Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. Sequence map update https://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU
  2. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome370370100%4e-99100%KX253996.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome370370100%4e-99100%KX197192.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds370370100%4e-99100%KX185891.1Select seq gb|KU752544.1|Zika virus isolate PoHuZV469196 nonstructural protein 5 gene, partial cds370370100%4e-99100%KU752544.1Select seq gb|KX101064.1|Zika virus isolate Bahia11, partial genome370370100%4e-99100%KX101064.1Select seq gb|KX101060.1|Zika virus isolate Bahia02, partial genome370370100%4e-99100%KX101060.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome370370100%4e-99100%KX117076.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds370370100%4e-99100%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds370370100%4e-99100%KX059013.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome370370100%4e-99100%KX051563.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome370370100%4e-99100%KU509998.3Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds370370100%4e-99100%KU963796.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome370370100%4e-99100%KU940228.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome370370100%4e-99100%KU940227.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome370370100%4e-99100%KU940224.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds370370100%4e-99100%KU955589.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome370370100%4e-99100%KU926310.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome370370100%4e-99100%KU926309.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds370370100%4e-99100%KU866423.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome370370100%4e-99100%KU820899.2Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds370370100%4e-99100%KU729217.2Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds370370100%4e-99100%KU729218.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome370370100%4e-99100%KU744693.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome370370100%4e-99100%KU497555.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds370370100%4e-99100%KU647676.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome370370100%4e-99100%KU321639.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds370370100%4e-99100%KM078970.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds370370100%4e-99100%KM078961.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds370370100%4e-99100%KM078936.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds370370100%4e-99100%KM078933.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds370370100%4e-99100%KM078930.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds370370100%4e-99100%KM078929.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds370370100%4e-99100%KF993678.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds370370100%4e-99100%KJ776791.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome36736799%5e-98100%KU527068.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds367367100%5e-9899%KM078971.1Select seq gb|KX262887.1|Zika virus isolate 103451, complete genome365365100%2e-9799%KX262887.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome365365100%2e-9799%KX247646.1Select seq gb|KU820897.2|Zika virus isolate FLR polyprotein gene, complete cds365365100%2e-9799%KU820897.2Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome365365100%2e-9799%KX198135.1Select seq gb|KU752545.1|Zika virus isolate PoHuZV472846 nonstructural protein 5 gene, partial cds365365100%2e-9799%KU752545.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome365365100%2e-9799%KX156776.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome365365100%2e-9799%KX156775.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome365365100%2e-9799%KX156774.1Select seq gb|KX101067.1|Zika virus isolate Bahia12, partial genome36536598%2e-97100%KX101067.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome365365100%2e-9799%KX087102.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds365365100%2e-9799%KU991811.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome365365100%2e-9799%KU870645.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome365365100%2e-9799%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome365365100%2e-9799%KU853012.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds365365100%2e-9799%KU179098.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome365365100%2e-9799%KU707826.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds365365100%2e-9799%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds365365100%2e-9799%KU501216.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds365365100%2e-9799%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds365365100%2e-9799%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds365365100%2e-9799%KU365777.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds361361100%2e-9699%KX247632.1Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome361361100%2e-9699%KX087101.2Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome361361100%2e-9699%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome361361100%2e-9699%KU922923.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds361361100%2e-9699%KU820898.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome361361100%2e-9699%KU681081.3Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome361361100%2e-9699%KU501215.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds361361100%2e-9699%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds361361100%2e-9699%KU312312.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds356356100%9e-9599%KX056898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds356356100%9e-9599%KU955590.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds356356100%9e-9599%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds356356100%9e-9599%KU761564.1Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds352352100%1e-9398%KU937936.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome352352100%1e-9398%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds352352100%1e-9398%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds347347100%5e-9298%EU545988.1Select seq gb|KF258813.1|Zika virus isolate Java non-structural protein 5 mRNA, partial cds34534598%2e-9198%KF258813.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome343343100%6e-9197%KU681082.3Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds32732788%4e-86100%KU556802.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds32232286%2e-84100%KU232300.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds32232286%2e-84100%KU232297.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds32232286%2e-84100%KU232292.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds32032086%7e-84100%KU232294.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds320320100%7e-8495%HQ234499.1Select seq gb|KU985087.1|Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds31631686%8e-8399%KU985087.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds31531584%3e-82100%KU232293.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds31531584%3e-82100%KU232290.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds31331384%1e-81100%KU232298.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds30930983%1e-80100%KU232296.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds30630682%1e-79100%KU232295.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds29829880%2e-77100%KU232289.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds29829880%2e-77100%KU232288.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds29729780%8e-77100%KU232299.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds29729780%8e-77100%KJ873160.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds29129180%3e-7599%KU232291.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome248248100%3e-6287%KX198134.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome248248100%3e-6287%KU955595.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome248248100%3e-6287%KU955592.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome248248100%3e-6287%KU955591.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds248248100%3e-6287%HQ234501.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds244244100%4e-6186%KF383117.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds244244100%4e-6186%KF383116.1
  3. LOCUS KU752544 205 bp RNA linear VRL 02-MAY-2016 DEFINITION Zika virus isolate PoHuZV469196 nonstructural protein 5 gene, partial cds. ACCESSION KU752544 VERSION KU752544.1 GI:1002634694 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 205) AUTHORS Ze-Ze,L., Prata,M.B., Teixeira,T., Marques,N., Mondragao,A., Fernandes,R., Saraiva da Cunha,J. and Alves,M.J. TITLE Zika virus infections imported from Brazil to Portugal, 2015 JOURNAL IDCases 4, 46-49 (2016) REFERENCE 2 (bases 1 to 205) AUTHORS Ze-Ze,L., Prata,M.B., Marques,N., Saraiva da Cunha,J. and Alves,M.J. TITLE Direct Submission JOURNAL Submitted (24-FEB-2016) Center for Vectors and Infectious Diseases Research (CEVDI), National Health Institute Doutor Ricardo Jorge, IP (INSA), Avenida Liberdade 5, Aguas de Moura 2965-575, Portugal COMMENT ##Assembly-Data-START## Assembly Method :: BioEdit v. 7.0.1 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..205 /organism="Zika virus" /mol_type="genomic RNA" /isolate="PoHuZV469196" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="Portugal" /collection_date="Nov-2015" /note="imported from Brazil"
  4. Sequence map update https://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU
  5. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU752545.1|Zika virus isolate PoHuZV472846 nonstructural protein 5 gene, partial cds370370100%4e-99100%KU752545.1Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome365365100%2e-9799%KX253996.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome365365100%2e-9799%KX197192.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds365365100%2e-9799%KX185891.1Select seq gb|KU752544.1|Zika virus isolate PoHuZV469196 nonstructural protein 5 gene, partial cds365365100%2e-9799%KU752544.1Select seq gb|KX101064.1|Zika virus isolate Bahia11, partial genome365365100%2e-9799%KX101064.1Select seq gb|KX101060.1|Zika virus isolate Bahia02, partial genome365365100%2e-9799%KX101060.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome365365100%2e-9799%KX117076.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds365365100%2e-9799%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds365365100%2e-9799%KX059013.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome365365100%2e-9799%KX051563.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome365365100%2e-9799%KU509998.3Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds365365100%2e-9799%KU963796.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome365365100%2e-9799%KU940228.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome365365100%2e-9799%KU940227.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome365365100%2e-9799%KU940224.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds365365100%2e-9799%KU955589.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome365365100%2e-9799%KU926310.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome365365100%2e-9799%KU926309.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds365365100%2e-9799%KU866423.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome365365100%2e-9799%KU820899.2Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds365365100%2e-9799%KU729217.2Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds365365100%2e-9799%KU729218.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome365365100%2e-9799%KU744693.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome365365100%2e-9799%KU497555.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds365365100%2e-9799%KU647676.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome365365100%2e-9799%KU321639.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds365365100%2e-9799%KM078970.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds365365100%2e-9799%KM078961.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds365365100%2e-9799%KM078936.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds365365100%2e-9799%KM078933.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds365365100%2e-9799%KM078930.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds365365100%2e-9799%KM078929.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds365365100%2e-9799%KF993678.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds365365100%2e-9799%KJ776791.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds363363100%6e-9799%KM078971.1Select seq gb|KX262887.1|Zika virus isolate 103451, complete genome361361100%2e-9699%KX262887.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome361361100%2e-9699%KX247646.1Select seq gb|KU820897.2|Zika virus isolate FLR polyprotein gene, complete cds361361100%2e-9699%KU820897.2Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome361361100%2e-9699%KX198135.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome361361100%2e-9699%KX156776.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome361361100%2e-9699%KX156775.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome361361100%2e-9699%KX156774.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome361361100%2e-9699%KX087102.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds361361100%2e-9699%KU991811.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome361361100%2e-9699%KU870645.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome361361100%2e-9699%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome361361100%2e-9699%KU853012.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds361361100%2e-9699%KU179098.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome361361100%2e-9699%KU707826.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome36136199%2e-9699%KU527068.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds361361100%2e-9699%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds361361100%2e-9699%KU501216.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds361361100%2e-9699%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds361361100%2e-9699%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds361361100%2e-9699%KU365777.1Select seq gb|KX101067.1|Zika virus isolate Bahia12, partial genome36036098%8e-9699%KX101067.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds356356100%9e-9599%KX247632.1Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome356356100%9e-9599%KX087101.2Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome356356100%9e-9599%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome356356100%9e-9599%KU922923.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds356356100%9e-9599%KU820898.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome356356100%9e-9599%KU681081.3Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome356356100%9e-9599%KU501215.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds356356100%9e-9599%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds356356100%9e-9599%KU312312.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds352352100%1e-9398%KX056898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds352352100%1e-9398%KU955590.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds352352100%1e-9398%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds352352100%1e-9398%KU761564.1Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds347347100%5e-9298%KU937936.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome347347100%5e-9298%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds347347100%5e-9298%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds343343100%6e-9197%EU545988.1Select seq gb|KF258813.1|Zika virus isolate Java non-structural protein 5 mRNA, partial cds34034098%7e-9098%KF258813.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome338338100%2e-8997%KU681082.3Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds32232288%2e-8499%KU556802.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds31631686%8e-8399%KU232300.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds31631686%8e-8399%KU232297.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds31631686%8e-8399%KU232292.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds316316100%8e-8394%HQ234499.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds31531586%3e-8299%KU232294.1Select seq gb|KU985087.1|Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds31331386%1e-8199%KU985087.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds30930984%1e-8099%KU232293.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds30930984%1e-8099%KU232290.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds30730784%4e-8099%KU232298.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds30430483%5e-7999%KU232296.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds30030082%6e-7899%KU232295.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds29529580%3e-7699%KU232291.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds29329380%9e-7699%KU232289.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds29329380%9e-7699%KU232288.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds29129180%3e-7599%KU232299.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds29129180%3e-7599%KJ873160.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds248248100%3e-6287%KF383117.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds248248100%3e-6287%KF383116.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds248248100%3e-6287%DQ859059.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome244244100%4e-6186%KX198134.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome244244100%4e-6186%KU955595.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome244244100%4e-6186%KU955592.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome244244100%4e-6186%KU955591.1
  6. LOCUS KU752545 205 bp RNA linear VRL 02-MAY-2016 DEFINITION Zika virus isolate PoHuZV472846 nonstructural protein 5 gene, partial cds. ACCESSION KU752545 VERSION KU752545.1 GI:1002634696 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 205) AUTHORS Ze-Ze,L., Prata,M.B., Teixeira,T., Marques,N., Mondragao,A., Fernandes,R., Saraiva da Cunha,J. and Alves,M.J. TITLE Zika virus infections imported from Brazil to Portugal, 2015 JOURNAL IDCases 4, 46-49 (2016) REFERENCE 2 (bases 1 to 205) AUTHORS Ze-Ze,L., Prata,M.B., Marques,N., Saraiva da Cunha,J. and Alves,M.J. TITLE Direct Submission JOURNAL Submitted (24-FEB-2016) Center for Vectors and Infectious Diseases Research (CEVDI), National Health Institute Doutor Ricardo Jorge, IP (INSA), Avenida Liberdade 5, Aguas de Moura 2965-575, Portugal COMMENT ##Assembly-Data-START## Assembly Method :: BioEdit v. 7.0.1 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..205 /organism="Zika virus" /mol_type="genomic RNA" /isolate="PoHuZV472846" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="Portugal" /collection_date="Dec-2015" /note="imported from Brazil" CDS <1..>205 /note="NS5" /codon_start=1 /product="nonstructural protein 5" /protein_id="AMN14622.1" /db_xref="GI:1002634697" /translation="WLGARFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEE MSRIPGGRMYADDTAGWDTRISRF" ORIGIN 1 tggctagggg ctagatttct agagttcgaa gcccttggat tcttgaacga ggatcactgg 61 atgggaagag agaactcagg aggtggtgtt gaagggctgg gattacaaag actcggatat 121 gtcctagaag agatgagtcg cataccagga ggaaggatgt atgcagatga cactgctggc 181 tgggacaccc gcatcagcag gtttg
  7. CEDVI has released partial Zika sequences from Portugal travelers returning from Brazil.
  8. Registration Date: 05/24/2016 18:05:40 the amended 05/24/2016 18:05:57 theREPORT CARD Microcephaly: Ministry of Health confirmed 1,434 cases in the countryThe Ministry of Health announced on Tuesday (24), the Report of Epidemiological microcephaly related to week 20 of this year, until 21 May. The new report confirms 1,434 cases of microcephaly and other nervous system disorders, suggestive of congenital infection throughout the country. The report gathers information sent weekly by state health departments. In total, they reported 7,623 suspected cases since the beginning of the investigation, in October 2015, and 3,257 remain under investigation. Other 2,932 were discarded because of normal tests, or because they have microcephaly and or malformations confirmed because no infectious or do not meet the case definition. The 1,434 confirmed cases in Brazil occurred in 517 municipalities located in 25 states of the federation. Of these cases, 208 were confirmed by specific laboratory criteria for Zika virus. The Ministry of Health, however, points out that this figure does not represent adequately the total number of cases related to the virus. The folder considers that there was infection Zika most of the mothers who had babies with a final diagnosis of microcephaly. In relation to deaths in the same period, there were 285 suspected deaths of microcephaly and / or alteration of the central nervous system after delivery or during pregnancy (miscarriage or stillbirth) in the country. Of these, 60 were confirmed to microcephaly and / or alteration of the central nervous system. Other 187 are still under investigation and 38 were discarded. The Ministry of Health says it is investigating all cases of microcephaly and other disorders of the central nervous system, informed by the states, and the possible relationship with the Zika virus and other congenital infections. Microcephaly may be caused by, various infectious agents beyond Zika as Syphilis, Toxoplasmosis, Other Infectious Agents, Rubella, Cytomegalovirus and Herpes Viral. The folder guides pregnant women adopt measures to reduce the presence of Aedes aegypti, the elimination of breeding, and protect themselves from mosquito exposure, keeping doors and windows closed or screened, wear pants and long sleeved shirts and use repellents allowed to pregnant women. Distribution of reported cases of microcephaly by UF until May 21, 2016 Regions and Federative Units Microcephaly cases and / or malformations suggestive of congenital infection Total accumulated 1of reported cases from 2015 to 2016 research confirmed 2.3 discarded 4 Brazil 3,257 1,434 2,932 7,623 Alagoas 69 70 155 294 Bahia 646 247 210 1,103 Ceará 210 102 174 486 Maranhão 77 126 54 257 Paraíba 313 129 439 881 Pernambuco 541 359 1,068 1,968 Piauí 15 82 70 167 large northern river 264 108 53 425 Sergipe 142 50 39 231 Northeast 2,277 1,273 2,262 5,812 Holy Spirit 86 11 45 142 Minas Gerais 54 3 55 112 Rio de Janeiro 271 61 114 446 Sao Paulo 186 8 112 306 Southeast region 597 83 326 1,006 Acre 21 0 17 38 Amapá two 7 1 10 Amazon 11 4 5 20 For 29 1 0 30 Rondônia 4 4 7 15 Roraima 9 8 7 24 Tocantins 96 8 33 137 North region 172 32 70 274 Federal district two 5 34 41 Goiás 68 14 52 134 Mato Grosso 109 15 93 217 Mato Grosso do Sul two two 14 18 Midwest region 181 36 193 410 Paraná 6 4 27 37 Santa Catarina 1 1 4 6 Rio Grande do Sul 23 5 50 78 South region 30 10 81 121 Source: Health Departments of the States and the Federal District (updated data until 05/21/2016). 1. Cumulative number of reported cases that met the definition of previous operating case (33 cm), and the definitions adopted in Surveillance Protocol (from 12/09/2015) that defined the Head Circumference 32 cm for newborns to 37 or more weeks of gestation and other protocol definitions. 2. Present typical changes: indicative of congenital infection, such as intracranial calcifications, dilation of cerebral ventricles or changes in posterior fossa and other clinical signs observed by any imaging method or identification of Zika virus in laboratory tests. 3. 208 cases were confirmed by specific laboratory criteria for Zika virus (PCR and serology technique). 4. Discarded have normal exams by presenting microcephaly and / or congenital malformations confirmed by non - infectious causes or does not meet the case definitions. As reported by the Epidemiological Surveillance Center "Prof. Alexandre Vranjac ", the State Secretary of Health of São Paulo 186 cases are under investigation for congenital infection. Of these, 40 are possibly associated with infection by Zika virus, but have not yet been finalized investigations.01 confirmed case of microcephaly Virus Zika in newborn with suspected infection site in another UF.Agency HealthCare to the press (61) 3315-3580 http://portalsaude.saude.gov.br/index.php/cidadao/principal/agencia-saude/23874-microcefalia-ministerio-da-saude-confirma-1-434-casos-no-pais
  9. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  10. Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  11. Map update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  12. May 24, 2016 DEPARTMENT OF HEALTH DAILY ZIKA UPDATE: TWO NEW CASES IN ST. JOHNS AND SEMINOLE COUNTIEShttp://www.floridahealth.gov/newsroom/2016/05/052416-zika-update.htmlContact:Communications [email protected](850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the Florida Department of Health will issue a Zika virus update each week day at 2 p.m. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. There are two new cases today with one in St. Johns and one in Seminole counties. Of the cases confirmed in Florida, four cases are still exhibiting symptoms. According to CDC, symptoms associated with the Zika virus last between seven to 10 days. CDC recommends that women who are pregnant or thinking of becoming pregnant postpone travel to Zika affected areas.According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms since January. The total number of pregnant women who have been monitored is 36, with 9 having met the previous CDC case definition. County Number of Cases (all travel related) Alachua 4 Brevard 3 Broward 17 Clay 2 Collier 1 Hillsborough 3 Lee 4 Martin 1 Miami-Dade 46 Orange 9 Osceola 5 Palm Beach 7 Pasco 1 Pinellas 4 Polk 3 Santa Rosa 1 Seminole 3 St. Johns 2 Volusia 2 Total cases not involving pregnant women 118 Cases involving pregnant women regardless of symptoms* 36 *Counties of pregnant women will not be shared. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 1,820 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. All cases are travel-associated. There have been no locally-acquired cases of Zika in Florida. For more information on the Zika virus, click here. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. More Information on DOH action on Zika: On Feb. 3, Governor Scott directed the State Surgeon General to issue a Declaration of Public Health Emergency for the counties of residents with travel-associated cases of Zika.There have been 19 counties included in the declaration– Alachua, Brevard, Broward, Clay, Collier, Hillsborough, Lee, Martin, Miami-Dade, Orange, Osceola, Palm Beach, Pasco, Pinellas, Polk, Santa Rosa, Seminole, St. Johns and Volusia – and will be updated as needed. DOH encourages Florida residents and visitors to protect themselves from all mosquito-borne illnesses by draining standing water; covering their skin with repellent and clothing; and covering windows with screens.DOH has a robust mosquito-borne illness surveillance system and is working with CDC, the Florida Department of Agriculture and Consumer Services and local county mosquito control boards to ensure that the proper precautions are being taken to protect Florida residents and visitors.On April 6, Governor Rick Scott and Interim State Surgeon General Dr. Celeste Philip hosted a conference call with Florida Mosquito Control Districts to discuss ongoing preparations to fight the possible spread of the Zika virus in Florida. There were 74 attendees on the call.On May 11, Governor Scott met with federal leaders on the importance of preparing for Zika as we would a hurricane. Governor Scott requested 5,000 Zika preparedness kits from HHS Secretary Sylvia Burwell as well as a plan from FEMA on how resources will be allocated to states in the event an emergency is declared.Florida currently has the capacity to test 6,257 people for active Zika virus and 1,942 for Zika antibodies.Federal Guidance on Zika: According to CDC, Zika illness is generally mild with a rash, fever and joint pain. CDC researchers have concluded that Zika virus is a cause of microcephaly and other birth defects.The FDA released guidance regarding donor screening, deferral and product management to reduce the risk of transfusion-transmission of Zika virus. Additional information is available on the FDA website here.CDC has put out guidance related to the sexual transmission of the Zika virus. This includes CDC recommendation that if you have traveled to a country with local transmission of Zika you should abstain from unprotected sex.Based on CDC guidance released Friday, DOH will now report pregnant women with evidence of Zika virus regardless of symptoms. Prior to Friday, CDC guidance was only to report cases of Zika if the pregnant women was symptomatic.For more information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and onFacebook. For more information about the Florida Department of Health, please visitwww.FloridaHealth.gov.
  13. County Number of Cases (all travel related) Alachua 4 Brevard 3 Broward 17 Clay 2 Collier 1 Hillsborough 3 Lee 4 Martin 1 Miami-Dade 46 Orange 9 Osceola 5 Palm Beach 7 Pasco 1 Pinellas 4 Polk 3 Santa Rosa 1 Seminole 3 St. Johns 2 Volusia 2 Total cases not involving pregnant women 118 Cases involving pregnant women regardless of symptoms* 36 *Counties of pregnant women will not be shared.
  14. CDC Official Says 'Thousands' May Have Arrived in US With ZikaBy GILLIAN MOHNEYMay 24, 2016, 1:31 PM ET Joe Raedle/Getty ImagesWATCH Dr. Fauci Says 'Forceful Preparation' Key to Combating Zika Spread28SHARES EmailFederal health officials today said they believe "thousands" of people may have contracted the Zika virus before returning to the U.S. as they remain concerned that the virus might start to have ongoing transmission in the U.S. Speaking at a panel at the Woodrow Wilson International Center for Scholars, Dr. Anne Schuchat, principal deputy director at the Centers for Disease Control and Prevention, said the Zika virus remains "pretty concerning" for experts as they learn how it affects pregnant women. "The reality is one bite, and if you’re pregnant, your baby might be harmed," Schuchat said at the panel today. "That’s a phenomenal problem." Common symptoms of the Zika virus include fever, rash, joint pain and conjunctivitis, according to the CDC. Approximately one in five people infected with the virus show symptoms. Severe complications from the virus that require hospitalization are rare, according to the CDC. The virus has also been linked to the serious birth defect microcephaly. The birth defect is characterized by a malformed or smaller head and brain, and can result in serious developmental delays. At today's panel government, health officials said they are concerned about local transmission of the virus if travelers spread the virus to mosquitoes in the U.S., which can then infect other people who have not traveled abroad where Zika transmission is ongoing. Schuchat said approximately 500 people in the U.S. were found to have likely been infected with Zika. However, since 80 percent of people with a Zika infection do not show symptoms, she estimates that thousands may have arrived in the U.S. unaware they were infected with the Zika virus and potentially able to start an outbreak through the mosquito population. She explained this number is especially concerning since local mosquito control has diminished in recent years. "We’re not starting in a good place. We used to have a lot stronger mosquito control and mosquito surveillance," said Schuchat. "We really have a patchwork nation around mosquito capacity. The local governments are really concerned." El Salvador Advises Women to Avoid Pregnancy for 2 Years Due to Zika Virus Outbreak Mosquito-Born Zika Virus Linked to Birth Defects Dr. Anthony Fauci, director of the National Institute of Allergy andInfectious Diseases at the National Institutes of Health, said at the panel that the Aedes aegypti mosquito, the main type of mosquito that spreads Zika and other diseases, is notoriously difficult to kill. He added that he expects to see some local transmission of the virus in the same way there were limited outbreaks of the Dengue virus and Chickungunya virus. "History has told us this is a really difficult mosquito to deal with," said Fauci, adding that a mosquito-based outbreak is far different from an outbreak that spreads from person to person. "It’s a whole new venue of transmission." http://abcnews.go.com/Health/cdc-official-thousands-arrived-us-zika/story?id=39332409
  15. The CDC and US state labs have reported over 600 lab confirmed symptomatic travelers who have entered the US. Since the number of asymptomatic case may be five fold higher, the confirmed cases suggest thousands of Zika infected travelers have entered the US.
  16. SummaryWhat is already known about this topic? Zika virus infection during pregnancy causes microcephaly and other serious brain abnormalities. However, the full range of outcomes of asymptomatic and symptomatic Zika virus infection during pregnancy are not yet well understood. What is added by this report? In February 2016, CDC, in collaboration with state, local, tribal, and territorial health departments, launched comprehensive surveillance systems to report and actively monitor pregnancies and congenital outcomes among symptomatic and asymptomatic women with laboratory evidence of possible Zika virus infection. As of May 12, 2016, there were 157 and 122 pregnant women with laboratory evidence of possible Zika virus infection residing in U.S. states and U.S. territories, respectively. What are the implications for public health practice? This report launches the weekly reporting of pregnant women with laboratory evidence of possible Zika virus infection in U.S. states and territories. Monitoring all pregnant women with possible Zika virus infection during pregnancy, whether asymptomatic or symptomatic, will enhance understanding of possible adverse outcomes and allow better estimates of the number of pregnancies at risk for adverse outcomes. This information will assist health care providers who counsel pregnant women and will facilitate planning services for affected families.
  17. Possible Zika Virus Infection Among Pregnant Women — United States and Territories, May 2016Early Release / May 20, 2016 / 65 Format:Select onePDF [166 KB]Recommend on FacebookTweetNews (76)Blogs (7)Twitter (315)Facebook (16)Google+ (4)Reddit (1)Regina M. Simeone, MPH1; Carrie K. Shapiro-Mendoza, PhD2; Dana Meaney-Delman, MD3; Emily E. Petersen, MD2; Romeo R. Galang, MD4,5; Titilope Oduyebo, MD2,4; Brenda Rivera-Garcia, DVM6; Miguel Valencia-Prado, MD7; Kimberly B. Newsome, MPH1; Janice Pérez-Padilla, MPH8; Tonya R. Williams, PhD9; Matthew Biggerstaff, MPH10; Denise J. Jamieson, MD2; Margaret A. Honein, PhD1; Zika and Pregnancy Working Group http://www.cdc.gov/mmwr/volumes/65/wr/mm6520e1.htm?s_cid=mm6520e1_w
  18. On May 20 the CDC announced the reporting of asymptomatic pregnant women in the United States and territories with laboratory evidence of Zika infection, including IgM without PRINT confirmation. The initial MMWR cited 157 pregnant cases in the United States with laboratory evidence of Zika infection, with an additional 122 in US territories, for a total of 279 cases.
  19. niman replied to niman's topic in Texas
    Zika Virus – May 24, 2016. Texas has had 36 confirmed cases of Zika virus disease. Of those, 35 were in travelers who were infected abroad and diagnosed after they returned home; one of those travelers was a pregnant woman. One case involved a Dallas County resident who had sexual contact with someone who acquired the Zika infection while traveling abroad. Case counts by county: Bexar – 3 Collin – 1 Dallas – 6 Denton – 2 Fort Bend – 2 Grayson – 1Harris – 13 Tarrant – 3 Travis – 2 Val Verde – 1 Williamson – 1 Wise – 1
  20. Top mosquito suspect found infected with ZikaBy Gretchen VogelMay. 23, 2016 , 5:15 PM The usual suspect has been caught, not red-handed but red-bellied. Since the beginning of the Zika virus outbreak in Brazil, health authorities and researchers have strongly suspected that the mosquito Aedes aegypti, known for spreading several deadly viruses, was also guilty of spreading Zika from one person to another. But direct evidence had been hard to find. Now, researchers in Rio de Janeiro, Brazil, report that they have found the Zika virus in wild-caught A.aegypti. The researchers did not find the virus in other mosquito species they captured in neighborhoods where Zika was spreading, which strengthens the case that A. aegypti is the main vector driving the outbreak. That mosquito species, which is ubiquitous in urban areas across Brazil and much of Latin America, is known to spread several closely related viruses, including dengue, chikungunya, and yellow fever. Researchers had confirmed that the species could be infected with Zika and that the virus could multiply and infect the mosquito’s saliva—a requirement for it being able to spread the virus. But no one in Latin America had found a wild-living specimen that was carrying the virus. Despite the hundreds of thousands of human cases, it’s not easy to find infected mosquitoes, explains Oliver Brady, an entomologist at the University of Oxford. “Finding the virus in a mosquito is extremely difficult,” he says. “They infect people and die before anyone shows up at the hospital” with disease symptoms. To try to nail down solid evidence against A. aegypti, Ricardo Lourenço-de-Oliveira, an entomologist at the Oswaldo Cruz Foundation (Fiocruz) in Rio de Janeiro and his colleagues collected mosquitoes from homes and streets in neighborhoods where people complaining of Zika symptoms lived. Over 10 months they collected more than 1500 mosquitoes, identified them, and tested them for the presence of Zika and other viruses. Nearly half were A. aegypti, and most of the rest were Culex quinquefasciatus, another common mosquito in urban Brazil that some have suspected of transmitting Zika. Roughly 5% of the collected mosquitoes were other species. A species called A. albopictus, which can also transmit Zika in the lab and has been found infected with the virus in Mexico, made up only about 2% of the catch, Lourenço-de-Oliveira says. That means it’s unlikely to be a major vector in urban areas, he says. The researchers pooled mosquitoes of the same species when they tested for viruses. They found Zika virus in three sets of A. aegypti mosquitoes, but none of the other species. The researchers plan to submit their results for publication once they have finished analyzing insects caught earlier this month, Lourenço-de-Oliveira says, but they announced their finding today because they wanted to let health authorities know as soon as possible. He and his colleagues are also examining whether any of the insects they caught were infected with dengue, chikungunya, or other viruses. The new findings do not rule out other mosquito species as possible vectors, but they do provide some reassurance that Zika is likely following the familiar patters seen in dengue and chikungunya outbreaks, says Philip McCall, an entomologist at the Liverpool School of Tropical Medicine un the United Kingdom. That suggests that large outbreaks are less likely outside the range of A. aegypti. If the virus were easily spread by Culex species or A. albopictus, the regions threatened by serious outbreaks would be much larger. How much A. albopictus is helping spread Zika is still an open question. It has been shown to be a Zika vector in Africa, but in Latin America it bites humans less frequently than A. aegypti does. Both A. albopictus and A. aegypti can transmit dengue in the lab, but in areas where A. albopictus lives but A. aegypti is lacking “you don’t have huge dengue outbreaks,” Brady notes. Posted in: HealthzikaDOI: 10.1126/science.aaf5743 Gretchen Vogel Email Gretchen Twitter
  21. Now, researchers in Rio de Janeiro, Brazil, report that they have found the Zika virus in wild-caught A.aegypti. The researchers did not find the virus in other mosquito species they captured in neighborhoods where Zika was spreading, which strengthens the case that A. aegypti is the main vector driving the outbreak. http://www.sciencemag.org/news/2016/05/top-mosquito-suspect-found-infected-zika
  22. Zika Virus Likely to Spread in U.S. ‘In the Next Month or So,’ Official SaysMelissa Chan @melissalchan 3:30 PM ET There are more than 500 cases of the Zika virus in the U.S. The Zika virus will likely begin spreading in the U.S. “in the next month or so,” a top health official said Sunday, highlighting the need for “forceful preparation.” Dr. Anthony Fauci, director of the National Institute of Allergy and Infectious Diseases, said the federal government needs to ensure any local outbreaks of the disease don’t spread widely. “We already have Zika in the United States. But it is travel-related,” Fauci said during an appearance on ABC’s This Week. “The concern is that we will have local transmission,” he added. “In other words, people who get infected in the United States, get bitten by a mosquito, but who have never left the continental United States. We fully expect that that will happen as we get to the more robust mosquito season in the next month or so.” “We need to make sure that those local outbreaks don’t become sustained and don’t become disseminated,” Fauci said. “That’s the reason why we need to have a very, very forceful preparation right now before that happens.” There are more than 500 travel-related cases of the Zika virus in the U.S., according to new figures from the Centers for Disease Control and Prevention. None of them were locally transmitted by mosquitoes. President Obama has asked Congress to allocate $1.9 billion in emergency funding to combat the spread of the virus. http://time.com/4345249/zika-virus-us-forceful-preparation/?xid=time_socialflow_twitter

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.