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds1327013270100%0.089%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome1327013270100%0.089%KU955594.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1325713257100%0.089%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132411324199%0.089%HQ234501.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1322713227100%0.089%AY632535.2Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1317813178100%0.088%KF383117.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds1315813266100%0.088%KU963574.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131561315699%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1296313031100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128881288897%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108811088197%0.084%KF383120.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome50341443187%0.095%KU940227.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4967496727%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4940494027%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4677467725%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4677467725%0.099%KU646827.1Select seq gb|KX101060.1|Zika virus isolate Bahia02, partial genome42311331775%0.095%KX101060.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3440344018%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3205320517%0.099%KU740199.1Select seq gb|KX101066.1|Zika virus isolate Bahia01, partial genome31191311374%0.099%KX101066.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2695269514%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2075207511%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2021202111%0.099%KU179098.1Select seq gb|KX101061.1|Zika virus isolate Bahia03, partial genome18461390078%0.0100%KX101061.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds183818389%0.099%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds183818389%0.099%KX059013.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds175217529%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds174817489%0.099%KM078961.1
  8. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU820897.2|Zika virus isolate FLR polyprotein gene, complete cds1851618516100%0.099%KU820897.2Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome1851618516100%0.099%KX087102.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome1847118471100%0.099%KX156776.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome1846518465100%0.099%KX156774.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome1846218462100%0.099%KX198135.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome1846218462100%0.099%KX156775.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1843818438100%0.099%KU647676.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome1842018420100%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome1841718417100%0.099%KU922923.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds1840218402100%0.099%KU991811.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome1839918399100%0.099%KU509998.3Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1839318393100%0.099%KJ776791.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1838418384100%0.099%KU321639.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome1838118381100%0.099%KX051563.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1837518375100%0.099%KU729218.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1837518375100%0.099%KU707826.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1837518375100%0.099%KU365779.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome1837218372100%0.099%KX197192.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome183681836899%0.099%KU497555.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome1836318363100%0.099%KU926309.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1836318363100%0.099%KU365780.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome1835718357100%0.099%KU940228.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1835718357100%0.099%KU365777.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1835418354100%0.099%KU501217.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1835418354100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1835418354100%0.099%KU312312.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1834818348100%0.099%KU729217.2Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1834818348100%0.099%KU527068.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1834818348100%0.099%KU501216.1Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds1834518345100%0.099%KU937936.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome1834518345100%0.099%KU926310.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1834518345100%0.099%KU501215.1Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome1833918339100%0.099%KX087101.2Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds1833618336100%0.099%KU820898.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome1833018330100%0.099%KU870645.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome1832718327100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome1832518325100%0.099%KU853012.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds1832118321100%0.099%KX056898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds1832118321100%0.099%KU955590.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds1831818318100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1831818318100%0.099%KU761564.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome1830318303100%0.099%KX117076.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds1829418294100%0.099%KX185891.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds1829418294100%0.099%KU963796.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds1829118291100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1829118291100%0.099%KU820899.2Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome182641826499%0.099%KU940224.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds1818218182100%0.099%KU866423.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1815018150100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1806018060100%0.099%KU681081.3Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome1775317753100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177531775399%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds177211772198%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1759817598100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1744317443100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164241642499%0.095%HQ234499.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1331513315100%0.089%KF383115.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1331113311100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1331113311100%0.089%KF268948.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1330813308100%0.089%KU720415.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1330413304100%0.089%KF268950.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds133021330299%0.089%HQ234498.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome1329913299100%0.089%KU955595.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome1329013290100%0.089%KU955592.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1329013290100%0.089%KF383119.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1328613286100%0.089%LC002520.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1328413284100%0.089%DQ859059.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome1327713760100%0.089%KX198134.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome1327213272100%0.089%KU955591.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds1327013270100%0.089%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome1327013270100%0.089%KU955594.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1325713257100%0.089%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132411324199%0.089%HQ234501.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1322713227100%0.089%AY632535.2Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1317813178100%0.088%KF383117.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds1315813266100%0.088%KU963574.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131561315699%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1296313031100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128881288897%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108811088197%0.084%KF383120.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome50341443187%0.095%KU940227.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4967496727%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4940494027%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4677467725%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4677467725%0.099%KU646827.1Select seq gb|KX101060.1|Zika virus isolate Bahia02, partial genome42311331775%0.095%KX101060.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3440344018%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3205320517%0.099%KU740199.1Select seq gb|KX101066.1|Zika virus isolate Bahia01, partial genome31191311374%0.099%KX101066.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2695269514%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2075207511%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2021202111%0.099%KU179098.1Select seq gb|KX101061.1|Zika virus isolate Bahia03, partial genome18461390078%0.0100%KX101061.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds183818389%0.099%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds183818389%0.099%KX059013.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds175217529%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds174817489%0.099%KM078961.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds174517459%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds174517459%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds174517459%0.099%KM078933.1
  9. LOCUS KX247646 10808 bp cRNA linear VRL 17-MAY-2016 DEFINITION Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome. ACCESSION KX247646 VERSION KX247646.1 GI:1028727781 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10808) AUTHORS Lednicky,J.A., White,S.K., Morris,J.G. Jr., Iovine,N.M. and Loeb,J.C. TITLE Complete genomic sequence of Zika virus isolated from a traveler to Colombia in 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10808) AUTHORS Lednicky,J.A., White,S.K., Morris,J.G. Jr., Iovine,N.M. and Loeb,J.C. TITLE Direct Submission JOURNAL Submitted (16-MAY-2016) Environmental and Global Health, University of Florida - Gainesville, 1225 Center Drive, Room 4155, Gainesville, FL 32610, USA COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10808 /organism="Zika virus" /mol_type="viral cRNA" /isolate="Zika virus/Homo sapiens/COL/UF-1/2016" /isolation_source="blood, saliva, and urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="Colombia" /collection_date="09-Feb-2016" 5'UTR 1..107 CDS 108..10379 /codon_start=1 /product="polyprotein" /protein_id="ANF04752.1" /db_xref="GI:1028727782" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGAETSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFWAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" 3'UTR 10380..10808 ORIGIN 1 agttgttact gttgctgact cagactgcga cagttcgagt ttgaagcgaa agctagcaac 61 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa 121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga 181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca 241 ggatggtctt ggcgattcta gcctttttga gattcacggc aatcaagcca tcactgggtc 301 tcatcaatag atggggttca gtggggaaaa aagaggctat ggaaataata aagaagttca 361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag 421 gcgcagaaac tagtgtcgga attgttggcc tcctgctgac cacagctatg gcagcggagg 481 tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct ggggaggcca 541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac 601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag 661 atgacgtcga ttgttggtgc aacacgacgt caacttgggt tgtgtacgga acctgccatc 721 acaaaaaagg tgaagcacgg agatctagaa gagccgtgac gctcccctcc cattccacta 781 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcacttga 841 ttagagtcga aaattggata ttcaggaacc ctggtttcgc tttagcagca gctgccatcg 901 cttggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga 961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta 1021 tgtcaggtgg gacttgggtt gatgtcgtct tggaacatgg aggttgtgtc accgtaatgg 1081 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg 1141 aggtaagatc ctactgctat gaggcatcaa tatcagacat ggcttcggac agccgctgcc 1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtc tgcaaaagaa 1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga 1321 catgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc 1381 tggagtaccg gataatgttg tcagttcatg gctcccagca cagtgggatg atcgttaatg 1441 acacaggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa 1501 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag 1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggttcaca 1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac 1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg 1741 tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga gctctggagg 1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa 1861 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca 1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga 1981 cagatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact ctgaccccag 2041 ttgggaggtt gataaccgct aaccccgtaa tcactgaaag cactgagaac tctaagatga 2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga 2161 agatcaccca ccactggcac aggagtggca gcaccattgg aaaagcattt gaagccactg 2221 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg 2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat 2341 cattgtttgg aggaatgtcc tggttctcac aaattctcat tggaacgttg ctgatgtggt 2401 tgggtctgaa cacaaagaat ggatctattt cccttatgtg cttggcctta gggggagtgt 2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga 2521 aggagacgag atgtggtaca ggggtgttcg tctataacga cgttgaagcc tggagggaca 2581 ggtacaagta ccatcctgac tccccccgta gattggcagc agcagtcaag caagcctggg 2641 aagatggtat ctgcgggatc tcctctgttt caagaatgga aaacatcatg tggagatcag 2701 tagaagggga gctcaacgca atcctggaag agaatggagt tcaactgacg gtcgttgtgg 2761 gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct gtgaacgagc 2821 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt cagagcagca aagacaaata 2881 acagctttgt cgtggatggt gacacactga aagaatgccc actcaaacat agagcatgga 2941 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg 3001 ttagagaaga ttattcatta gagtgtgatc cagccgttat tggaacagct gttaagggaa 3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga 3121 ggctgaagag ggcccatctg atcgagatga aaacatgtga atggccaaag tcccacacat 3181 tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttta gctgggccac 3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg 3301 aagagcttga aattcggttt gaggaatgcc caggcactaa ggtccacgtg gaggaaacat 3361 gtggaacaag aggaccatct ctgagatcaa ccactgcaag cggaagggtg atcgaggaat 3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttctg ggctaaagat ggctgttggt 3481 atggaatgga gataaggccc aggaaagaac cagaaagcaa cttagtaagg tcaatggtga 3541 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca 3601 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcaatgg 3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa 3721 tcttgatggg tgccaccttc gcggaaatga acactggagg agatgtagct catctggcgc 3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc cttcatcttc agagctaatt 3841 ggacaccccg tgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct 3901 ccgccttgga gggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa 3961 tacgagcgat ggttgttcca cgcactgaca acatcacctt ggcaatcctg gctgctctga 4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg 4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca 4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt 4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc 4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg 4321 ccgcggttgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca 4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc 4441 ggctcgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc 4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag 4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggtg 4621 cgctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt 4681 acagagtaat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag 4741 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag 4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat 4861 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg 4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca 4981 ttggagcggt tgcgctggat tacccagcag gaacttcagg atctccaatc ctagacaagt 5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg agttatgtta 5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga 5161 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga 5221 gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact gtgatcttag 5281 ctccaaccag ggttgtcgct gctgaaatgg aggaagccct tagagggctt ccagtgcgtt 5341 atatgacaac agcagtcaat gtcacccact ctggaacaga aatcgtcgac ttaatgtgcc 5401 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtata 5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcaa 5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc 5581 gtgacgcatt tccggactcc aactcaccaa ttatggacac cgaagtggaa gtcccagaga 5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg 5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg 5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt 5821 gggactttgt cgtgacaact gacatttcag agatgggcgc caactttaaa gctgaccgtg 5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattctgg 5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga 6001 atcccaataa acctggagat gagtatctgt atggaggtgg gtgcgcagag actgacgaag 6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc 6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca 6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg 6241 tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga agatggtgct 6301 ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag gtgtggacca 6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc 6421 atgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag 6481 tgatggaagc cctgggaaca ctgccaggac acatgacaga gagattccag gaagccattg 6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg 6601 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgt 6661 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg 6721 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg 6781 catgtgtcct cattgttgtg ttcctattgc tggtggtgct catacctgag ccagaaaagc 6841 aaagatctcc ccaggacaac caaatggcaa tcatcatcat ggtagcagta ggtcttctgg 6901 gcttgattac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc 6961 taatgggaag gagagaggag ggggcaacca taggattctc aatggacatt gacctgcggc 7021 cagcctcagc ttgggccatc tatgctgcct tgacaacttt cattacccca gccgtccaac 7081 atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg caagctggag 7141 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc 7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc 7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc 7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg 7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca 7441 tagcagtagc cgtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg 7501 gggccctgat cacagccgca acttccactt tgtgggaagg ctctccgaac aagtactgga 7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt 7621 ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag 7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct 7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca 7801 aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt 7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag 7921 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa 7981 aaggaggccc tggtcatgaa gaacccgtgt tggtgcaaag ctatgggtgg aacatagtcc 8041 gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt 8101 gtgacatagg tgagtcatca tctagtcctg aagtggaaga agcacggacg ctcagagtcc 8161 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt 8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag 8281 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag 8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg 8401 acgggcctag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg 8461 ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga 8521 tccgcagtga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg 8581 cttaccatgg aagctatgag gcccccacac aagggtcagc gtcctctcta ataaacgggg 8641 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga 8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc 8761 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag 8821 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc aacaaggtgc 8881 gtagcaatgc agcattaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg 8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga 9001 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg 9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc 9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag 9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc 9241 gcataccagg aggaaggatg tatgcagatg acactgctgg ctgggacacc cgcattagca 9301 ggtttgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg cacagggcct 9361 tggcattggc cataatcaag tacacatacc aaaacaaagt ggtaaaggtc cttagaccag 9421 ctgaaaaagg gaaaacagtt atggacatta tttcgagaca agaccaaagg gggagcggac 9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggaata 9541 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag 9601 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag 9661 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg 9721 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact 9781 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt 9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag 9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc 9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg 10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat 10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc 10141 acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg ggaaaaaggg 10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca 10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag tacatggact 10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctgga gtgctgtaag 10381 caccaatctt aatgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc 10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg 10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca 10561 cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg 10621 ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt agaggagacc 10681 ccccggaaaa cgcaaaacag catattgacg ctgggaaaga ccagagactc catgagtttc 10741 caccacgctg gccgccaggc acagatcgcc gaatagcggc ggccggtgtg gggaaatcca 10801 tgggtctt
  10. University of Florida has released a full Zika sequence from a traveler (presumably from Florida) infected in Colombia, COL/UF-1/2016. The sequence is closely related to other sequences from Columbia. http://www.ncbi.nlm.nih.gov/nuccore/KX247646.1
  11. New Report Says 279 U.S. Pregnant Women Have ZikaThe new CDC numbers include pregnant women without symptoms, giving a more accurate picture By Dina Fine Maron on May 20, 2016 Health workers conduct fumigation against Aedes aegypti mosquitoes in Bukit Duri, Jakarta, Indonesia on April 1, 2016. Credit: Photo by Dasril Roszandi/NurPhoto via Getty ImagesTracking of the Zika virus indicates that 279 pregnant women across the United States and its territories now have it, according to new official figures. Most of these women are still pregnant and are being monitored to see if their fetuses develop abnormalities including microcephaly. The new numbers, published Friday in a report from the U.S. Centers for Disease Control and Prevention, underscore the challenge of preventing Zika from spreading to pregnant women and their fetuses. The official count includes cases up to May 12 and will be updated every Thursday at noon. The women in all of these cases had tested positive for the virus or responded to antibody testing—indicating they were likely positive—but not all the women had symptoms or pregnancy complications. Before Friday’s announcement, the number of pregnant women who tested positive for Zika but did not have any of its symptoms was not publicly reported. Instead, only the number of pregnant women with lab evidence of the virus—and symptoms or complications—was publicly tracked. So far there have been “less than a dozen” adverse outcomes such as birth defects or miscarriages among these 279 women, but tracking is ongoing, says Margaret Honein, chief of CDC’s birth defects branch. Exactly how often birth defects occur among pregnant women with Zika remains unknown. The CDC’s change in tracking and publishing numbers was prompted by evidence that asymptomatic women have given birth to children with abnormalities, Honein says. “We have been monitoring women with both symptomatic and asymptomatic Zika since February,” when the U.S. tracking began, she adds. “The change is that we are now publicly reporting the number to give a more transparent picture of all the monitoring that we are doing.” Zika is being locally transmitted by mosquito bites in some U.S. territories, where a total of 122 women are known to have contracted the virus. The 157 pregnant women in the continental U.S. are believed to have contracted it during travels outside of the country or from sexual contact with an infected partner who had traveled. So far there has been no confirmed case from a local mosquito bite in the continental U.S. But the mosquitoes biologically capable of transmitting the disease are found in about two-thirds of country, and public health authorities expect that there will be small clusters of Zika caused by those bugs. Because of the threat to pregnant women, CDC also announced Friday that it has launched two new Zika-related pregnancy tracking systems—one for the U.S. and most of its territories and one specific to Puerto Rico—to officially record the broader population of Zika-infected pregnant with laboratory evidence of the virus, regardless of their symptoms. CDC is not yet sharing any specific patient details about individual cases, or whether the women contracted the virus sexually or during travel. http://www.scientificamerican.com/article/new-report-says-279-u-s-pregnant-women-have-zika/
  12. Why the number of pregnant US women with possible Zika infections just tripledUpdated by Julia Belluz on May 20, 2016, 12:50 p.m. ET @juliaoftoronto [email protected] TWEET SHARE (25) + If you've been watching cable news, you might get the impression that an epidemic of Zika among pregnant women has suddenly spiraled out of control in the United States. According to a report on Friday from the Centers for Disease Control and Prevention, 279 pregnant women with possible Zika infection in US states and territories are being monitored — tripling the agency's previous estimates. Have cases suddenly spiked? Not exactly. What actually happened is that the CDC changed the method it's been using to count cases. The new approach uses a broader definition — and one that better reflects what we're learning about how the disease can affect fetuses. RelatedSimple Zika advice for women, from a top CDC officialUntil today, the CDC only looked at women who had both evidence of Zika virus in blood tests as well as symptoms or complications during pregnancy. That methodology was based on the belief that there was an association between symptomatic women and birth defects associated with the virus, like microcephaly — which is characterized by a shrunken head and incomplete brain development. (Zika symptoms include fever, rash, joint pain, and red eyes — but they only occur in a minority of people who have the virus.) Newer research has indicated that some women who test positive for the virus but recalled having no symptoms later delivered babies with microcephaly and other brain defects. By the new count, there were 157 pregnant women on the US mainland with possible Zika infection and 122 pregnant women in Puerto Rico — a total of 279 women. The CDC had previously said it was monitoring just 113 pregnant women, a number that excluded those who didn't report Zika symptoms or pregnancy complications. The CDC has not yet reported on the outcomes of pregnancies they're monitoring. Zika definitely causes birth defectsAccording to the Centers for Disease Control and Prevention, there's indisputable evidence that Zika causes microcephaly. The association between the condition and Zika has been seen in this outbreak in Brazil, as well as in reanalyses of the data from previous outbreaks, such as one in the French Polynesian islands in 2013 to 2014. Other countries, including Cabo Verde, Colombia, Martinique, and Panama, have also reported microcephaly or other fetal malformations to the WHO over the last year. In addition to microcephaly, researchers have found that the virus seems to kill off the tissue in entire regions of the brain, damage babies' eyes, and heighten the risk of miscarriage and fetal death. Researchers believe pregnant women are at a greatest risk of having babies with birth defects if they are infected in the first trimester. They've also estimated that women infected with Zika during the first trimester of their pregnancies face a one in 100 chance of delivering a baby with microcephaly. Zika wouldn't be the first virus to cause microcephaly. Rubella famously caused an epidemic of birth defects before the advent of the vaccine, and cytomegalovirus (CMV) can damage fetuses too. But Zika is the first mosquito-borne virus to threaten fetuses. And even if birth defects turn out to be a very rare complication of Zika, the risk to fetuses was enough to prompt the WHO to declare a rare global public health emergency earlier this year. Health officials urge pregnant women to avoid travel to places where Zika is circulatingIn total, there have been about 550 cases of Zika in the United States — but most have originated in places where the virus is currently circulating, and a minority have occurred because of sexual contact with a traveler. "Although the mosquitoes that carry Zika are here, Zika is not currently here," Dr.Denise Jamieson, an obstetrician-gynecologist and the chief of CDC's women's health and fertility branch, told us in April. So she advised pregnant women in the continental US to avoid travel to areas where there is ongoing Zika transmission. (This includes more than 40 countriesaround the world.) "For women who live here and are pregnant — they should avoid mosquito bites." http://www.vox.com/2016/5/20/11720672/zika-pregnancy-cases-US
  13. The Count of American Zika Cases Just Got BiggerThe CDC is now reporting that nearly 300 women in the U.S. and its territories have the virus. Zika's mosquito vectors at a Kansas lab Josh Replogle / AP TEXT SIZE NORA KELLY 12:48 PM ET POLITICSThe Centers for Disease Control and Prevention announced Friday that 279 pregnant women in the United States and its territories have tested positive for the Zika virus, which can cause the birth defect microcephaly. At first glance, that figure looks like a frightening uptick in the number of cases—it’s more than double the number released just last week. But the agency was quick to note that the new numbers reflect updated reporting standards that encompass a greater pool of women. RELATED STORYThe Still Uncertain Future of Zika Funding Previously, the CDC only reported the number of pregnant women who tested positive for Zika and either showed symptoms or had Zika-related complications, a news release explains. Now, the agency is reporting all pregnant women who have “any laboratory evidence” of possible infection, no matter what. The CDC made the change after seeing reports of asymptomatic pregnant women who delivered children with birth defects. Researchers still haven’t nailed down women’s “absolute risk” of having microcephalic babies, a CDC official recently told PBS NewsHour. Researchers have known for months that not every Zika patient shows symptoms; indeed, most infected people don’t. That’s in part what makes the virus so concerning. Before the virus emerged in South America in 2015 and began creeping northward, public-health-research agencies had not focused on it. In recent months, everything scientists have learned about Zika is “a bit scarier than we initially thought,” the CDC principal deputy director Anne Schuchat said last month. Researchers have established a causal link between Zika and microcephaly, as well as a link with the autoimmune disorder Guillain-Barré; they know it can be transmitted sexually; and there have been reports of brain and spinal-cord infections related to Zika. Its range is amplifying as well, even as outbreaks in some locations, such as Brazil, have quieted. The World Health Organization reported Friday that the Asian strain of Zika, which appeared in Brazil last year, is now in Africa. http://www.theatlantic.com/politics/archive/2016/05/zika-cdc-congress/483737/
  14. DR. MARGARET HONEIN: thank you for your question. I’ll address the first one. The majority of the pregnancies being monitored by these two Zika virus surveillance systems are still ongoing. At this time there's relatively few adverse birth out comes and we’re not reporting on specific outcomes out of concern of protecting the privacy of the affected families. Among those pregnancies with lab evidence of Zika virus infection that are being monitored by these two surveillance systems, CDC is aware of less than a dozen adverse out comes. The adverse outcomes include miscarriages and birth defects. While we're not reporting the specific information about the cases at this time, we are working closely with our partners at state, local and territorial health departments to obtain full information on those adverse outcomes. http://www.cdc.gov/media/releases/2016/t0520-zika-update.html
  15. The "official" number of cited Zika pregnancy adverse neurological outcomes in the US is at two (live severe microcephaly birth in Hawaii ex-Brazil and District of Columbia ex-Guatemala termination after severe brain atrophy) as well as microcephaly termination in Puerto Rico. However, today's press release on asymptomatic Zika positive pregnancy cases noted that there were "less than a dozen" adverse outcomes, suggesting most adverse outcomes have not been made public.
  16. Pregnant Women with Any Laboratory Evidence of Possible Zika Virus Infection in the United States and Territories, 2016Language:EnglishEspañolPortuguêsRecommend on FacebookTweet Pregnant Women with Any Laboratory Evidence of Possible Zika Virus InfectionUS States and the District of Columbia Pregnant women with any laboratory evidence of possible Zika virus infection: 157**This update includes aggregated data reported to the US Zika Pregnancy Registry as of May 12, 2016. US Territories Pregnant women with any laboratory evidence of possible Zika virus infection: 122**This update includes data from the US territories reported to the US Zika Pregnancy Registry and data from Puerto Rico reported to the Zika Active Pregnancy Surveillance System as of May 12, 2016. About These NumbersWhat these updated numbers show These updated numbers reflect counts of pregnant women in the United States with any laboratory evidence of possible Zika virus infection, with or without symptoms. Pregnant women with laboratory evidence include those in whom viral particles have been detected and those with evidence of an immune reaction to a recent virus that is likely to be Zika.This information will help healthcare providers as they counsel pregnant women affected by Zika and is essential for planning at the federal, state, and local levels for clinical, public health, and other services needed to support pregnant women and families affected by Zika.What these new numbers do not show These new numbers are not comparable to the previous reports. These updated numbers reflect a different, broader population of pregnant women.These updated numbers are not real time estimates. They will reflect the number of pregnant women reported with any laboratory evidence of possible Zika virus infection as of 12 noon every Thursday the week prior; numbers will be delayed one week.Where do these numbers come from? These data reflect pregnant women in the US Zika Pregnancy Registry and the Zika Active Pregnancy Surveillance System in Puerto Rico. CDC, in collaboration with state, local, tribal and territorial health departments, established these registries for comprehensive monitoring of pregnancy and infant outcomes following Zika virus infection. The data collected through these registries will be used to update recommendations for clinical care, to plan for services and support for pregnant women and families affected by Zika virus, and to improve prevention of Zika virus infection during pregnancy. http://www.cdc.gov/zika/geo/pregwomen-uscases.html
  17. Press Briefing TranscriptFriday, May 20, 2016, 10:00 AM EDT Audio recording[MP3, 7.01 MB]Please Note:This transcript is not edited and may contain errors. OPERATOR: welcome and thank you for standing by. During the question and answer session, please press star 1 on your touchtone phone. Also, today is being recorded. I’d like to turn the conference over to Ms. Kathy Harben. KATHY HARBEN: thank you all for joining us this morning for this update on Zika virus, specifically the MMWR article announcing the change in how CDC reports the number of pregnant women affected by Zika virus. Today Dr. Denise Jamieson, a clinical OBGYN with CDC division of reproductive health and co-lead of the pregnancy task force will provide opening remarks. Also joining us is Dr. Margaret Honein. She is chief of CDC's birth defects branch, National Center for Birth Defects and Developmental Disabilities. And co-lead of the pregnancy and birth defects task force. Dr. Jamieson will now give opening remarks. DR. DENISE JAMIESON: Good morning. As of today, national reporting of the number of U.S. pregnant women affected by Zika virus will change. Previously CDC reported the number of pregnant women with Zika virus which included only pregnant women with symptoms or pregnancy complications consistent with Zika. CDC will now report pregnancy data from two enhanced surveillance systems (The U.S. Zika Pregnancy Registry and the Puerto Rico Active surveillance system. Both of these systems include pregnant women with any laboratory evidence of possible Zika virus infection with or without symptoms. The new reporting systems are the topic of a MMWR, which has just been released. And we also be shortly updating the pregnancy numbers on the CDC's website. I’ll now turn it over to Dr. Margaret Honein for additional comments. DR. MARGARET HONEIN: thank you for joining us. Today I’ll provide further information on how we are reporting on the number of pregnant women affected by Zika virus. Before today, CDC's ArboNET used an interim case definition established by the state and territorial epidemiologist to report the number of those are Zika disease. We’ve learned a lot in the past four months and now we know of reports of asymptomatic Zika infections linked to microcephaly brain defects and miscarriage. Recent published studies indicate that there are babies with microcephaly that have test results suggesting Zika infection but whose mothers did not recall having any symptoms of Zika. Therefore, starting today, CDC will begin reporting the number of pregnant women with any laboratory evidence of possible Zika virus infection with or without symptoms from the U.S. Zika pregnancy registry and the Puerto Rico Zika active pregnancy Zika surveillance system. This reporting is in line with our recommendations with ongoing pregnancies at risk for poor outcomes associated with Zika based on our current understanding with the risk of Zika infection during pregnancy. Research to further determine the link between Zika infection symptoms and birth outcomes is still underway. As of last Thursday, May 12th, the two Zika virus infection surveillance systems are monitoring 157 pregnant women in the U.S. states and 122 pregnant women in the U.S. territories with laboratory evidence of possible Zika virus infection. That is a total of 279 pregnant women in the U.S. states and territories. These updated numbers reflect all pregnant women in the United States, including U.S. territories, with any laboratory evidence of Zika virus infection regardless of whether they had symptoms. This includes pregnant women in whom Zika virus particles have been detected and women whose tests indicate an immune reaction to a recent virus that is likely to be Zika. There are a couple of important reasons for this change. First, reporting numbers from the U.S. Zika pregnancy registry and the Puerto Rico active surveillance system will provide a more complete picture of the effects of Zika on pregnant women in the U.S. states and territories. Second, since Zika virus outbreak began, experts have found that interpretation of laboratory testing for Zika virus infection can be difficult. The surveillance systems include pregnant women with any laboratory evidence of Zika virus infection. This includes pregnant women who are likely to have Zika but whose laboratory testing results suggest they might have been infected with another virus such as dengue. Because of the potential risk of Zika virus infection during pregnancy, CDC's top priority for the Zika response will continue to be protecting pregnant women and their fetuses. Understanding the range of health effects linked with Zika infection during pregnancy, as well as how many and which pregnancies may be at risk of poor outcomes is essential for guiding our public health response to Zika. Reporting the total number of pregnant women with any laboratory evidence of possible Zika virus infection from the U.S. Zika pregnancy registry and the Puerto Rico active surveillance system will provide a more comprehensive picture of the effects of Zika in the U.S. States and territories. This comprehensive information will assist healthcare providers as they counsel pregnant women affected by Zika. It is also essential for planning at the federal, state and local levels for the clinical public health and services needed to support pregnant women and families affected by Zika. Our goal is to track all Zika affected pregnancies through the U.S. Zika Pregnancy Registry and the Puerto Rico Zika Active Pregnancy Surveillance System. To get the complete picture we need participation by all jurisdictions. All jurisdictions are encouraged to participate because it will allow us to gather as much data as possible as quickly as possible to arm pregnant women, healthcare providers and public health authorities with needed information. It is important to note that these new numbers are not comparable to CDC’s previous reports of pregnant women who have Zika virus. These updated numbers reflect a broader range of pregnant women. The new numbers will affect the number of pregnant women with any laboratory evidence of possible Zika virus infection as of 12 noon each Thursday the week before. The numbers will be reported weekly on the CDC website, but will reflect the total count as of one week prior to allow time for verification of numbers. KATHY HARBEN: Thank you, Dr. Honein. Ashley we're now ready to open up the line for questions. OPERATOR: We will now begin the question and answer session. If you would like to ask a question, please press star 1. Please unmute your phone and state your name clearly when prompted. To withdraw your request press star 2. One moment please for your first question. Again, if you'd like to ask a question, please press star 1. Our first question comes from Mike Stobbe with the Associated Press. MIKE STOBBE: Hi. Thank you for taking my call. I have a couple of questions. First to Dr. Honein’s last comment about they're not directly comparable. Can you give us an idea now that we have this new definition and this new number what the pace of new diagnosis has been? Have we seen under this new definition -- have we been seeing a steady trickle or have we seen a bunch of new ones in recent weeks? What’s been the pace only under this new definition, what's been the pace of new cases? And then I wanted to ask -- it was back in January that i think Oliver row mellow had the study that showed asymptomatic women had given birth to children with abnormalities. Why now in May the change if that's been reported for several months? And then the last question, do you know of any cases -- I’m sorry. That’s it. Those two. Margaret Honein Okay. So this is Margaret Honein. You can see in the figure from the MMWR which hopefully you've all received by now that we've been monitoring pregnant women with both symptomatic and asymptomatic infections since February when we started the registry. This is not a change in who we're monitoring. We have always been monitoring this broad definition of pregnant women with any laboratory evidence of Zika virus infection. The change is that we're now publicly reporting the number so that we've giving a more transparent picture of all the monitoring that we're doing. This is a whiter net than the arbonet definition but this is consistent with the definitions established with the U.S. Zika registry and the Zika Active Pregnancy Registry in Puerto Rico from the beginning. I think the why now question is in an attempt to be transparent about the monitoring and the full count of pregnant women that we think are at risk of adverse outcomes. We’ve learned a lot in the past four months about the risk of adverse out comes. And with the growing evidence, both some publications about asymptomatic pregnant women having a variety of adverse outcomes and other accumulating data, we felt it was important to publicly share the numbers that we have been monitoring since February. MIKE STOBBE was there some turning point event? Why in May and not like last month? DR. MARGARET HONEIN: We’ve been working closely with the state, local and territorial health departments to get case reports from as many jurisdictions as possible to verify those numbers with them. we were hoping to transition to this a couple of weeks ago but it's taken time to work with all the different jurisdictions and make sure that we have accurate numbers of what's being monitoring in all of those locations. We’re also continuing to monitor every publication on this disease and we're gathering more information and learning more every single day. We know a lot more about this and what the potential risk is using this broader case definition than we did a few months ago. OPERATOR: Your next question comes from Betsy McKay with the wall street journal. BETSY MCKAY: I wondered if you could tell us how many of these 279 pregnant women have had pregnancy complications of any kind, you know, birth defects, miscarriages, whatever. I think Dr. Honein said that, you know, information on those birth outcomes would be coming later. But is there anything you can tell us now? Because this is a dramatic increase in numbers. You know, readers and viewers are going to want to know what this means. You know, the last thing we know is that there are about seven cases in the U.S. of these complications. So is it only seven? Is it more than seven? Is it half of these cases? Anything you could tell us would be really helpful. The second question is, the report says that some of the pregnant women were infected through sexual transmission rather than through mosquito bites in travel. How many of those women were affected by sexual transmission? Thanks. DR. MARGARET HONEIN: thank you for your question. I’ll address the first one. The majority of the pregnancies being monitored by these two Zika virus surveillance systems are still ongoing. At this time there's relatively few adverse birth out comes and we’re not reporting on specific outcomes out of concern of protecting the privacy of the affected families. Among those pregnancies with lab evidence of Zika virus infection that are being monitored by these two surveillance systems, CDC is aware of less than a dozen adverse out comes. The adverse outcomes include miscarriages and birth defects. While we're not reporting the specific information about the cases at this time, we are working closely with our partners at state, local and territorial health departments to obtain full information on those adverse outcomes. Also, since most of the pregnancies we're monitoring are ongoing, it's not possible to use this information to estimate the risk of adverse outcomes. To appropriate estimate the risk we would need to consider the number of adverse outcomes out of the total number of completed pregnancies. The Zika Pregnancy Surveillance Systems will eventually be able to provide the information that's needed to estimate risk and to provide the critical answers to the questions you're asking, but we're not at that stage yet. And to your second question, we're also not reporting the numbers out of the registry that are by sexual transmission versus mosquito born transmission at this point in time. OPERATOR: Your next question comes from Elizabeth Cohen with CNN. Your line is open. ELIZABETH COHEN: Hi, thanks very much for having this press conference. I would second that the question about wanting to know more about outcomes. I think that in the past CDC has done that in different situations without violating privacy. It’s unclear why we can't do that now. But having given the answer that you're given, I was wondering can you be more specific when you say most are still ongoing. Also do you know if in which registry there were any asymptomatic women who gave birth to or had miscarriages or had a Zika related outcome? And if so, how many? DR. MARGARET HONEIN: So I don't have information on linking symptoms of lack of symptoms to the adverse outcomes we're aware of yet. And we really have not complete information at this point of time on the adverse outcomes. So I think it would be premature for us to be sharing that until we'd gathered more comprehensive information. We do know of at least four published reports that have had various levels of information about asymptomatic mothers having babies with adverse outcomes such as microcephaly, miscarriages and other outcomes. So some of this is based on what we're reading in the literature, more than what we're seeing in the pregnancy registries. ELIZABETH COHEN: When you say four reports, were those four individual women or reports of many women with several -- four individual women or four reports about women? DR. MARGARET HONEIN: I think of the four published reports, one is an individual case and the others are larger case series. OPERATOR: your next question comes from Maggie Fox with NBC News. MAGGIE FOX: First of all, I missed what you said CDC was aware of how many adverse outcomes, please? I just missed the number. Second, does this suggest that more women who are pregnant and suspect they might have had Zika should be getting tested? And is there capacity for this testing especially given that state and local health departments are being cut back and there's still not funding out there? Thanks. DR. MARGARET HONEIN: So we have CDC recommendations for testing of both symptomatic pregnant women and also guidance to offer testing to asymptomatic pregnant women who have traveled to or reside in areas of Zika virus transmission. That recommendation is to offer testing once at the initiation of prenatal care and once during the second trimester. We’re committed to making sure that this is available. It’s critical for pregnant women who have information on whether or not they have likely been infected with Zika virus infection. So we have dramatically increased the state capacity for helping with this testing. CDC is working hard on this testing. DR. DENISE JAMIESON: And the decision about whether jurisdiction should institute testing is based on the decision of local authorities, based on the local transmission rates as well as the laboratory capacity. OPERATOR: your next question comes from Eben Brown with Fox News. EBEN BROWN: A couple questions. the number 279, does this include women who are currently pregnant or women who both are currently pregnant and also who were pregnant but have since either given birth or have miscarried or for some reason no longer pregnant? I’m not clear on that. And then I’ve got a follow-up. DR. MARGARET HONEIN: The number 279 includes all of the pregnant women, those that are still pregnant as well as those who are no longer pregnant but were pregnant at the time of their Zika virus infection. The majority of these are ongoing pregnancies. EBEN BROWN: okay. Are the women who are no longer pregnant still being monitored for anything follow up-wise or are they added into your tally but no longer being monitored? DR. MARGARET HONEIN: So in some cases we're continuing to gather complete information about their pregnancies and adverse outcome but we're not doing ongoing monitoring of the woman herself after the end of her pregnancy. EBEN BROWN: Okay. Why not institute this time of tallying and record keeping from the very beginning? I know that there was a change and i understand the reasoning for the change. But why was this not done from the very beginning of especially CDC really taking a big interest in this? DR. MARGARET HONEIN: We did begin these pregnancy registries early on in the response. However, we have gathered new information and its being published every day new information. We’re learning more every day. We’re working very hard to better understand this virus. And the accumulating evidence about the potential for adverse outcomes in a much broader group than we originally thought might be the case really motivated us to push forward and report on the pregnancy information. The pregnancy registry information – the broader definition. So while we've been gathering this, as the data accumulated about the risk of asymptomatic infections, it seemed more and more important to be very transparent and share the full number of pregnant women with adverse outcomes associated with Zika. KATHY HARBEN: next question, please. OPERATOR: Your next question comes from Dan Childs with ABC News. Your line is open. DAN CHILDS: Thank you so much for taking my call. The question that I had is given that four in five people infected with Zika show no symptoms how confident are we that we're catching all cases of pregnant women. Is this system going to be ready to catch all or even most of these cases? DR. MARGARET HONEIN: The system is ready to monitor these cases but it's very important that healthcare providers be aware of our guidelines and our offering testing to asymptomatic pregnant women who either have traveled to an area with ongoing Zika virus transmission or reside in an area with ongoing Zika transmission. We are taking efforts to communicate with professional groups and seek their assistance in making sure healthcare providers are aware of our recommendations and are communicating this information to their patients. DAN CHILDS: I just had one follow up question. Will CDC be monitoring and reporting microcephaly cases and other cases of birth defects in the future and if so is there a projected date for that? DR. MARGARET HONEIN: We don't have a projected date at this point, but we do anticipate at some point coming out with outcomes to accompany this registry information. We are monitoring all the outcomes, want to verify the outcomes and eventually will plan to report that. OPERATOR: your next question comes from Donald McNeil from the "New York Times." DONALD MCNEIL: Hi, can you explain why you're not giving the number of cases that are sexually transmitted? I mean, this is a serious issue. We already know that a lot of women don't take it seriously. It’s hard to convince pregnant women to use condoms when they're already pregnant. It’s hard to convince their partners. It seems this information would be pretty useful in convincing people that it's a serious threat. DR. MARGARET HONEIN: I think we know of a relatively small number of cases in pregnant women that are definitively resulted from sexual transmission. But in so many cases where someone has traveled to an area of ongoing Zika virus transmission via mosquitos we can't definitively separate the method of transmission for those women. I think those public health messages are critically important for all women and not just based on the numbers where we know because a woman didn't travel that the only risk factor would have been sexual transmission. So I think it is critically important to get that message out that we know sexual transmission can occur, that there is CDC guidance about preventing transmission to women who are pregnant or women who are thinking about becoming pregnant and their partners. OPERATOR: Your next question comes from Brady Dennis with "Washington Post." Your line is open. BRADY DENNIS: Thanks for having the call. I had one thing to clarify earlier when we started talking about the numbers. I couldn't tell if it was Dr. Honein or Dr. Jamieson who said there have been about a dozen or so adverse outcomes among these women. Am I understanding that correctly? And who was that saying that? DR. MARGARET HONEIN: This is Dr. Honein. CDC is aware of less than a dozen adverse outcomes at this time but we don't have full information on all of the outcomes. BRADY DENNIS: Mainly because they're ongoing? John Cohen Mainly because they are ongoing pregnancies, correct. BRADY DENNIS: Okay. OPERATOR: Your next question comes from Kevin Finnegan with CBS News. Your line is open. KEVIN FINNEGAN: Good morning. I just want to talk about how you're casting a very broad net. I’m just wondering is there any danger of over estimation because of dengue cross reaction. DR. DENISE JAMIESON: This is Denise Jamieson. Given what we now know as we said we think it's important to cast a wide net and to include both asymptomatic and symptomatic pregnant women. The biggest change in the numbers is due to including these asymptomatic with Zika virus infection. And we do exclude any women with evidence of other viral infections such as dengue. Since laboratory testing and in particular with sear logic testing has its limitations there may be a few women included who do not have Zika virus infections. But since tested women either travel to or reside in areas with large ongoing outbreaks of Zika virus we are confident that most of these pregnant women reporting do have Zika virus infections. KATHY HARBEN: Next question, please. OPERATOR: Your next question comes from Elizabeth St. Phillip with CTV national news. Your line is open. Elizabeth, your line is open. We’ll go to the next question. Your next question comes from John Cohen with science magazine. JOHN COHEN: I wanted to clarify one thing and ask another question. In your press release from MMWR, it reads as though you were only reporting case definitions in general, not specifically for pregnant women who had symptoms. And the W.H.O. case definitions are people who test positive on laboratory tests that doesn't have that symptom requirement. Which leads to the more complicated question of why have that symptom requirement in the first place when W.H.O. and P.A.O have a simple lab test. And then I have a follow-up question. DR. MARGARET HONEIN: The council of state and territorial epidemiologist has an interim question. That is an interim case definition and that is still being worked on by that group. And there will not be a final case definition until June. So CDC is working closely with the counsel of state and territorial epidemiologists and there is a lot of discussion about these issues. So I think that there are many revisions and clarifications being made to those. What we have right now is to work within the existing case definition with arbonet reporting, a broader definition for the pregnancy registries. JOHN COHEN: given that 80 percent of the people have no symptoms, are estimated to have no symptoms and the W.H.O and P.A.O are using a different system, isn't that confusing? DR. MARGARET HONEIN: We know that there are a lot of asymptomatic infections with Zika virus. we don't know the exact percentage but we know there are a lot of asymptomatic infections and for that reason we have carefully monitored with the pregnancy surveillance systems both symptomatic Zika virus disease and asymptomatic Zika virus infections. So we agree with you it's very important to monitor both. OPERATOR: Your next question comes from Elizabeth Cohen with CNN. Your line is open. ELIZABETH COHEN: Thank you. I wanted to ask a little bit more about the increase. So it makes sense that there have been more pregnant women with Zika over time since the outbreak began in the United States. But it also makes sense of course that it's grown with the reporting because of the reporting. So these new higher numbers could be a reflection of both of those changes, the natural increase of the number of pregnant women with Zika in the U.S. but also because of the changing reporting. Would it be incorrect to attribute to both of those thing? DR. DENISE JAMIESON: It's not because we're counting them differently. We’ve been monitoring both systems since early on in the outbreak. What’s different now is that we're reporting them in a different way. As the numbers of pregnant women have increased, we felt it was more and more important to make sure that the pregnant women who we were monitoring that we were also transparent about reporting those numbers. I think it's a combination of both, both increasing numbers of pregnant women with increase in Zika virus infection as well as a very recent change in the way we're reporting out the numbers on a weekly basis. ELIZABETH COHEN: okay. Thank you for clarifying. I had a follow-up question about sexual transmission. When a woman travels to a Zika area or lived there, there's really no way of knowing whether it was from sexual transmission or from a mosquito bite. But there have been at least nine women, if I’m remembering that number right, who contracted Zika without ever leaving the continental U.S. but their male partners has been travelers. First of all, has that number nine increased since you reported it? And second have any of those women become pregnant? DR. DENISE JAMIESON: Sorry what was the last part of your question? ELIZABETH COHEN: Has that nine number, if I’m remembering it correctly -- you reported it a while back. As that nine number increased and have any of those women become pregnant -- any of those Zika positive women become pregnant? I’m talking people who were in the U.S. and never traveled, contracted it sexually. DR. MARGARET HONEIN: I’m not aware of any -- I don't think we have that information. So the recommendation would be after travel to an area with ongoing Zika virus infection, if there's no symptoms we would recommend both men and women wait eight weeks to conceive because of the possibility of asymptomatic infection. But I’m not aware of case reports at this time that would fall into the category of being conceived during that time post travel. Is that what you're asking? OPERATOR: Your next question comes from Joe Neel with national public radio. JOE NEEL: I’d like to know what Elizabeth -- if you could open Elizabeth’s line again, I’d like to hear the end of that. But my question until we can do that is I’d like to put this in some type of context. What is the baseline rate of microcephaly in the U.S.? DR. MARGARET HONEIN: In the United States microcephaly affected about six per 10,000 infants. JOE NEEL: And do you have any idea, any estimate when you might be able to put a number on the risk that Zika poses for microcephaly in U.S. women? DR. MARGARET HONEIN: We're learning more every day but we don't have enough data to estimate that at this time. There are two published reports that can inform that question, though. One in French Polynesia where they had eight cases of microcephaly. There was a paper published that estimated first trimester infection might relate to about a 1 percent risk. And second there was a paper published based on data from Rio de Janeiro in Brazil looking at ultrasound screenings. So not definitive pregnancy out comes but from ongoing pregnancies for the most part that estimated about a 30 percent risk of adverse outcomes. But we need much more data to provide more precise and better estimates of the risk. JOE NEEL: Thank you. OPERATOR: Your next question comes from Gregory Korte from USA Today. GREGORY KORTE: I’m still trying to get a sense of - with these new numbers reflect as i gather both the change in methodology and an increase in the number of cases. what would the number be today under the old methodology just to kind of maybe help us suss out how much of this is methodological and is there any reason to believe since you're monitoring pregnant women more carefully, is that the best way to get the overall sort of Zika trajectory in the United States? DR. MARGARET HONEIN: So the last week of reporting with the arbonet numbers was last week. And in the U.S. states there were 47 cases of Zika virus disease and in the territories there were 65 cases. So 47 in arbonet compared to 157 in the U.S. states with the pregnancy registers and 65 in arbonet compared to 122 in the U.S. territories. And I’m sorry could you repeat the second part of your question? GREGORY KORTE: Is looking at these numbers the best way to get a sense of the overall trajectory of the Zika spread in the United States given that you're monitoring pregnant women most closely here? DR. MARGARET HONEIN: Yes. I think this gives a good indication of the prevalence of Zika virus infection because pregnant women are being prioritized for referral to testing. So we recommend testing of both symptomatic pregnant women and asymptomatic pregnant women during initiation of prenatal care and during the second trimester. If you look at the figures in the MMWR, you can see what appears to be following the CDC recommendations more testing of asymptomatic pregnant women and identifying those infections that are occurring without symptoms. OPERATOR: Your next question comes from Katie Leslie from Dallas Morning News. Your line is open. KATIE LESLIE: Hi. Thanks for having this press conference today. I had a general question about transmission. I understand that no one has yet contracted Zika from a mosquito. But for those who have from traveling abroad or sexually, how long are they considered contagious? I’ve seen warnings to take steps to prevent the spread in the first week of infection. But how confident are you that that window of infection, either sexually or that a mosquito would bite that person is just one week and what should be done to prevent the spread to I guess mosquitos at this point? DR. DENISE JAMIESON: This is Denise Jamieson. We are recommending that people take precautions upon returning from travel and use insect repellant and avoid mosquito bites for three weeks following their return from an area with ongoing Zika virus transmission. KATIE LESLIE: I cover Texas. I think they've had 35 cases. People who have that now, are they being quarantined? I mean, what happens to those who do have it and they're back in the states? They don't leave their homes? DR. DENISE JAMIESON: Yes. People who have Zika virus infection currently in the United States, we recommend that they avoid further mosquito bites and use insect repellants for three weeks following return from travel. And for those with documented Zika virus infection, we recommend similarly that they take precautions and avoid mosquito bites for several weeks after the onset of symptoms. KATHY HARBEN: at this point we do want to check and see if Elizabeth Cohen, if your question was answered. OPERATOR: Elizabeth Cohen, your line is open. ELIZABETH COHEN: Thank you for coming back to me. I appreciate that. So if the set of women who we know in the continental United States caught Zika sexually and we know this because they didn't travel to a Zika endemic area but their male partners had Zika so we know they caught it sexually. Amongst these women, did any of them get pregnant while Zika positive, any of them in this 297 number. DR. MARGARET HONEIN: The number is 279 pregnant women who were monitored. ELIZABETH COHEN: Sorry. DR. MARGARET HONEIN: Just to be clear. I don't know the answer to that. OPERATOR: Your next question comes from Megan Rosen with science news. Your line is open. MEGAN ROSEN: Hi, just a follow-up question about the 279 women. Can you tell us how many of these women are in the first, second or third trimester, how many of them have given birth and whether or not these births were live births or miscarriages. DR. MARGARET HONEIN: No, we don't have those details to report at this time. MEGAN ROSEN: Okay. Thank you. KATHY HARBEN: We have time for one more question. OPERATOR: As a reminder if you'd like to ask a question, please press star 1. KATHY HARBEN: Hearing no questions, thank you, Dr. Honein and Dr. Jamieson for joining us today. Thank you also to the reporters who have been with us. If you have follow-up questions you can cause the press office at 404-639-2286. We will post a transcript of this telebriefing on the CDC newsroom website. Thank you for joining us. This concludes our call. http://www.cdc.gov/media/releases/2016/t0520-zika-update.html
  18. Audio http://www.cdc.gov/media/releases/2016/t0520-zika-update.mp3
  19. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  20. CDPH Weekly Update on Number of Zika Cases in California May 20, 2016 The following table provides the number of travel-associated cases of Zika in California residents in 2015 and 2016. CDPH is following CDC testing guidelines. This table is updated every Friday. As of May 20, 2016, there have been 49 travel-associated cases of Zika in California.  Total: 49  Pregnant: 10*  Sexually transmitted: 1 Cases of Zika in California, 2015-2016§ (as of May 20, 2016) County Travel-associated cases¥ Locally acquired cases† Alameda 4 0 Contra Costa 3 0 Los Angeles 13 0 Marin 1 0 Napa 1 0 Orange 2 0 San Bernardino 3 0 San Diego 12** 0 San Francisco 2 0 San Joaquin 2 0 San Mateo 2 0 Santa Clara 1 0 Sonoma 1 0 Yolo 2 0 Total 49 0 https://www.cdph.ca.gov/HealthInfo/discond/Documents/TravelAssociatedCasesofZikaVirusinCA.pdf
  21. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  22. http://rense.gsradio.net:8080/rense/special/rense_051916_hr1.mp3
  23. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.