-
Posts
74,774 -
Joined
-
Last visited
-
Days Won
31
Content Type
Profiles
Forums
Articles
Events
Blogs
Everything posted by niman
-
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
-
Metro Health confirms 2 new cases of Zika virus in San Antonio residentsResidents contracted virus while traveling abroadBy Robert Taylor - Web - News EditorPosted: 10:50 AM, May 20, 2016Updated: 6:39 PM, May 20, 2016685 685SAN ANTONIO - Two new cases of the Zika virus have been confirmed in San Antonio residents, the Metropolitan Health District reported Friday. "What we, as a health department, are doing is surveillance and making sure the virus now present in the mosquito. It is not thus far," Dr. Anil Mangla, assistant director of Metro Health said. More Health HeadlinesSenate likely to advance $1.1 billion in Zika fundingMosquito season brings no urgency for money to fight ZikaRio Olympics: South Korea unveils anti-Zika uniformObama wants $1.9B to fight Zika: Where does it stand?Mayor, county officials share tips to help fight Zika virusMetro Health said the residents contracted the virus while traveling abroad, not in Texas. "I know people are worried but I want to reassure the population that we are safe with Zika right now," Mangla said. Here are the latest Zika virus numbers for San Antonio: 6 confirmed cases41 negative test results19 pending investigationsIn the wake of recent rain across South Texas, Metro Health is advising residents to take the following precautions to reduce the mosquito population: Remove standing water.Wear long-sleeved shirts and long pants.Avoid use of perfumes and colognes when working outdoors.Use an insect repellent containing DEET or Picaridin.Metro Health also advises pregnant women and women who are considering becoming pregnant who have a sex partner living in or traveling to Zika-affected areas to abstain from sex or use condoms correctly and consistently for the duration of the pregnancy. Men who traveled to a Zika-affected area also should abstain from sex or use condoms correctly and consistently for three months after their return.
-
Two new cases of the Zika virus have been confirmed in San Antonio residents, the Metropolitan Health District reported Friday. "What we, as a health department, are doing is surveillance and making sure the virus now present in the mosquito. It is not thus far," Dr. Anil Mangla, assistant director of Metro Health said. Metro Health said the residents contracted the virus while traveling abroad, not in Texas. http://www.ksat.com/health/metro-health-confirms-2-new-cases-of-zika-virus-in-san-antonio-residents
-
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
-
Two pregnant Garland women test positive for ZikaTwo expecting mothers in Garland had a confirmed case of the Zika virus, health officials said.By: FOX4News.com Staff POSTED:MAY 20 2016 01:39PM CDT UPDATED:MAY 20 2016 05:54PM CDT GARLAND, Texas - Two expecting mothers in Garland had a confirmed case of the Zika virus, health officials said. Garland Health Director Jason Chessher says he's aware of two positive test results in the city, both involving pregnant women. However, the Center for Disease Control has only confirmed one case. Ad Content 7 Reasons Why Glasses Should be Bought OnlineGlassesUSA.com Who Gets the Home in a Divorce? This Lawyer ExplainsAvvo Chessher says a pregnant woman from Garland traveled to a Central America sometime in late March. When she returned to North Texas, she went to her doctor and was tested for the Zika virus. Since the test came back positive, it was automatically sent to the CDC which conducts a second independent test. On Friday, the CDC confirmed the woman’s positive result. Top fox4news.com Searches AuctionShootingGarlandTent CitySave Me SteveIrvingTwo pregnant Garland women test positive for ZikaThe other pregnant woman, who is not related to the first patient, also traveled to Central America. When she returned to Garland, she was tested for the Zika virus which resulted positive. However, the CDC has not confirmed that second test result. It is not yet clear if the unborn babies affected. “Neither of these individuals came to Garland during the disease phase where they could transmit the virus to another person,” explained Chessher. “So in terms of intervention, there's nothing to be done on our part.” Garland officials do not believe there is any risk to others in the area because the women didn’t return to Garland until after the phase of the disease when they were capable of transmitting the virus to mosquitoes. Symptoms of the Zika virus are usually mild and only last several days. But, doctors have found a link between the virus and birth defects. It is typically spread by mosquitoes, so pregnant women especially are encouraged to protect themselves against bites.
-
The other pregnant woman, who is not related to the first patient, also traveled to Central America. When she returned to Garland, she was tested for the Zika virus which resulted positive. However, the CDC has not confirmed that second test result. http://www.fox4news.com/news/143476049-story
-
Chessher says a pregnant woman from Garland traveled to a Central America sometime in late March. When she returned to North Texas, she went to her doctor and was tested for the Zika virus. Since the test came back positive, it was automatically sent to the CDC which conducts a second independent test. On Friday, the CDC confirmed the woman’s positive result. http://www.fox4news.com/news/143476049-story
-
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
-
On May 20, 2016, the Garland Health Department (GHD) received confirmation of the first case of Zika virus in Garland. Based on CDC guidance, the infected individual was tested for the Zika virus because she is pregnant and has recently traveled to a country with local transmission of Zika. There is no local threat of transmission in our area because the infected individual did not return to Garland during the disease phase when she was capable of transmitting Zika via mosquitoes. http://www.garlandtx.gov/civicax/filebank/blobdload.aspx?BlobID=26480
-
Health officials: 2 Maricopa County residents test positive for Zika virus Ken Alltucker, The Republic | azcentral.com8:50 p.m. MST May 20, 2016 0:20 1:43 Zika virus brings mosquito control into even sharper focus ZIKA VIRUSZika virus brings mosquito control into even sharper focus | 1:43The Zika virus brings mosquito control into even sharper focus. Maricopa County Vector Control searches for mosquitoes with even more interest from the public because of the Zika virus. Video by Tom Tingle/azcentral.com Tom Tingle/azcentral.com 1 of 7 ZIKA VIRUSPregnant or thinking about it? What you should know about Zika | 1:07The CDC reports hundreds of women in the United States and its territories have shown signs of infection from the Zika virus. This is what health officials want you to know so that you can defend yourself and your unborn baby. Florida Today 2 of 7 ZIKA VIRUSGuarding your home from the Zika virus | 1:10A USA TODAY motion graphic showing how to prevent your home from becoming a breeding ground for the Aedes mosquito, known to spread the Zika virus. Source: National Environmental Health Association Ramon Padilla Berna Elibuyuk and Liz Szabo, USA TODAY 3 of 7 ZIKA VIRUS5 things you may not know about the Zika virus | 1:04The CDC announced that the Zika virus may be 'scarier than we initially thought,' saying the mosquito-borne virus could be linked to more birth defects than previously believed. 4 of 7 ZIKA VIRUSCDC: Zika virus scarier than we thought | 1:36The Centers for Disease Control and Prevention said Puerto Rico could see "hundreds of thousands of cases of Zika virus." Officials also said the rest of the country needs to be prepared for possible outbreaks. (April 11) AP 5 of 7 ZIKA VIRUSFirst Zika case confirmed in Arizona | 0:44A woman from Maricopa County was confirmed to have contracted the Zika virus, the Arizona Department of Health Services announced Monday.The woman had traveled outside of the United States to an area affected with Zika and later developed symptoms o Wochit 6 of 7 ZIKA VIRUS6 Things To Know About Zika Virus | 2:39CDC Director Dr. Tom Frieden answers questions about the Zika virus and new guidelines issued by the health agency on Friday. (Feb. 5) AP 7 of 7Next VideoZika virus brings mosquito control into even sharper focusPregnant or thinking about it? What you should know about ZikaGuarding your home from the Zika virus5 things you may not know about the Zika virusCDC: Zika virus scarier than we thoughtFirst Zika case confirmed in Arizona6 Things To Know About Zika Virus The man and woman, both young adults, are the second and third confirmed Zika infections among Arizona residents who traveled to nations where the Zika virus is circulating.(Photo: LUIS ROBAYO/AFP-Getty Images) STORY HIGHLIGHTSA man and woman from Maricopa County who traveled to Latin America now test positive for Zika virusHealthy adults may not know they have the virus, which is transmitted by mosquito bites or sexual contactSymptoms can include fever, rash, joint pain or conjunctivitisTwo Maricopa County residents who recently traveled to Latin America have tested positive for the Zika virus, Arizona health officials said Friday. The man and woman are the second and third confirmed Zika infections among Arizona residents who traveled to nations where the virus is circulating. The latest people infected are both young adults, said Dr. Cara Christ, director of the Arizona Department of Health Services. Healthy adults may not even know they are infected with the virus, which is mostly transmitted by mosquito bites but also has been spread through sexual contact. Symptoms include fever, rash, joint pain or conjunctivitis. Pregnant women can pass the virus to a baby during pregnancy or birth. The virus can cause abnormally small brains in babies, a condition called microcephaly, or other brain defects. State health officials would not say whether the Maricopa County woman is pregnant, citing patient confidentiality. The Centers for Disease Control and Prevention said it is monitoring 157 women with confirmed or suspected Zika virus infections in 50 states and the District of Columbia. Another 122 pregnant women with confirmed or suspected infections are being monitored in U.S. territories. Christ said state and county health and environmental officials will work to identify any mosquito breeding sites at or near the homes of the two Maricopa County residents. No case has been transmitted by mosquito bite in the U.S., but Arizona and other regions have the type of mosquito that can carry the virus. "We don't have Zika in our mosquito population," Christ said. "The goal is to keep it out of our mosquito population." http://www.azcentral.com/story/news/local/phoenix/2016/05/20/maricopa-county-residents-test-positive-zika-virus/84671906/
-
Two Asymptomatic Pregnant Zika Cases In Washington State
niman replied to niman's topic in Washington
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ -
Two Asymptomatic Pregnant Zika Cases In Washington State
niman replied to niman's topic in Washington
Two pregnant Washington women test positive for Zika virusBY MATT MARKOVICH FRIDAY, MAY 20TH 2016 KOMO2 sharestweet now! SEATTLE -- Two pregnant Washington state women have tested positive for the Zika virus, state health officials revealed on Friday. The women will now join a new registry set up by the Centers for Disease Control to track pregnant women infected by the mosquito borne virus. Doctors at a press conference at Harborview Medical Center said they were not sure how the virus might affect the women's pregnancies. The virus has been linked to birth defects such as microcephaly. Senator Patty Murray brokered a $1.1 billion funding bill for Zika research and expanded testing that passed the Senate on Thursday. "I will tell you as a mother and an grandmother, I know one of the scariest questions an expecting parent can ask is, is my baby ok," said Murray. But Murray and House democrats are upset by a House republican bill that would cut the amount requested by two-thirds and move funds earmarked to combat Ebola to fund Zika research. "We can't be borrowing money from other critical resources and that's what's happening right now," said Representative Susan Del Bene, a Democrat who represents Washington's 1st district. "We've got to make that fight." Money in the Senate proposal could go to fund in-state testing for Zika at the state's public health lab in Shoreline. "So think about your loved one who's worried about a pregnancy, whether the baby has been affected and they have to wait three weeks for that answer," said Dr. Scott Lindquist, Washington's State Epidemiologist. "That is unacceptable" -
SEATTLE -- Two pregnant Washington state women have tested positive for the Zika virus, state health officials revealed on Friday. The women will now join a new registry set up by the Centers for Disease Control to track pregnant women infected by the mosquito borne virus. http://komonews.com/news/local/two-pregnant-washington-women-test-positive-for-zika-virus
-
Map update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
-
As of May 19, 201614 confirmed travel-related Zika cases in Georgia (all non-pregnant)
-
Zika Virus Update: Last Update: DC Human Cases Related to International TravelLocally Acquired Mosquito Borne CasesDaily (5 pm EST) 4 0
-
New DC tally page http://doh.dc.gov/publication/zika-virus-information
-
Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
-
May 20, 2016 - Texas Reports Data to CDC’s National Zika Pregnancy Registry The CDC began publicly reporting the number of pregnant women who may be affected by Zika virus in the United States. The newly released numbers are based on a broader definition from the CDC and its effort to more fully communicate the potential impact on pregnant women nationally. The Zika situation in Texas has not changed, though Texas is now providing Zika pregnancy data in a new way. Texas has reported to the CDC one confirmed case of Zika in a pregnant woman who traveled abroad to an area with Zika transmission. There have been 12 additional pregnancies in Texas with laboratory evidence of Zika infection since tracking and testing for Zika began, but all of those 12 have come back inconclusive. The registry aims to cast a wider net – beyond confirmed Zika cases – to track and follow pregnancies that may have been impacted by Zika. States are reporting confirmed cases but also the number of pregnancies that can’t be confirmed to be Zika-infected but have some lab indication of a flavivirus infection. Flaviviruses are known to cross-react during confirmatory testing, making it difficult to determine if the person was infected with Zika or some other flavivirus. Who Texas Counts for the CDC Registry Any pregnant women in Texas whose testing for Zika virus infection yielded positive or inconclusive test results, regardless of whether the woman has symptoms. Who Texas Counts as Zika Pregnancy Case To be reported as a Zika pregnancy case, the pregnant woman has to have had a rash or fever plus at least one other symptom, and also have a positive Zika-specified test result. Note: Pregnancy Registry counts will be updated weekly. No other details will be provided about Texas pregnancies reported to the CDC due to privacy concerns and that it is not warranted from a public health standpoint.
-
Zika Virus – May 20, 2016. Texas has had 36 confirmed cases of Zika virus disease. Of those, 35 were in travelers who were infected abroad and diagnosed after they returned home; one of those travelers was a pregnant woman. One case involved a Dallas County resident who had sexual contact with someone who acquired the Zika infection while traveling abroad. Case counts by county: Bexar – 3 Collin – 1 Dallas – 6 Denton – 2 Fort Bend – 2 Grayson – 1Harris – 13 Tarrant – 3 Travis – 2 Val Verde – 1 Williamson – 1 Wise – 1 Note: Zika case data for Texas will be updated weekdays by 11 a.m.
-
Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome1852518525100%0.0100%KX253996.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds1852518525100%0.0100%KU955589.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds1852018520100%0.099%KX185891.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds1852018520100%0.099%KU963796.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1851618516100%0.099%KU820899.2Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome1851118511100%0.099%KX117076.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds1839018390100%0.099%KU866423.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1839018390100%0.099%KJ776791.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome1834518345100%0.099%KU509998.3Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome1832718327100%0.099%KX051563.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds1832118321100%0.099%KU991811.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1832118321100%0.099%KU321639.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1831218312100%0.099%KU729218.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1831218312100%0.099%KU707826.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1831218312100%0.099%KU365779.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome1830918309100%0.099%KX197192.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome1830018300100%0.099%KX198135.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome1830018300100%0.099%KU926309.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1830018300100%0.099%KU501217.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1830018300100%0.099%KU365780.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome1829418294100%0.099%KU940228.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1829418294100%0.099%KU647676.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1829418294100%0.099%KU501216.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1829418294100%0.099%KU365777.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome1829118291100%0.099%KX247646.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome1829118291100%0.099%KX156776.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome182871828799%0.099%KU497555.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome1828518285100%0.099%KX156774.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1828518285100%0.099%KU729217.2Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1828518285100%0.099%KU527068.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds1828218282100%0.099%KX247632.1Select seq gb|KU820897.2|Zika virus isolate FLR polyprotein gene, complete cds1828218282100%0.099%KU820897.2Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome1828218282100%0.099%KX156775.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome1828218282100%0.099%KX087102.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1828218282100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1828218282100%0.099%KU312312.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome1827618276100%0.099%KU922960.1Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds1827318273100%0.099%KU937936.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome1827318273100%0.099%KU926310.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome1827318273100%0.099%KU922923.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1827318273100%0.099%KU501215.1Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome1826718267100%0.099%KX087101.2Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome1826718267100%0.099%KU870645.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome1826418264100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome1826218262100%0.099%KU853012.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds1825418254100%0.099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds1825418254100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1825418254100%0.099%KU761564.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds1824918249100%0.099%KX056898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds1824918249100%0.099%KU955590.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome182001820099%0.099%KU940224.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1810518105100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1805118051100%0.099%KU681081.3Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome1775317753100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177531775399%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds176881768898%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1760717607100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1744317443100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164331643399%0.095%HQ234499.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1328613286100%0.089%KU720415.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds132811328199%0.089%HQ234498.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1327013270100%0.089%KF383115.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1326813268100%0.089%KF383119.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1326613266100%0.089%KF268949.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1326613266100%0.089%DQ859059.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome1326313263100%0.089%KU955595.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1326313263100%0.089%LC002520.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome1325413254100%0.089%KU955592.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1324813248100%0.089%KF268948.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds1324713247100%0.089%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome1324713247100%0.089%KU955594.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome1324113724100%0.089%KX198134.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1324113241100%0.089%KF268950.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome1323613236100%0.089%KU955591.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132141321499%0.089%HQ234501.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1321213212100%0.089%KF383116.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1320513205100%0.089%AY632535.2Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1314213142100%0.088%KF383117.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds1312213224100%0.088%KU963574.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131201312099%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1295113019100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128641286497%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108591085997%0.084%KF383120.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome50341439587%0.095%KU940227.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4962496227%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4935493527%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4637463725%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4628462825%0.099%KU646827.1Select seq gb|KX101060.1|Zika virus isolate Bahia02, partial genome41991325875%0.095%KX101060.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3431343118%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3202320217%0.099%KU740199.1Select seq gb|KX101066.1|Zika virus isolate Bahia01, partial genome31131306174%0.099%KX101066.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2695269514%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2042204211%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2008200811%0.099%KU179098.1Select seq gb|KX101061.1|Zika virus isolate Bahia03, partial genome18311385178%0.099%KX101061.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds182418249%0.099%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds182418249%0.099%KX059013.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds173717379%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds173617369%0.099%KM078961.1
-
LOCUS KX253996 10807 bp RNA linear VRL 18-MAY-2016 DEFINITION Zika virus isolate ZKC2/2016, complete genome. ACCESSION KX253996 VERSION KX253996.1 GI:1029032430 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10807) AUTHORS Wu,D., Lin,L., Zhang,Y., Li,J., Liang,M. and Li,D. TITLE Direct Submission JOURNAL Submitted (18-MAY-2016) Center for Diseases Control and Prevention of Guangdong Province; National Institute of Viral Disease Control and Prevention, China COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. version 8.5.1 Sequencing Technology :: IonTorrent; 5' RACE and 3' RACE (Sanger dideoxy sequencing) ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10807 /organism="Zika virus" /mol_type="genomic RNA" /isolate="ZKC2/2016" /host="Homo sapiens" /db_xref="taxon:64320" /country="China" /collection_date="16-Feb-2016" /note="passage history: suckling mouse 2 times,Vero cells 1 time; genotype: Asian" CDS 108..10379 /codon_start=1 /product="polyprotein" /protein_id="ANF16414.1" /db_xref="GI:1029032431" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTNVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGARRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFQAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPMLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRSMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVRPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 agttgttgat ctgtgtgaat cagactgcga cagttcgagt ttgaagcgaa agctagcaac 61 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa 121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga 181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca 241 ggatggtctt ggcgattcta gccttcttga gattcacggc aatcaagcca tcactgggtc 301 tcatcaatag atggggttca gtggggaaaa aagaggctat ggaaataata aagaagttca 361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag 421 gcgcagatac taatgtcgga attgttggcc tcctgctgac cacagctatg gcagcggagg 481 tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct ggggaggcca 541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac 601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag 661 atgacgtcga ttgttggtgc aacacgacgt caacttgggt tgtgtacgga acctgccatc 721 acaaaaaagg tgaagcacgg agatctagaa gagctgtgac gctcccctcc cattccacta 781 ggaagctgca aacgcggtcg caaacttggt tggaatcaag agaatacaca aagcacttga 841 ttagagtcga aaattggata ttcaggaacc ctggcttcgc gttagcagca gctgccatcg 901 cttggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga 961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta 1021 tgtcaggtgg gacttgggtt gatgttgtct tggaacatgg aggttgtgtc accgtaatgg 1081 cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc aacatggcgg 1141 aggtaagatc ctactgctat gaggcatcaa tatcggacat ggcttcggac agccgctgcc 1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtc tgcaaaagaa 1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga 1321 catgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc 1381 tggagtaccg gataatgctg tcagttcatg gctcccagca cagtgggatg atcgttaatg 1441 acacaggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa 1501 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag 1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggttcaca 1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac 1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg 1741 tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga gctctggagg 1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa 1861 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca 1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga 1981 cagatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact ctgaccccag 2041 ttgggaggct gataaccgct aaccccgtaa tcactgaaag cactgagaac tccaagatga 2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga 2161 agatcaccca ccactggcac aggagtggca gcaccattgg aaaagcattt gaagccactg 2221 tgagaggtgc caggagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg 2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat 2341 cattgtttgg aggaatgtcc tggttctcac aaattctcat tggaacgttg ctgatgtggt 2401 tgggtctgaa cacaaagaat ggatctattt cccttatgtg cttggcctta gggggagtgt 2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga 2521 aggagacgag atgcggtaca ggggtgttcg tctataacga cgttgaagcc tggagggaca 2581 ggtacaagta ccatcctgac tccccccgta gattggcagc agcagtcaag caagcctggg 2641 aagatggtat ctgtgggatc tcctctgttt caagaatgga aaacatcatg tggagatcag 2701 tagaagggga gctcaacgca atcctggaag agaatggagt tcaactgacg gtcgttgtgg 2761 gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct gtgaacgagc 2821 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt cagagcagca aagacaaata 2881 acagctttgt cgtggatggt gacacactga aggaatgccc actcaaacat agagcatgga 2941 acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc tggctcaagg 3001 ttagagaaga ttattcatta gagtgtgatc cagccgttat tggaacagct gttaagggaa 3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga 3121 ggctgaagag ggcccatctg atcgagatga aaacatgtga atggccaaag tcccacacat 3181 tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttta gctgggccac 3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg 3301 aagagcttga aattcggttt gaggaatgcc caggcaccaa ggtccacgtg gaggaaacat 3361 gtggaacaag aggaccatct ctgagatcaa ccactgcaag cggaagggtg atcgaggaat 3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttcca ggctaaagat ggctgttggt 3481 atggaatgga gataaggccc aggaaagaac cagaaagtaa cttagtaagg tcaatggtga 3541 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca 3601 tggtgcagga agggctgaag aagagaatga ccacaaagat catcataagc acatcaatgg 3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa 3721 ttttgatggg tgccaccttc gcggaaatga acactggagg agatgtagct catctggcgc 3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc tttcatcttc agagctaatt 3841 ggacaccccg tgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa actgcgatct 3901 ccgccttgga aggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa 3961 tacgagcgat ggttgttcca cgcactgata acatcacctt ggcaatcctg gctgctctga 4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg 4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca 4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt 4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc 4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg 4321 ccgcggtcgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca 4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc 4441 ggcttgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc 4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag 4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactggaaaa aggagtggag 4621 ctctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt 4681 acagagtgat gactcgtaga ctgctaggtt caacacaagt tggagtggga gttatgcaag 4741 agggggtctt tcacaccatg tggcacgtca caaaaggatc cgcgctgaga agcggtgaag 4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat 4861 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg 4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca 4981 ttggagcggt tgcgctggat tacccagcag gaacttcagg atctccaatc ctagacaagt 5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg agttatgtta 5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga 5161 tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg aaaaccagga 5221 gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact gtgatcttag 5281 ctccaaccag ggttgtcgct gccgaaatgg aggaagccct tagagggctt ccagtgcgtt 5341 atatgacaac agcagtcaat gtcacccact ctggaacaga aatcgtcgac ttaatgtgcc 5401 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtata 5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagagga tacatttcaa 5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc 5581 gtgacgcatt tccggactcc aactcaccaa ttatggacac cgaagtggaa gtcccagaga 5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtctggtttg 5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg 5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt 5821 gggactttgt cgtgacaact gacatttcag agatgggcgc caactttaaa gctgaccgtg 5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattctgg 5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga 6001 atcccaacaa acctggagat gagtatctgt atggaggtgg gtgcgcagag actgacgaag 6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc 6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca 6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg 6241 tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga agatggtgct 6301 ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag gtgtggacca 6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc 6421 acgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag 6481 tgatggaagc cttgggaaca ctgccaggac acatgacaga gagattccag gaagccattg 6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg 6601 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgc 6661 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg 6721 tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca gccagaattg 6781 catgtgtcct cattgttgtg ttcctattgc tggtggtgct catacctgag ccagaaaagc 6841 aaagatctcc ccaggacaac caaatggcaa tcatcatcat ggtagcagta ggtcttctgg 6901 gcttgattac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc 6961 taatgggaag gagagaggag ggggcaacca taggattctc aatggacatt gacctgcggc 7021 cagcctcagc ttgggccatc tacgctgcct tgacaacttt cattacccca gccgtccaac 7081 atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg caagctggag 7141 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc 7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtagcc atcattttgc 7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagctgcg cgtgctgccc 7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg 7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca 7441 tagcagtagc cgtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg 7501 gggccctgat cacagctgca acttccactt tgtgggaagg ctctccgaac aagtactgga 7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt 7621 ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag 7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct 7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca 7801 aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt 7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag 7921 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa 7981 aaggaggccc tggtcatgaa gaacccatgt tggtgcaaag ctatgggtgg aacatagtcc 8041 gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt 8101 gtgacatagg tgagtcatca tctagtcctg aagtggaaga agcacggacg ctcagagtcc 8161 tttccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt 8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag 8281 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag 8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg 8401 acgggcccag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg 8461 ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc attgaaagga 8521 tccgcagtga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg 8581 cttaccatgg aagctatgag gcccccacac aagggtcagc gtcctctcta ataaacgggg 8641 ttgtcaggct cctgtcaaaa ccctgggacg tggtgactgg agtcacagga atagccatga 8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc 8761 cagatcccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg ttgtggaaag 8821 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc aacaaggttc 8881 gtagcaatgc agcattaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg 8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga 9001 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg 9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc 9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag 9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtc 9241 gcataccagg aggaaggatg tatgcagatg acactgctgg ctgggacacc cgcatcagca 9301 ggtttgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg cacagggcct 9361 tggcattggc cataatcaag tacacatacc aaaacaaagt ggtaaaggtc cttagaccag 9421 ctgaaaaagg gaagacagtt atggacatta tttcgagaca agaccaaagg gggagcggac 9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggagta 9541 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag 9601 tgaccaactg gctgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag 9661 atgattgcgt tgtgaggcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg 9721 atatggggaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact 9781 gggaggaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt 9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag 9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc 9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg 10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat 10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc 10141 acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg ggaaaaaggg 10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca 10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag tacatggact 10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctgga gtgctgtaag 10381 caccaatctt agtgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc 10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg 10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca 10561 cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc tttaatctgg 10621 ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt agaggagacc 10681 ccccggaaaa cgcaaaacag catattgacg ctgggaaaga ccagagactc catgagtttc 10741 caccacgctg gccgccaggc acagatcgcc gaatagcggc ggccggtgtg gggaaatcca 10801 tgggtct