niman

Zika Virus Likely to Spread in U.S. ‘In the Next Month or So,’ Official SaysMelissa Chan @melissalchan 3:30 PM ET There are more than 500 cases of the Zika virus in the U.S. The Zika virus will likely begin spreading in the U.S. “in the next month or so,” a top health official said Sunday, highlighting the need for “forceful preparation.” Dr. Anthony Fauci, director of the National Institute of Allergy and Infectious Diseases, said the federal government needs to ensure any local outbreaks of the disease don’t spread widely. “We already have Zika in the United States. But it is travel-related,” Fauci said during an appearance on ABC’s This Week. “The concern is that we will have local transmission,” he added. “In other words, people who get infected in the United States, get bitten by a mosquito, but who have never left the continental United States. We fully expect that that will happen as we get to the more robust mosquito season in the next month or so.” “We need to make sure that those local outbreaks don’t become sustained and don’t become disseminated,” Fauci said. “That’s the reason why we need to have a very, very forceful preparation right now before that happens.” There are more than 500 travel-related cases of the Zika virus in the U.S., according to new figures from the Centers for Disease Control and Prevention. None of them were locally transmitted by mosquitoes. President Obama has asked Congress to allocate $1.9 billion in emergency funding to combat the spread of the virus. http://time.com/4345249/zika-virus-us-forceful-preparation/?xid=time_socialflow_twitter

Dr. Fauci: 'Forceful Preparation' Key to Combating Zika Spread in USBy ADRIENNE SALAZARMay 22, 2016, 1:33 PM ET William Volcov/Brazil Photo Press/LatinContent/Getty ImagesWATCH Dr. Fauci Says 'Forceful Preparation' Key to Combating Zika Spread11SHARES EmailWith “well over 500” cases of the Zika virus currently in the U.S., Dr. Anthony Fauci, director of the National Institute of Allergy andInfectious Diseases, said on “This Week” Sunday that “forceful preparation” will be critical to preventing further spread in the U.S. this summer. “We already have Zika in the United States. But it is travel related,” Dr. Fauci said on ABC’s “This Week.” “The concern is that we will have local transmission; in other words, people who get infected in the United States, get bitten by a mosquito, but who have never left the continental United States. We fully expect that that will happen as we get to the more robust mosquito season in the next month or so.” “We need to make sure that those local outbreaks don’t become sustained and don’t become disseminated,” Fauci added. “That’s the reason why we need to have a very, very forceful preparation right now before that happens.” The Centers for Disease Control released new figures on Friday showing that 157 pregnant women in the continental U.S. show evidence of possible Zika virus infection, all related to travel outside the U.S. President Obama has requested Congress to allocate $1.9 billion in emergency funding to combat the spread of the virus. “This is something that is solvable. It is not something that we have to panic about. But it is something that we have to take seriously,” President Obama said Friday after meeting with Fauci and other top advisers tackling Zika. “This is not something where we can build a wall to prevent – mosquitoes don't go through customs. To the extent that we're not handling this thing on the front end, we're going to have bigger problems on the back end.” A vaccine to combat Zika would be the main focus of government funding, according to Fauci, saying “We’re right now very aggressively developing the vaccine.” The Senate passed a $1.1 billion plan to combat Zika on Thursday, while House Republicans have advanced a separate $622 million bill that shifts previously established funds to combat the spread of Ebola. While efforts to prevent a widespread Ebola outbreak from West Africa to the U.S. were successful, Fauci called the idea of shifting those funds away from Ebola “very foolhardy.” “We may not see it in the front page of the newspapers… but we have the danger of cropping up of Ebola,” Fauci said. “We can't take our eye off the ball with Ebola. And that would really be robbing Peter to pay Paul and I think very foolhardy to do that.” Asked whether concerns about Zika were being overhyped, ABC News’ Chief Health and Medical Editor Dr. Richard Besser said greater vigilance is always needed when dealing with a new virus. “When there’s a new outbreak, a new infectious disease, you have to go all in, because you don’t know in the long run what it’s going to look like,” he said on “This Week.” Concern surrounding the Zika virus has even prompted some countries and athletes to consider skipping the 2016 Summer Olympics in Brazil, where the virus and potential birth defects were first spotlighted. Dr. Besser urged pregnant women to follow CDC guidelines to not to travel to Brazil and other impacted countries in South America, Central America and the Caribbean, and for those who plan on attending to be proactive to prevent mosquito bites.

With “well over 500” cases of the Zika virus currently in the U.S., Dr. Anthony Fauci, director of the National Institute of Allergy andInfectious Diseases, said on “This Week” Sunday that “forceful preparation” will be critical to preventing further spread in the U.S. this summer. “We already have Zika in the United States. But it is travel related,” Dr. Fauci said on ABC’s “This Week.” “The concern is that we will have local transmission; in other words, people who get infected in the United States, get bitten by a mosquito, but who have never left the continental United States. We fully expect that that will happen as we get to the more robust mosquito season in the next month or so.” http://abcnews.go.com/Politics/dr-fauci-forceful-preparation-key-combatting-zika-spread/story?id=39281419

Allegheny County Residents Approved for Zika Testing: 96 CDC Confirmed Cases: 3(as of May 23)

May 23, 2016 DEPARTMENT OF HEALTH DAILY ZIKA UPDATE: NO NEW CASES TODAY Contact:Communications [email protected](850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the Florida Department of Health will issue a Zika virus update each week day at 2 p.m. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. There are no new cases today. Of the cases confirmed in Florida, four cases are still exhibiting symptoms. According to CDC, symptoms associated with the Zika virus last between seven to 10 days. CDC recommends that women who are pregnant or thinking of becoming pregnant postpone travel to Zika affected areas. According to CDC guidance, providers should consider testing all pregnant women with a history of travel to a Zika affected area for the virus. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. County Number of Cases (all travel related) Alachua 4 Brevard 3 Broward 17 Clay 2 Collier 1 Hillsborough 3 Lee 4 Martin 1 Miami-Dade 46 Orange 9 Osceola 5 Palm Beach 7 Pasco 1 Pinellas 4 Polk 3 Santa Rosa 1 Seminole 2 St. Johns 1 Volusia 2 Cases involving pregnant women regardless of symptoms* 36 *Counties of pregnant women will not be shared. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 1,797 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. All cases are travel-associated. There have been no locally-acquired cases of Zika in Florida. For more information on the Zika virus, click here. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. More Information on DOH action on Zika: On Feb. 3, Governor Scott directed the State Surgeon General to issue a Declaration of Public Health Emergency for the counties of residents with travel-associated cases of Zika.There have been 19 counties included in the declaration– Alachua, Brevard, Broward, Clay, Collier, Hillsborough, Lee, Martin, Miami-Dade, Orange, Osceola, Palm Beach, Pasco, Pinellas, Polk, Santa Rosa, Seminole, St. Johns and Volusia – and will be updated as needed. DOH encourages Florida residents and visitors to protect themselves from all mosquito-borne illnesses by draining standing water; covering their skin with repellent and clothing; and covering windows with screens.DOH has a robust mosquito-borne illness surveillance system and is working with CDC, the Florida Department of Agriculture and Consumer Services and local county mosquito control boards to ensure that the proper precautions are being taken to protect Florida residents and visitors.On April 6, Governor Rick Scott and Interim State Surgeon General Dr. Celeste Philip hosted a conference call with Florida Mosquito Control Districts to discuss ongoing preparations to fight the possible spread of the Zika virus in Florida. There were 74 attendees on the call.On May 11, Governor Scott met with federal leaders on the importance of preparing for Zika as we would a hurricane. Governor Scott requested 5,000 Zika preparedness kits from HHS Secretary Sylvia Burwell as well as a plan from FEMA on how resources will be allocated to states in the event an emergency is declared.Florida currently has the capacity to test 6,262 people for active Zika virus and 1,942 for Zika antibodies.Federal Guidance on Zika: According to CDC, Zika illness is generally mild with a rash, fever and joint pain. CDC researchers have concluded that Zika virus is a cause of microcephaly and other birth defects.The FDA released guidance regarding donor screening, deferral and product management to reduce the risk of transfusion-transmission of Zika virus. Additional information is available on the FDA website here.CDC has put out guidance related to the sexual transmission of the Zika virus. This includes CDC recommendation that if you have traveled to a country with local transmission of Zika you should abstain from unprotected sex.Based on CDC guidance released Friday, DOH will now report pregnant women with evidence of Zika virus regardless of symptoms. Prior to Friday, CDC guidance was only to report cases of Zika if the pregnant women was symptomatic.For more information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov. http://www.floridahealth.gov/newsroom/2016/05/052316-zika-update.html

Pennsylvania Blood Tests Submitted for Zika TestingInformation updated Mondays at 2 p.m. CDC Confirmed Cases: 19Pending Test Results: 136

Zika Virus – May 23, 2016. Texas has had 36 confirmed cases of Zika virus disease. Of those, 35 were in travelers who were infected abroad and diagnosed after they returned home; one of those travelers was a pregnant woman. One case involved a Dallas County resident who had sexual contact with someone who acquired the Zika infection while traveling abroad. Case counts by county: Bexar – 3 Collin – 1 Dallas – 6 Denton – 2 Fort Bend – 2 Grayson – 1Harris – 13 Tarrant – 3 Travis – 2 Val Verde – 1 Williamson – 1 Wise – 1

Costa Rica confirms microcephaly birth, possible Zika linkPublished May 23, 2016 ReutersFacebook0 Twitter11 livefyre Email Print A pregnant woman cleans a street wet with water flowing from houses as health workers fumigate to help control the spread of the mosquito-borne Zika virus, in a slum of San Jose, Costa Rica February 3, 2016. REUTERS/Juan Carlos Ulate - RTX25CBN SAN JOSE – A Salvadoran woman suspected of being infected with the Zika virus has given birth in Costa Rica to a baby girl that tested positive for microcephaly, a rare birth defect, authorities said on Friday. Costa Rican health officials said the woman entered the country from her native El Salvador in April. More on this...Puerto Rico says confirmed Zika cases top 1,100CDC says 157 pregnant women in US test positive for ZikaUS drops Puerto Rico swim training over ZikaIf confirmed, the case would mark the sixth instance of microcephaly linked to a Zika infection in Central America and the first in Costa Rica. According to the World Health Organization, there is a strong scientific consensus that Zika can cause microcephaly as well as Guillain-Barre syndrome, a rare neurological disorder that can result in paralysis, though conclusive proof may take months or years. Zika-Linked Birth Defects in Infants with Microcephaly | HealthGroveMicrocephaly is defined by unusually small heads and can result in developmental problems. Brazil has confirmed about 1,200 cases of microcephaly and considers most of them to be related to Zika infections. http://www.foxnews.com/health/2016/05/23/costa-rica-confirms-microcephaly-birth-possible-zika-link.html

Fri May 20, 2016 10:07pm EDTRelated: WORLD, HEALTHCosta Rica confirms microcephaly birth, possible Zika link A Salvadoran woman suspected of being infected with the Zika virus has given birth in Costa Rica to a baby girl that tested positive for microcephaly, a rare birth defect, authorities said on Friday. Costa Rican health officials said the woman entered the country from her native El Salvador in April. If confirmed, the case would mark the sixth instance of microcephaly linked to a Zika infection in Central America and the first in Costa Rica. According to the World Health Organization, there is a strong scientific consensus that Zika can cause microcephaly as well as Guillain-Barre syndrome, a rare neurological disorder that can result in paralysis, though conclusive proof may take months or years. Microcephaly is defined by unusually small heads and can result in developmental problems. Brazil has confirmed about 1,200 cases of microcephaly and considers most of them to be related to Zika infections. http://www.reuters.com/article/us-health-zika-costarica-idUSKCN0YC02A (Reporting by Enrique Andres Pretel; Editing by Tom Brown)

Associated PressMay 21, 2016, at 2:46 p.m.+ More BOGOTA, Colombia (AP) — Colombian authorities are reporting that five babies have been born in the country this year with microcephaly associated with the rapidly spreading Zika virus. The National Health Institute also said Saturday that there have been 4,097 confirmed cases of Zika in pregnant women so far in 2016. The mosquito-borne virus has been linked to microcephaly, a condition where babies are born with abnormally small heads. It can also cause a potentially deadly temporary paralysis syndrome known as Guillain-Barre. Colombian authorities had previously reported two cases of Zika-associated microcephaly in April. http://www.usnews.com/news/world/articles/2016-05-21/colombia-5-cases-of-zika-associated-microcephaly-this-year

Zika virus currently circulating in Cabo Verde CIHAN | GENEVA - 23.05.2016 10:37:59 Sequencing of the virus in Cabo Verde by the Institut Pasteur in Dakar confirms that the Zika virus currently circulating in Cabo Verde is the same as the one circulating in theAmericas - the Asian type- and was most likely imported from Brazil. This is the first time that the Zika strain responsible for the outbreaks linked to neurological disorders and microcephaly has been detected in Africa. The World Health Organization (WHO) Regional Director for Africa, Dr. Matshidiso Moeti, said “over 7,000 suspected cases” have been reported so far in Cabo Verde so far. Moeti said that “now that this outbreak prone strain is present on the doorstep of the African continent” countries will “need to heighten and intensify their preparedness to detect and control any cases of Zika that may occur.” She said “WHO recommends that countries improve their surveillance, improve their laboratory capacity for diagnoses, communicate with the public so that people protect themselves from mosquito bites, and improve vector controls, so, try to kill all the mosquitoes.” According to the WHO, as a first step, these countries should heighten risk communication to pregnant women to raise awareness of complications associated with the Asian type of Zika virus and promote protection steps to avoid mosquito bites as well as sexual transmission. In addition, countries should increase their surveillance for Zika transmission and congenital malformations, such as microcephaly, as well as Guillain-Barré syndrome. The WHO does not recommend any travel or trade restrictions for Cabo Verde. Moeti said “it wouldn’t make sense to put restrictions on Cabo Verde because we see that globally sixty countries already have this virus circulating. I had the opportunity to study some travel figures to Cabo Verde from a number of countries, Europe, African countries, large numbers of people have been travelling to Cabo Verde in the period that this outbreak has been going on.” Activated since February 2016, WHO Zika Virus Disease Incident Management System inBrazzaville and at Headquarters will continue to review existing risk assessments, increase surveillance, and assess laboratory testing capacity and support community engagement and risk communications in priority countries. In addition, WHO and its partners will support the countries in the African region to step up preparedness efforts for early detection, confirmation and management of potential complications related to Zika infection. The response will build on investments in strengthened systems made in West Africa during the Ebola emergency. DESCRIPTION STORY: GENEVA / ZIKA CABO VERDE TRT: 02:53 SOURCE: WHO / IAEA RESTRICTIONS: NONE LANGUAGE: ENGLISH / NATS DATELINE: 20 MAY 2016, GENEVA, SWITZERLAND / FILE SHOTLIST 20 MAY 2016, GENEVA, SWITZERLAND 1. Various shots, Dr. Matshidiso Moeti and interviewer 2. SOUNDBITE (English) Matshidiso Moeti, WHO Regional Director for Africa: “The outbreak of Zika virus disease in Cabo Verde was first reported, first case was reported, in October last year and we have had over 7,000 suspected cases so far, but we are seeing that it has peaked and now we are getting weekly single digit cases reported, so that is good. However, we have had a piece of news that is of great concern, after genetic sequencing of the virus that is circulating in Cabo Verde; we have confirmation that it is the same strain that is causing the outbreak in South America.” FILE – IAEA - KALITY, ETHIOPIA 3. Various shots, scientists in lab handling mosquito samples 20 MAY 2016, GENEVA, SWITZERLAND 4. SOUNDBITE (English) Matshidiso Moeti, WHO Regional Director for Africa: “This Asian strain that is circulating in South America has caused neurological complications; it has caused cases of microcephaly in children, in new-born children, and also Guillain-Barre syndrome in adults, so this is additional aspect, and worry, because particularly with microcephaly, this is a lifelong issue for families and children and implications as far as this disease is concerned are now very different.” FILE – IAEA - SEIBERSDORF, AUSTRIA 5. Various shots, mosquito samples in lab 20 MAY 2016, GENEVA, SWITZERLAND 6. SOUNDBITE (English) Matshidiso Moeti, WHO Regional Director for Africa: “The vector that transmits this virus is present in many, many African countries, in fact in most African countries, so now that this outbreak prone strain is present on the doorstep of the African continent, this is of great concern to us in WHO, and to member states. It implies that they need to heighten and intensify their preparedness to detect and control any cases of Zika that may occur.” FILE – IAEA - SEIBERSDORF, AUSTRIA 7. Close up, scientist holding mosquito sample 20 MAY 2016, GENEVA, SWITZERLAND 8. SOUNDBITE (English) Matshidiso Moeti, WHO Regional Director for Africa: “WHO recommends that countries improve their surveillance, improve their laboratory capacity for diagnoses, communicate with the public so that people protect themselves from mosquito bites, and improve vector controls, so, try to kill all the mosquitoes.” FILE – IAEA - BRASILIA, BRAZIL 9. Wide shot, spraying of insecticide for vector control 20 MAY 2016, GENEVA, SWITZERLAND 10. SOUNDBITE (English) Matshidiso Moeti, WHO Regional Director for Africa: “It wouldn’t make sense to put restrictions on Cabo Verde because we see that globally sixty countries already have this virus circulating. I had the opportunity to study some travel figures to Cabo Verde from a number of countries, Europe, African countries, large numbers of people have been travelling to Cabo Verde in the period that this outbreak has been going on.” 11. Zoom out Moeti talking to interviewer DURATION: 02:53 https://www.cihan.com.tr/en/zika-virus-currently-circulating-cabo-verde-2077528.htm

Published Date: 05/22/2016 22:57:59 Subject: PRO / ESP> Zika - Colombia: microcephaly, cases update Archive Number: 20160522.4238489 ZIKA - COLOMBIA: microcephaly, CASE UPDATE ************************************************** **** A statement from ProMED-mail http://www.promedmail.org ProMED-mail is a program of the International Society for Infectious Diseases http://www.isid.org Date: May 22, 2016 Source: Globedia Peru http://pe.globedia.com/colombia-registra-casos-microcefalia-zika?utm_source=Boletín de noticias&utm_medium=link&utm_campaign=Boletín [Edited by Jaime Torres and Jorge González] Colombia recorded five cases of babies born with microcephaly associated Zika virus that has infected 83,889 people since October, according to the National Institute of Health (INS), whose epidemic is in decline phase. "We have confirmed five cases of microcephaly associated with Zika virus, 26 cases were dismissed and 50 cases are under consideration," said INS latest epidemiological bulletin published Saturday. Zika by the epidemic, which began in Colombia last October and authorities say will last until June, it is expected that about 300 cases of children born with microcephaly appear between May and September. This serious and irreversible malformation, which according to recent studies can be caused by Zika virus in fetuses, is characterized by an abnormally small skull in newborns and associated neurological deficits. Since the beginning of the epidemic have been reported 6,402 cases of Zika virus infection confirmed by laboratory and clinical suspects 77,487. Of these, 15,038 have affected pregnant. On the other hand, since December they have been reported 529 cases of neurological syndromes - mainly of Guillain-Barre syndrome - with a history compatible with Zika virus fever, found in the verification process. The zika spreads among humans through mosquito _Aedes aegypti_, present in 130 countries and also spread dengue, yellow fever and chikungunya. But recent studies claim that it can also be transmitted sexually among humans carriers of the virus, in some cases asymptomatic. There is no vaccine, treatment or rapid tests for this virus discovered in 1947 in Uganda diagnosis. According to WHO, at least a dozen laboratories and government agencies around the world are working on a vaccine whose marketing could take years. Reported by: Jaime R. Torres <[email protected]> - ProMED-ESP ----- ................. Jt, jg [While we all want the end not only of the epidemic zika, but many others, consider somewhat risky to try to predict the end of an epidemic putting tentative dates and deadlines. There are many variables involved; and, for example humans have no immediate control over the weather, which may favor vector breeding. You have to put all the effort in those areas where it can influence, such as preventive measures, starting with improving the socioeconomic conditions of many people and educating them, since such actions fighting not only the vector zika, dengue and chikungunya, but other infectious and communicable diseases. It is a subject, rather than political decision, common sense. Moderator Jorge González ] http://promedmail.org/direct.php?id=20160522.4238489

ColombiaSunday May 22, 2016 - 12:01 AMIn Colombia five cases of microcephaly are reported zikaZika by the epidemic, which began in Colombia last October and authorities say will last until next June, it is expected that some 300 cases of children born with microcephaly appear between May and September.Santander have been confirmed in 55 cases of zika, 3,189 cases are classified as suspected clinically and 347 remain unconfirmed.(Photo: Colprensa / LIBERAL VANGUARDIA)Colombia recorded five cases of newborns with microcephaly associated Zika virus that has infected 83,889 people since last October, according to the National Institutes of Health, INS, and where the epidemic is in decline phase."We have confirmed five cases of microcephaly associated with Zika virus, 26 cases were dismissed and 50 cases are in study"Said INS latest epidemiological bulletin published yesterday.In April this year had confirmed the first two cases of microcephaly in newborns associated with the Zika virus, registered in Cundinamarca and Norte de Santander.By the epidemic, which began in Colombia last October and according to the authorities will be extended until June this year, it is expected that some 300 cases of children born with microcephaly appear between May and September."However, the new estimates we project with the National Institute of Health realize that may occur between 95 and 300 cases of microcephaly, up to 380 cases of Guillain-Barre syndrome and a maximum of 200,000 clinical cases of the disease across the country, "said Deputy Minister of Public Health and Health Services Delivery Fernando Ruiz GómezThe illnessThis serious and irreversible malformation, which according to recent studies can be caused by Zika virus in fetuses, is characterized by an abnormally small skull size in newborns and associated neurological deficits.Since the beginning of the epidemic have been reported 6,402 cases of Zika virus infection confirmed by laboratory and clinical suspects 77,487. Of these, 15,038 have affected pregnant.On the other hand, since December they have been reported 529 cases of mainly neurological syndromes of Guillain-Barré syndrome, a history compatible with Zika virus fever, found in the verification process.The virusThe zika spreads among humans through mosquito Aedes aegypti, present in 130 countries and also spread dengue, yellow fever and chikungunya. But recent studies claim that it can also be transmitted sexually among humans carriers of the virus, in some cases asymptomatic.There is no vaccine, treatment or rapid tests for this virus discovered in 1947 in Uganda diagnosis. According to WHO, at least a dozen laboratories and government agencies around the world are working on a vaccine whose marketing could take years.Two of the five cases are santanderThe INS confirmed on April 22 the first two cases of microcephaly directly associated with the Zika virus in Santander. The report was presented by the Secretary of Health Department, Claudia Amaya Ayala, who reported that comes to babies with about three months infants whose mothers were diagnosed with zika during pregnancy, "not disclose the municipalities where such cases were reported. We want to protect the identity of children. " According to the official, in Santander currently being studied three cases of babies with microcephaly related zika in the region.http://www.vanguardia.com/colombia/359306-en-colombia-se-reportan-cinco-casos-de-microcefalia-por-zika

Colombian health officials report 5 cases of Zika-associated microcephalyPublished May 22, 2016Fox News Latino Brazil hit by mysterious rash of babies born with small heads More than 2,700 babies have been born in Brazil with microcephaly this year, up from fewer than 150 in 2014. Brazil's health officials say they're convinced the jump is linked to a sudden outbreak of the Zika virus that infected Pereira, though international experts caution it's far too early to be sure and note the condition can have many other causes. BOGOTA, COLOMBIA (AP) – Colombian authorities are reporting that five babies have been born in the country this year with microcephaly associated with the rapidly spreading Zika virus. The National Health Institute also said Saturday that there have been 4,097 confirmed cases of Zika in pregnant women so far in 2016. The mosquito-borne virus has been linked to microcephaly, a condition where babies are born with abnormally small heads. It can also cause a potentially deadly temporary paralysis syndrome known as Guillain-Barre. Colombian authorities had previously reported two cases of Zika-associated microcephaly in April. http://latino.foxnews.com/latino/health/2016/05/22/colombian-health-officials-report-5-cases-zika-associated-microcephaly/

Map Update https://www.google.com/maps/d/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ

Zika virus infects slew of pregnant women in NYCBy Susan Edelman May 22, 2016 | 6:57am Modal TriggerPhoto: APMORE ON:ZIKA VIRUS157 pregnant Americans have Zika Postpone the Olympics to save Zika babies: public health expert MLB relocates Puerto Rico series over Zika fears Schumer supports Obama's $1.9B plan to fight ZikaThe Zika virus has struck 86 New York City residents — including 14 pregnant women, according to the latest city Health Department tally. All the patients recovered, officials said, but it’s unknown whether the babies will suffer severe birth defects such as underdeveloped brains. “We closely monitor pregnant women through the duration of their pregnancy,” said spokeswoman Carolina Rodriquez. She would not say if any women had given birth. The city’s count comes as the Centers for Disease Control and Prevention said Friday that it is monitoring 279 pregnant women with likely Zika virus infections in US states and territories. So far, every NYC victim contracted the mosquito-borne virus after visiting other Zika-plagued countries, mostly in Central and South America. The 86 NYC cases are among 152 reported statewide to date. The total includes 50 males and 102 females, 23 of them pregnant. “The Zika virus is a disease of significant public health concern, with the greatest concern being the risk to the exposed fetus,” a state Health Department spokesperson said Friday. The state has been notified of four births by women who tested positive for Zika, but none resulted in microcephaly, the brain defect, said spokesman Jeffrey Hammond. http://nypost.com/2016/05/22/zika-virus-infects-dozens-of-pregnant-women-in-nyc/

Sequence Map Update https://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU

Sequence map update https://www.google.com/maps/d/u/0/edit?hl=en&mid=1XSxKe6FIecV8f33cQwyc7uylxeU

Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX262887.1|Zika virus isolate 103451, complete genome1852518525100%0.0100%KX262887.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1846218462100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1845618456100%0.099%KU501216.1Select seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds1845318453100%0.099%KX247632.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome1843818438100%0.099%KU870645.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome1841718417100%0.099%KU509998.3Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1841118411100%0.099%KJ776791.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds1840218402100%0.099%KU991811.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1840218402100%0.099%KU707826.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1840218402100%0.099%KU365779.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1840218402100%0.099%KU321639.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome1839918399100%0.099%KX051563.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome1839918399100%0.099%KU926309.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1839318393100%0.099%KU729218.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome1839018390100%0.099%KX197192.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1839018390100%0.099%KU365780.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1838418384100%0.099%KU365777.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome1838118381100%0.099%KX198135.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome1837518375100%0.099%KU940228.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1837518375100%0.099%KU647676.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome1837218372100%0.099%KX247646.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome1837218372100%0.099%KX156776.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1837218372100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1837218372100%0.099%KU312312.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome183681836899%0.099%KU497555.1Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome1836618366100%0.099%KX156774.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1836618366100%0.099%KU729217.2Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1836618366100%0.099%KU527068.1Select seq gb|KU820897.2|Zika virus isolate FLR polyprotein gene, complete cds1836318363100%0.099%KU820897.2Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds1836318363100%0.099%KU937936.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome1836318363100%0.099%KX156775.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome1836318363100%0.099%KX087102.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1836318363100%0.099%KU501215.1Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome1835718357100%0.099%KX087101.2Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome1835718357100%0.099%KU922960.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome1835418354100%0.099%KU926310.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome1835418354100%0.099%KU922923.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds1834518345100%0.099%KU820898.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome1834518345100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome1834318343100%0.099%KU853012.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds1833918339100%0.099%KX056898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds1833918339100%0.099%KU955590.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds1833618336100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1833618336100%0.099%KU761564.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome1832118321100%0.099%KX117076.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds1831218312100%0.099%KX185891.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds1831218312100%0.099%KU963796.1Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome1830918309100%0.099%KX253996.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds1830918309100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1830918309100%0.099%KU820899.2Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome182821828299%0.099%KU940224.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds1820018200100%0.099%KU866423.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1817718177100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1807818078100%0.099%KU681081.3Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome1777117771100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177711777199%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds177151771598%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1760717607100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1745217452100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164381643899%0.096%HQ234499.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1329013290100%0.089%KU720415.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds132841328499%0.089%HQ234498.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1326813268100%0.089%LC002520.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome1326313263100%0.089%KU955595.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1326113261100%0.089%KF383115.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1326113261100%0.089%KF268948.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1325713257100%0.089%KF268949.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome1325413254100%0.089%KU955592.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1325413254100%0.089%KF383119.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1325413254100%0.089%KF268950.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds1325213252100%0.089%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome1325213252100%0.089%KU955594.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome1324113729100%0.089%KX198134.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1323913239100%0.089%DQ859059.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome1323613236100%0.089%KU955591.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1322113221100%0.089%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132051320599%0.089%HQ234501.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1320013200100%0.089%AY632535.2Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1315113151100%0.088%KF383117.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds1313513242100%0.088%KU963574.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131351313599%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1294913017100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128521285297%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108441084497%0.084%KF383120.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome50431444787%0.095%KU940227.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4994499427%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4967496727%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4668466825%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4659465925%0.099%KU646827.1Select seq gb|KX101060.1|Zika virus isolate Bahia02, partial genome42311332375%0.095%KX101060.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3449344918%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3214321417%0.099%KU740199.1Select seq gb|KX101066.1|Zika virus isolate Bahia01, partial genome31281311774%0.099%KX101066.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2704270414%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2060206011%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2021202111%0.099%KU179098.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds183818389%0.099%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds183818389%0.099%KX059013.1Select seq gb|KX101061.1|Zika virus isolate Bahia03, partial genome18371391378%0.099%KX101061.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds174817489%0.099%KM078961.1

LOCUS KX262887 10806 bp RNA linear VRL 20-MAY-2016 DEFINITION Zika virus isolate 103451, complete genome. ACCESSION KX262887 VERSION KX262887.1 GI:1031621529 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10806) AUTHORS Lanciotti,R.S. TITLE Direct Submission JOURNAL Submitted (18-MAY-2016) Diagnostic & Reference Laboratory, Arbovirus Diseases Branch, Centers for Disease Control & Prevention, 3150 Rampart Road, Fort Collins, CO 80521, USA COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. 7 Sequencing Technology :: IonTorrent ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10806 /organism="Zika virus" /mol_type="genomic RNA" /isolate="103451" /host="Homo sapiens" /db_xref="taxon:64320" /country="Honduras" /collection_date="06-Jan-2016" CDS 107..10378 /note="C-prM/M-E-NS1-NS2a-NS2b-NS3-NS4A-NS4B-NS5" /codon_start=1 /product="polyprotein" /protein_id="ANG09399.1" /db_xref="GI:1031621530" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRAPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIL EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSCIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 gttgttgatc tgtgtgaatc agactgcgac agttcgagtt tgaagcgaaa gctagcaaca 61 gtatcaacag gttttatttt ggatttggaa acgagagttt ctggtcatga aaaacccaaa 121 aaagaaatcc ggaggattcc ggattgtcaa tatgctaaaa cgcggagtag cccgtgtgag 181 cccctttggg ggcttgaaga ggctgccagc cggacttctg ctgggtcatg ggcccatcag 241 gatggtcttg gcgattctag cctttttgag attcacggca atcaagccat cactgggtct 301 catcaataga tggggttcag tggggaaaaa agaggctatg gaaataataa agaagttcaa 361 gaaagatctg gctgccatgc tgagaataat caatgctagg aaggagaaga agagacgagg 421 cgcagatact agtgtcggaa ttgttggcct cctgctgacc acagctatgg cagcggaggt 481 cactagacgt gggagtgcat actatatgta cttggacaga aacgatgctg gggaggccat 541 atcttttcca accacattgg ggatgaataa gtgttatata cagatcatgg atcttggaca 601 catgtgtgat gccaccatga gctatgaatg ccctatgctg gatgaggggg tggaaccaga 661 tgacgtcgat tgttggtgca acacgacgtc aacttgggtt gtgtacggaa cctgccatca 721 caaaaaaggt gaagcacgga gatctagaag agctgtgacg ctcccctccc attccactag 781 gaagctgcaa acgcggtcgc aaacctggtt ggaatcaaga gaatacacaa agcacttgat 841 tagagtcgaa aattggatat tcaggaaccc tggcttcgcg ttagcagcag ctgccatcgc 901 ttggcttttg ggaagctcaa cgagccaaaa agtcatatac ttggtcatga tactgctgat 961 tgccccggca tacagcatca ggtgcatagg agtcagcaat agggactttg tggaaggtat 1021 gtcaggtggg acttgggttg atgttgtctt ggaacatgga ggttgtgtca ccgtaatggc 1081 acaggacaaa ccgactgtcg acatagagct ggttacaaca acagtcagca acatggcgga 1141 ggtaagatcc tactgctatg aggcatcaat atcagacatg gcttcggaca gccgctgccc 1201 aacacaaggt gaagcctacc ttgacaagca atcagacact caatatgtct gcaaaagaac 1261 gttagtggac agaggctggg gaaatggatg tggacttttt ggcaaaggga gcctggtgac 1321 atgcgctaag tttgcatgct ccaagaaaat gaccgggaag agcatccagc cagagaatct 1381 ggagtaccgg ataatgctgt cagttcatgg ctcccagcac agtgggatga tcgttaatga 1441 cacaggacat gaaactgatg agaatagagc gaaggttgag ataacgccca attcaccaag 1501 agccgaagcc accctggggg gttttggaag cctaggactt gattgtgaac cgaggacagg 1561 ccttgacttt tcagatttgt attacttgac tatgaataac aagcactggt tggttcacaa 1621 ggagtggttc cacgacattc cattaccttg gcacgctggg gcagacaccg gaactccaca 1681 ctggaacaac aaagaagcac tggtagagtt caaggacgca catgccaaaa ggcaaactgt 1741 cgtggttcta gggagtcaag aaggagcagt tcacacggcc cttgctggag ctctggaggc 1801 tgagatggat ggtgcaaagg gaaggctgtc ctctggccac ttgaaatgtc gcctgaaaat 1861 ggataaactt agattgaagg gcgtgtcata ctccttgtgt accgcagcgt tcacattcac 1921 caagatcccg gctgaaacac tgcacgggac agtcacagtg gaggtacagt acgcagggac 1981 agatggacct tgcaaggttc cagctcagat ggcggtggac atgcaaactc tgaccccagt 2041 tgggaggttg ataaccgcta accccgtaat cactgaaagc actgagaact ctaagatgat 2101 gctggaactt gatccaccat ttggggactc ttacattgtc ataggagtcg gggagaagaa 2161 gatcacccac cactggcaca ggagtggcag caccattgga aaagcatttg aagccactgt 2221 gagaggtgcc aagagaatgg cagtcttggg agacacagcc tgggactttg gatcagttgg 2281 aggcgctctc aactcattgg gcaagggcat ccatcaaatt tttggagcag ctttcaaatc 2341 attgtttgga ggaatgtcct ggttctcaca aattctcatt ggaacgttgc tgatgtggtt 2401 gggtctgaac acaaagaatg gatctatttc ccttatgtgc ttggccttag ggggagtgtt 2461 gatcttctta tccacagccg tctctgctga tgtggggtgc tcggtggact tctcaaagaa 2521 ggagacgaga tgcggtacag gggtgttcgt ctataacgac gttgaagcct ggagggacag 2581 gtacaagtac catcctgact ccccccgtag attggcagca gcagtcaagc aagcctggga 2641 agatggtatc tgcgggatct cctctgtttc aagaatggaa aacatcatgt ggagatcagt 2701 agaaggggag ctcaacgcaa tcctggaaga gaatggagtt caactgacgg tcgttgtggg 2761 atctgtaaaa aaccccatgt ggagagctcc acagagattg cccgtgcctg tgaacgagct 2821 gccccacggc tggaaggctt gggggaaatc gtacttcgtc agagcagcaa agacaaataa 2881 cagctttgtc gtggatggtg acacactgaa ggaatgccca ctcaaacata gagcatggaa 2941 cagctttctt gtggaggatc atgggttcgg ggtatttcac actagtgtct ggctcaaggt 3001 tagagaagat tattcattag agtgtgatcc agccgttatt ggaacagctg ttaagggaaa 3061 ggaggctgta cacagtgatc taggctactg gattgagagt gagaagaatg acacatggag 3121 gctgaagagg gcccatctga tcgagatgaa aacatgtgaa tggccaaagt cccacacatt 3181 gtggacagat ggaatagaag agagtgatct gatcataccc aagtctttag ctgggccact 3241 cagccatcac aataccagag agggctacag gacccaaatg aaagggccat ggcacagtga 3301 agagcttgaa attcggtttg aggaatgccc aggcactaag gtccacgtgg aggaaacatg 3361 tggaacaaga ggaccatctc tgagatcaac cactgcaagc ggaagggtga tcgaggaatg 3421 gtgctgcagg gagtgcacaa tgcccccact gtcgttccgg gctaaagatg gctgttggta 3481 tggaatggag ataaggccca ggaaagaacc agaaagcaac ttagtaaggt caatggtgac 3541 tgcaggatca actgatcaca tggatcactt ctcccttgga gtgcttgtga ttctgctcat 3601 ggtgcaggaa gggctaaaga agagaatgac cacaaagatc atcataagca catcaatggc 3661 agtgctggta gctatgatcc tgggaggatt ttcaatgagt gacctggcta agcttgcaat 3721 tttgatgggt gccaccttcg cggaaatgaa cactggagga gatgtagctc atctggcgct 3781 gatagcggca ttcaaagtca gaccagcgtt gctggtatct ttcatcttca gagctaattg 3841 gacaccccgt gaaagcatgc tactggcctt ggcctcgtgt cttttgcaaa ctgcgatctc 3901 cgccttggaa ggcgacctga tggttctcat caatggtttt gctttggcct ggttggcaat 3961 acgagcgatg gttgttccac gcactgataa catcaccttg gcaatcctgg ctgctctgac 4021 accactggcc cggggcacac tgcttgtggc gtggagagca ggccttgcta cttgcggggg 4081 gtttatgctc ctctctctga agggaaaagg cagtgtgaag aagaacttac catttgtcat 4141 ggccctggga ctaaccgctg tgaggctggt cgaccccatc aacgtggtgg gactgctgtt 4201 gctcacaagg agtgggaagc ggagctggcc ccctagcgaa gtactcacag ctgttggcct 4261 gatatgcgca ttggctggag ggttcgccaa ggcagatata gagatggctg ggcccatggc 4321 cgcggtcggt ctgctaattg tcagttacgt ggtctcagga aagagtgtgg acatgtacat 4381 tgaaagagca ggtgacatca catgggaaaa agatgcggaa gtcactggaa acagtccccg 4441 gctcgatgtg gcgctagatg agagtggtga tttctccctg gtggaggatg acggtccccc 4501 catgagagag atcatactca aggtggtcct gatgaccatc tgtggcatga acccaatagc 4561 catacccttc gcagctggag cgtggtacgt atacgtgaag actggaaaaa ggagtggtgc 4621 tctatgggat gtgcctgctc ccaaggaagt aaaaaagggg gagaccacag atggagtgta 4681 cagagtaatg actcgtagac tgctaggttc aacacaagtt ggagtgggag ttatgcaaga 4741 gggggtcttt cacactatgt ggcacgtcac aaaaggatcc gcactgagaa gcggtgaagg 4801 gagacttgat ccatactggg gagatgtcaa gcaggatctg gtgtcatact gtggtccatg 4861 gaagctagat gccgcctggg acgggcacag cgaggtgcag ctcttggccg tgccccccgg 4921 agagagagcg aggaacatcc agactctgcc cggaatattt aagacaaagg atggggacat 4981 tggagcggtt gcgctggatt acccagcagg aacttcagga tctccaatcc tagacaagtg 5041 tgggagagtg ataggacttt atggcaatgg ggtcgtgatc aaaaatggga gttatgttag 5101 tgccatcacc caagggagga gggaggaaga gactcctgtt gagtgcttcg agccttcgat 5161 gctgaagaag aagcagctaa ctgtcttaga cttacatcct ggagctggga aaaccaggag 5221 agttcttcct gaaatagtcc gtgaagccat aaaaacaaga ctccgtactg tgatcttagc 5281 tccaaccagg gttgtcgctg ctgaaatgga ggaggccctt agagggcttc cagtgcgtta 5341 tatgacaaca gcagtcaatg tcacccactc tggaacagaa atcgtcgact taatgtgcca 5401 tgccaccttc acttcacgtc tactacagcc aatcagagtc cccaactata atctgtatat 5461 tatggatgag gcccacttca cagatccctc aagtatagca gcaagaggat acatttcaac 5521 aagggttgag atgggcgagg cggctgccat cttcatgacc gccacgccac caggaacccg 5581 tgacgcattt ccggactcca actcaccaat tatggacacc gaagtggaag tcccagagag 5641 agcctggagc tcaggctttg attgggtgac ggatcattct ggaaaaacag tttggtttgt 5701 tccaagcgtg aggaacggca atgagatcgc agcttgtctg acaaaggctg gaaaacgggt 5761 catacagctc agcagaaaga cttttgagac agagttccag aaaacaaaac atcaagagtg 5821 ggactttgtc gtgacaactg acatttcaga gatgggcgcc aactttaaag ctgaccgtgt 5881 catagattcc aggagatgcc taaagccggt catacttgat ggcgagagag tcattctggc 5941 tggacccatg cctgtcacac atgccagcgc tgcccagagg agggggcgca taggcaggaa 6001 tcccaacaaa cctggagatg agtatctgta tggaggtggg tgcgcagaga ctgacgaaga 6061 ccatgcacac tggcttgaag caagaatgct ccttgacaat atttacctcc aagatggcct 6121 catagcctcg ctctatcgac ctgaggccga caaagtagca gccattgagg gagagttcaa 6181 gcttaggacg gagcaaagga agacctttgt ggaactcatg aaaagaggag atcttcctgt 6241 ttggctggcc tatcaggttg catctgccgg aataacctac acagatagaa gatggtgctt 6301 tgatggcacg accaacaaca ccatactgga agacagcgtg ccggcagagg tgtggaccag 6361 acacggagag aaaagagtgc tcaaaccgag gtggatggac gccagagttt gttcagatca 6421 tgcggccctg aagtcattca aggagtttgc cgctgggaaa agaggagcgg cttttggagt 6481 gatggaagcc ctgggaacac tgccaggaca catgacagag agattccagg aagccattga 6541 caacctcgct gtgctcatgc gggcagagac tggaagcagg ccttacaaag ccgcggcggc 6601 ccaattgccg gagaccctag agaccattat gcttttgggg ttgctgggaa cagtctcgct 6661 gggaatcttt ttcgtcttga tgaggaacaa gggcataggg aagatgggct ttggaatggt 6721 gacccttggg gccagtgcat ggctcatgtg gctctcggaa attgagccag ccagaattgc 6781 atgcgtcctc attgttgtgt tcctattgct ggtggtgctc atacctgagc cagaaaagca 6841 aagatctccc caggacaacc aaatggcaat catcatcatg gtagcagtag gtcttctggg 6901 cttgattacc gccaatgaac tcggatggtt ggagagaaca aagagtgacc taagccatct 6961 aatgggaagg agagaggagg gggcaaccat aggattctca atggacattg acctgcggcc 7021 agcctcagct tgggccatct atgctgcctt gacaactttc attaccccag ccgtccaaca 7081 tgcagtgacc acttcataca acaactactc cttaatggcg atggccacgc aagctggagt 7141 gttgtttggt atgggcaaag ggatgccatt ctacgcatgg gactttggag tcccgctgct 7201 aatgataggt tgctactcac aattaacacc cctgacccta atagtggcca tcattttgct 7261 cgtggcgcac tacatgtact tgatcccagg gctgcaggca gcagctgcgc gtgctgccca 7321 gaagagaacg gcagctggca tcatgaagaa ccctgttgtg gatggaatag tggtgactga 7381 cattgacaca atgacaattg acccccaagt ggagaaaaag atgggacagg tgctactcat 7441 agcagtagcc gtctccagcg ccatactgtc gcggaccgcc tgggggtggg gggaggctgg 7501 ggccctgatc acagccgcaa cttccacttt gtgggaaggc tctccgaaca agtactggaa 7561 ctcctctaca gccacttcac tgtgtaacat ttttagggga agttacttgg ctggagcctc 7621 tctaatctac acagtaacaa gaaacgctgg cttggtcaag agacgtgggg gtggaacagg 7681 agagaccctg ggagagaaat ggaaggcccg cttgaaccag atgtcggccc tggagttcta 7741 ctcctacaaa aagtcaggca tcaccgaggt gtgcagagaa gaggcccgcc gcgccctcaa 7801 ggacggtgtg gcaacgggag gccatgctgt gtcccgagga agtgcaaagc tgagatggtt 7861 ggtggagcgg ggatacctgc agccctatgg aaaggtcatt gatcttggat gtggcagagg 7921 gggctggagt tactacgccg ccaccatccg caaagttcaa gaagtgaaag gatacacaaa 7981 aggaggccct ggtcatgaag aacccgtgtt ggtgcaaagc tatgggtgga acattgtccg 8041 tcttaagagt ggggtggacg tctttcatat ggcggctgag ccgtgtgaca cgttgctgtg 8101 tgacataggt gagtcatcat ctagtcctga agtggaagaa gcacggacgc tcagagtcct 8161 ctccatggtg ggggattggc ttgaaaaaag accaggagcc ttttgtataa aagtgttgtg 8221 cccatacacc agcactatga tggaaaccct ggagcgactg cagcgtaggt atgggggagg 8281 actggtcaga gtgccactct cccgcaactc tacacatgag atgtactggg tctctggagc 8341 gaaaagcaac accataaaaa gtgtgtccac cacgagccag ctcctcttgg ggcgcatgga 8401 cgggcctagg aggccagtga aatatgagga ggatgtgaat ctcggctctg gcacgcgggc 8461 tgtggtaagc tgcgctgaag ctcccaacat gaagatcatt ggtaaccgca ttgaaaggat 8521 ccgcagtgag cacgcggaaa cgtggttctt tgacgagaac cacccatata ggacatgggc 8581 ttaccatgga agctatgagg cccccacaca agggtcagcg tcctctctaa taaacggggt 8641 tgtcaggctc ctgtcaaaac cctgggatgt ggtgactgga gtcacaggaa tagccatgac 8701 cgacaccaca ccgtatggtc agcaaagagt tttcaaggaa aaagtggaca ctagggtgcc 8761 agacccccaa gaaggcactc gtcaggttat gagcatggtc tcttcctggt tgtggaaaga 8821 gctaggcaaa cacaaacggc cacgagtctg taccaaagaa gagttcatca acaaggttcg 8881 tagcaatgca gcattagggg caatatttga agaggaaaaa gagtggaaga ctgcagtgga 8941 agctgtgaac gatccaaggt tctgggctct agtggacaag gaaagagagc accacctgag 9001 aggagagtgc cagagttgtg tgtacaacat gatgggaaaa agagaaaaga aacaagggga 9061 atttggaaag gccaagggca gccgcgccat ctggtatatg tggctagggg ctagatttct 9121 agagttcgaa gcccttggat tcttgaacga ggatcactgg atggggagag agaactcagg 9181 aggtggtgtt gaagggctgg gattacaaag actcggatat gtcctagaag agatgagttg 9241 cataccagga ggaaggatgt atgcagatga cactgctggc tgggacaccc gcatcagcag 9301 gtttgatctg gagaatgaag ctctaatcac caaccaaatg gagaaagggc acagggcctt 9361 ggcattggcc ataatcaagt acacatacca aaacaaagtg gtaaaggtcc ttagaccagc 9421 tgaaaaaggg aaaacagtta tggacattat ttcgagacaa gaccaaaggg ggagcggaca 9481 agttgtcact tacgctctta acacatttac caacctagtg gtgcaactca ttcggaatat 9541 ggaggctgag gaagttctag agatgcaaga cttgtggctg ctgcggaggt cagagaaagt 9601 gaccaactgg ttgcagagca acggatggga taggctcaaa cgaatggcag tcagtggaga 9661 tgattgcgtt gtgaagccaa ttgatgatag gtttgcacat gccctcaggt tcttgaatga 9721 tatgggaaaa gttaggaagg acacacaaga gtggaaaccc tcaactggat gggacaactg 9781 ggaagaagtt ccgttttgct cccaccactt caacaagctc catctcaagg acgggaggtc 9841 cattgtggtt ccctgccgcc accaagatga actgattggc cgggcccgcg tctctccagg 9901 ggcgggatgg agcatccggg agactgcttg cctagcaaaa tcatatgcgc aaatgtggca 9961 gctcctttat ttccacagaa gggacctccg actgatggcc aatgccattt gttcatctgt 10021 gccagttgac tgggttccaa ctgggagaac tacctggtca atccatggaa agggagaatg 10081 gatgaccact gaagacatgc ttgtggtgtg gaacagagtg tggattgagg agaacgacca 10141 catggaagac aagaccccag ttacgaaatg gacagacatt ccctatttgg gaaaaaggga 10201 agacttgtgg tgtggatctc tcatagggca cagaccgcgc accacctggg ctgagaacat 10261 taaaaacaca gtcaacatgg tgcgcaggat cataggtgat gaagaaaagt acatggacta 10321 cctatccacc caagttcgct acttgggtga agaagggtct acacctggag tgctgtaagc 10381 accaatctta acgttgtcag gcctgctagt cagccacagc ttggggaaag ctgtgcagcc 10441 tgtgaccccc ccaggagaag ctgggaaacc aagcctatag tcaggccgag aacgccatgg 10501 cacggaagaa gccatgctgc ctgtgagccc ctcagaggac actgagtcaa aaaaccccac 10561 gcgcttggag gcgcaggatg ggaaaagaag gtggcgacct tccccaccct tcaatctggg 10621 gcctgaactg gagatcagct gtggatctcc agaagaggga ctagtggtta gaggagaccc 10681 cccggaaaac gcaaaacagc atattgacgc tgggaaagac cagagactcc atgagtttcc 10741 accacgctgg ccgccaggca cagatcgccg aatagcggcg gccggtgtgg ggaaatccat 10801 gggtct

CDC in Fort Collins has released a full 2016 Zika sequence from Honduras, 103451, which matches District of Columbia severe brain atrophy sequence, FB-GWUH-2016

Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX247632.1|Zika virus isolate MEX_I_7 polyprotein gene, complete cds1852518525100%0.0100%KX247632.1Select seq gb|KX262887.1|Zika virus isolate 103451, complete genome1845318453100%0.099%KX262887.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1843518435100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1842918429100%0.099%KU501216.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome1841118411100%0.099%KU870645.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome1839018390100%0.099%KU509998.3Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1838418384100%0.099%KJ776791.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds1837518375100%0.099%KU991811.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1837518375100%0.099%KU707826.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1837518375100%0.099%KU365779.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1837518375100%0.099%KU321639.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome1837218372100%0.099%KX051563.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome1837218372100%0.099%KU926309.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1836618366100%0.099%KU729218.1Select seq gb|KX197192.1|Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome1836318363100%0.099%KX197192.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1836318363100%0.099%KU365780.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1835718357100%0.099%KU365777.1Select seq gb|KX198135.1|Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome1835418354100%0.099%KX198135.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome1834818348100%0.099%KU940228.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1834818348100%0.099%KU647676.1Select seq gb|KX247646.1|Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome1834518345100%0.099%KX247646.1Select seq gb|KX156776.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome1834518345100%0.099%KX156776.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1834518345100%0.099%KU501215.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1834518345100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1834518345100%0.099%KU312312.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome183411834199%0.099%KU497555.1Select seq gb|KX087101.2|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome1833918339100%0.099%KX087101.2Select seq gb|KX156774.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome1833918339100%0.099%KX156774.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1833918339100%0.099%KU729217.2Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1833918339100%0.099%KU527068.1Select seq gb|KU820897.2|Zika virus isolate FLR polyprotein gene, complete cds1833618336100%0.099%KU820897.2Select seq gb|KU937936.1|Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds1833618336100%0.099%KU937936.1Select seq gb|KX156775.1|Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome1833618336100%0.099%KX156775.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome1833618336100%0.099%KX087102.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome1833018330100%0.099%KU922960.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome1832718327100%0.099%KU926310.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome1832718327100%0.099%KU922923.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds1831818318100%0.099%KU820898.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome1831818318100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome1831618316100%0.099%KU853012.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds1831218312100%0.099%KX056898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds1831218312100%0.099%KU955590.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds1830918309100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1830918309100%0.099%KU761564.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome1829418294100%0.099%KX117076.1Select seq gb|KX185891.1|Zika virus isolate Zika virus/CN/SZ02/2016 polyprotein gene, complete cds1828518285100%0.099%KX185891.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds1828518285100%0.099%KU963796.1Select seq gb|KX253996.1|Zika virus isolate ZKC2/2016, complete genome1828218282100%0.099%KX253996.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds1828218282100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1828218282100%0.099%KU820899.2Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome182541825499%0.099%KU940224.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds1817318173100%0.099%KU866423.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1815018150100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1804218042100%0.099%KU681081.3Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome1774417744100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177441774499%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds176881768898%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1758017580100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1742517425100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164241642499%0.095%HQ234499.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1329513295100%0.089%KU720415.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds132901329099%0.089%HQ234498.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1327913279100%0.089%KF383115.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1327213272100%0.089%LC002520.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1326813268100%0.089%KF383119.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome1326313263100%0.089%KU955595.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1326113261100%0.089%KF268949.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1326113261100%0.089%DQ859059.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds1325613256100%0.089%KU963573.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome1325613256100%0.089%KU955594.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome1325413254100%0.089%KU955592.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1325213252100%0.089%KF268948.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1324513245100%0.089%KF268950.1Select seq gb|KX198134.1|Zika virus strain ZIKV/Aedes africanus/SEN/DAK-AR-41524_A1C1-V2/1984, complete genome1324113729100%0.089%KX198134.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome1323613236100%0.089%KU955591.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1322113221100%0.089%KF383116.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1321413214100%0.089%AY632535.2Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132051320599%0.089%HQ234501.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1316013160100%0.088%KF383117.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds1314413251100%0.088%KU963574.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131441314499%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1295413022100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128641286497%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108501085097%0.084%KF383120.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome50341442487%0.095%KU940227.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4989498927%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4962496227%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4659465925%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4650465025%0.099%KU646827.1Select seq gb|KX101060.1|Zika virus isolate Bahia02, partial genome42171329975%0.095%KX101060.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3443344318%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3202320217%0.099%KU740199.1Select seq gb|KX101066.1|Zika virus isolate Bahia01, partial genome31221308874%0.099%KX101066.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2700270014%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2057205711%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2017201711%0.099%KU179098.1Select seq gb|KX101061.1|Zika virus isolate Bahia03, partial genome18401389578%0.099%KX101061.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds183318339%0.099%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds183318339%0.099%KX059013.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds174517459%0.099%KM078961.1

LOCUS KX247632 10777 bp RNA linear VRL 17-MAY-2016 DEFINITION Zika virus isolate MEX_I_7 polyprotein gene, complete cds. ACCESSION KX247632 VERSION KX247632.1 GI:1028727777 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10777) AUTHORS Barrows,N.J., Campos,R.K., Soto-Acosta,R., Lerner,G., Prasanth,K.R., Powell,S., Galarza Munoz,G., McGrath,E.L., Gao,J., Wu,P., Routh,A., Saade,G., Vasilakis,N., Fernandez Salas,I., Rossi,S.L., Bradrick,S.S. and Garcia-Blanco,M.A. TITLE Repurposed drug candidates to treat ZIKV infection in pregnancy JOURNAL Unpublished REFERENCE 2 (bases 1 to 10777) AUTHORS Routh,A.L. TITLE Direct Submission JOURNAL Submitted (14-MAY-2016) Dept Biochemistry and Molecular Biology, University of Texas Medical Branch, Galveston, 301 University Blvd, Galveston, TX 77555, USA COMMENT ##Assembly-Data-START## Assembly Method :: Bowtie v. 2.2.6; Samtools v. 1.2 Coverage :: >100 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10777 /organism="Zika virus" /mol_type="genomic RNA" /isolate="MEX_I_7" /host="Homo sapiens" /db_xref="taxon:64320" /country="Mexico" /collection_date="2015" /note="passage details: C6-36" CDS 108..10379 /codon_start=1 /product="polyprotein" /protein_id="ANF04750.1" /db_xref="GI:1028727778" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRAPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGIMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIL EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWRELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSCISGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 agttgttgat ctgtgtgaat cagactgcga cagttcgagt ttgaagcgaa agctagcaac 61 agtatcaaca ggttttattt tggatttgga aacgagagtt tctggtcatg aaaaacccaa 121 aaaagaaatc cggaggattc cggattgtca atatgctaaa acgcggagta gcccgtgtga 181 gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat gggcccatca 241 ggatggtctt ggcgattcta gcctttttga gattcacggc aatcaagcca tcactgggtc 301 tcatcaatag atggggttca gtggggaaaa aagaggctat ggaaataata aagaagttca 361 agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag aagagacgag 421 gcgcagatac tagtgtcgga attgttggcc tcctgctgac cacagctatg gcagcggagg 481 tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct ggggaggcca 541 tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg gatcttggac 601 acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg gtggaaccag 661 atgacgtcga ttgttggtgc aacacgacgt caacttgggt tgtgtacgga acctgccatc 721 acaaaaaagg tgaagcacgg agatctagaa gagctgtgac gctcccctcc cattccacta 781 ggaagctgca aacgcggtcg caaacctggt tggaatcaag agaatacaca aagcacttga 841 ttagagtcga aaattggata ttcaggaacc ctggcttcgc gttagcagca gctgccatcg 901 cttggctttt gggaagctca acgagccaaa aagtcatata cttggtcatg atactgctga 961 ttgccccggc atacagcatc aggtgcatag gagtcagcaa tagggacttt gtggaaggta 1021 tgtcaggtgg gacttgggtt gatgttgtct tggaacatgg aggttgtgtc accgtaatgg 1081 cacaggacaa accgactgtc gacatagagc tggtcacaac aacagtcagc aacatggcgg 1141 aggtaagatc ctactgctat gaggcatcaa tatcagacat ggcttcggac agccgctgcc 1201 caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtc tgcaaaagaa 1261 cgttagtgga cagaggctgg ggaaatggat gtggactttt tggcaaaggg agcctggtga 1321 catgcgctaa gtttgcatgc tccaagaaaa tgaccgggaa gagcatccag ccagagaatc 1381 tggagtaccg gataatgctg tcagttcatg gctcccagca cagtgggatg atcgttaatg 1441 acacaggaca tgaaactgat gagaatagag cgaaggttga gataacgccc aattcaccaa 1501 gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa ccgaggacag 1561 gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg ttggttcaca 1621 aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc ggaactccac 1681 actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa aggcaaactg 1741 tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga gctctggagg 1801 ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt cgcctgaaaa 1861 tggataaact tagattgaag ggcgtgtcat actccttgtg taccgcagcg ttcacattca 1921 ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag tacgcaggga 1981 cagatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact ctgaccccag 2041 ttgggaggtt gataaccgct aaccccgtaa tcactgaaag cactgagaac tctaagatga 2101 tgctggaact tgatccacca tttggggact cttacattgt cataggagtc ggggagaaga 2161 agatcaccca ccactggcac aggagtggca gcaccattgg aaaagcattt gaagccactg 2221 tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctgggacttt ggatcagttg 2281 gaggcgctct caactcattg ggcaagggca tccatcaaat ttttggagca gctttcaaat 2341 cattgtttgg aggaatgtcc tggttctcac aaattctcat tggaacgttg ctgatgtggt 2401 tgggtctgaa cacaaagaat ggatctattt cccttatgtg cttggcctta gggggagtgt 2461 tgatcttctt atccacagcc gtctctgctg atgtggggtg ctcggtggac ttctcaaaga 2521 aggagacgag atgcggtaca ggggtgttcg tctataacga cgttgaagcc tggagggaca 2581 ggtacaagta ccatcctgac tccccccgta gattggcagc agcagtcaag caagcctggg 2641 aagatggtat ctgcgggatc tcctctgttt caagaatgga aaacatcatg tggagatcag 2701 tagaagggga gctcaacgca atcctggaag agaatggagt tcaactgacg gtcgttgtgg 2761 gatctgtaaa aaaccccatg tggagagctc cacagagatt gcccgtgcct gtgaacgagc 2821 tgccccacgg ctggaaggct tgggggaaat cgtacttcgt cagagcagca aagacaaata 2881 acagctttgt cgtggatggt gacacactga aggaatgccc actcaaacat agagcatgga 2941 acagctttct tgtggaggat catgggttcg gggtattcca cactagtgtc tggctcaagg 3001 ttagagaaga ttattcatta gagtgtgatc cagccgttat tggaacagct gttaagggaa 3061 aggaggctgt acacagtgat ctaggctact ggattgagag tgagaagaat gacacatgga 3121 ggctgaagag ggcccatctg atcgagatga aaacatgtga atggccaaag tcccacacat 3181 tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttta gctgggccac 3241 tcagccatca caataccaga gagggctaca ggacccaaat gaaagggcca tggcacagtg 3301 aagagcttga aattcggttt gaggaatgcc caggcactaa ggtccacgtg gaggaaacat 3361 gtggaacaag aggaccatct ctgagatcaa ccactgcaag cggaagggtg atcgaggaat 3421 ggtgctgcag ggagtgcaca atgcccccac tgtcgttccg ggctaaagat ggctgttggt 3481 atggaatgga gataaggccc aggaaagaac cagaaagcaa cttagtaagg tcaatggtga 3541 ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg attctgctca 3601 tggtgcagga agggctaaag aagagaatga ccacaaagat catcataagc acatcaatgg 3661 cagtgctggt agctatgatc ctgggaggat tttcaatgag tgacctggct aagcttgcaa 3721 ttttgatggg tgccaccttc gcggaaatga acactggagg agatgtagct catctggcgc 3781 tgatagcggc attcaaagtc agaccagcgt tgctggtatc tttcatcttc agagctaatt 3841 ggacaccccg tgaaagcatg ctactggcct tggcctcgtg tcttttgcaa actgcgatct 3901 ccgccttgga aggcgacctg atggttctca tcaatggttt tgctttggcc tggttggcaa 3961 tacgagcgat ggttgttcca cgcactgata acatcacctt ggcaatcctg gctgctctga 4021 caccactggc ccggggcaca ctgcttgtgg cgtggagagc aggccttgct acttgcgggg 4081 ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta ccatttgtca 4141 tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg ggactgctgt 4201 tgctcacaag gagtgggaag cggagctggc cccctagcga agtactcaca gctgttggcc 4261 tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct gggcccatgg 4321 ccgcggtcgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg gacatgtaca 4381 ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga aacagtcccc 4441 ggctcgatgt ggcgctagat gagagtggtg atttctccct ggtggaggat gacggtcccc 4501 ccatgagaga gatcatactc aaggtggtcc tgatgaccat ctgtggcatg aacccaatag 4561 ccataccctt tgcagctgga gcgtggtacg tatacgtgaa gactgggaaa aggagtggtg 4621 ctctatggga tgtgcctgct cccaaggaag taaaaaaggg ggagaccaca gatggagtgt 4681 acagagtaat gactcgtaga ctgctaggtt caacacaagt tggagtggga attatgcaag 4741 agggggtctt tcacactatg tggcacgtca caaaaggatc cgcactgaga agcggtgaag 4801 ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac tgtggtccat 4861 ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc gtgccccccg 4921 gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag gatggggaca 4981 ttggagcggt tgcgctggat tacccagcag gaacttcagg atctccaatc ctagacaagt 5041 gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaacggg agttatgtta 5101 gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc gagccttcga 5161 tgctgaagaa gaagcagcta actgtcttag acttacatcc tggagctggg aaaaccagga 5221 gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact gtgatcttag 5281 ctccaaccag ggttgtcgct gctgaaatgg aggaggccct tagagggctt ccagtgcgtt 5341 atatgacaac agcagtcaat gtcacccact ctggaacaga aatcgtcgac ttaatgtgcc 5401 atgccacctt cacttcacgt ctactacagc caatcagagt ccccaactat aatctgtata 5461 ttatggatga ggcccacttc acagatccct caagtatagc agcaagggga tacatttcaa 5521 caagggttga gatgggcgag gcggctgcca tcttcatgac cgccacgcca ccaggaaccc 5581 gtgacgcatt tccggactcc aactcaccaa ttatggacac cgaagtggaa gtcccagaga 5641 gagcctggag ctcaggcttt gattgggtga cggatcattc tggaaaaaca gtttggtttg 5701 ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct ggaaaacggg 5761 tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa catcaagagt 5821 gggactttgt cgtgacaact gacatttcag agatgggcgc caactttaaa gctgaccgtg 5881 tcatagattc caggagatgc ctaaagccgg tcatacttga tggcgagaga gtcattctgg 5941 ctggacccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc ataggcagga 6001 atcccaacaa acctggagat gagtatctgt atggaggtgg gtgcgcagag actgacgaag 6061 accatgcaca ctggcttgaa gcaagaatgc tccttgacaa tatttacctc caagatggcc 6121 tcatagcctc gctctatcga cctgaggccg acaaagtagc agccattgag ggagagttca 6181 agcttaggac ggagcaaagg aagacctttg tggaactcat gaaaagagga gatcttcctg 6241 tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga agatggtgct 6301 ttgatggcac gaccaacaac accatactgg aagacagtgt gccggcagag gtgtggacca 6361 gacacggaga gaaaagagtg ctcaaaccga ggtggatgga cgccagagtt tgttcagatc 6421 atgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg gcttttggag 6481 tgatggaagc cctgggaaca ctgccaggac acatgacaga gagattccag gaagccattg 6541 acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa gccgcggcgg 6601 cccaattgcc ggagacccta gagaccatta tgcttttggg gttgctggga acagtctcgc 6661 tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc tttggaatgg 6721 tgacccttgg ggccagtgca tggctcatgt ggctctcgga aattgagcca gccagaattg 6781 catgtgtcct cattgttgtg ttcctattgc tggtggtgct catacctgag ccagaaaagc 6841 aaagatctcc ccaggacaac caaatggcaa tcatcatcat ggtagcagta ggtcttctgg 6901 gcttgattac cgccaatgaa ctcggatggt tggagagaac aaagagtgac ctaagccatc 6961 taatgggaag gagagaggag ggggcaacca taggattctc aatggacatt gacctgcggc 7021 cagcctcagc ttgggccatc tatgctgcct tgacaacttt cattacccca gccgtccaac 7081 atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg caagctggag 7141 tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga gtcccgctgc 7201 taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc atcattttgc 7261 tcgtggcgca ctacatgtac ttgatcccag ggctgcaggc agcagccgcg cgtgctgccc 7321 agaagagaac ggcagctggc atcatgaaga accctgttgt ggatggaata gtggtgactg 7381 acattgacac aatgacaatt gacccccaag tggagaaaaa gatgggacag gtgctactca 7441 tagcagtagc cgtctccagc gccatactgt cgcggaccgc ctgggggtgg ggggaggctg 7501 gggccctgat cacagccgca acttccactt tgtgggaagg ctctccgaac aagtactgga 7561 actcctctac agccacttca ctgtgtaaca tttttagggg aagttacttg gctggagctt 7621 ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg ggtggaacag 7681 gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc ctggagttct 7741 actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc cgcgccctca 7801 aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag ctgagatggt 7861 tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga tgtggcagag 7921 ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa ggatacacaa 7981 aaggaggccc tggtcatgaa gaacccgtgt tggtgcaaag ctatgggtgg aacatagtcc 8041 gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac acgttgctgt 8101 gtgacatagg tgagtcatca tctagtcctg aagtggaaga agcacggacg ctcagagtcc 8161 tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata aaagtgttgt 8221 gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg tatgggggag 8281 gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg gtctctggag 8341 cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg gggcgcatgg 8401 acgggcctag gaggccagtg aaatatgagg aggatgtgaa tctcggctct ggcacgcggg 8461 ctgtggtaag ctgcgctgag gctcccaaca tgaagatcat tggtaaccgc attgaaagga 8521 tccgcagtga gcacgcggaa acgtggttct ttgacgagaa ccacccatat aggacatggg 8581 cttaccatgg aagctatgag gcccccacac aagggtcagc gtcctctcta ataaacgggg 8641 ttgtcaggct cctgtcaaaa ccctgggatg tggtgactgg agtcacagga atagccatga 8701 ccgacaccac accgtatggt cagcaaagag ttttcaagga aaaagtggac actagggtgc 8761 cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcctcctgg ttgtggagag 8821 agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc aacaaggttc 8881 gtagcaatgc agcattaggg gcaatatttg aagaggaaaa agagtggaag actgcagtgg 8941 aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag caccacctga 9001 gaggagagtg ccagagttgt gtgtacaaca tgatgggaaa aagagaaaag aaacaagggg 9061 aatttggaaa ggccaagggc agccgcgcca tctggtatat gtggctaggg gctagatttc 9121 tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga gagaactcag 9181 gaggtggtgt tgaagggctg ggattacaaa gactcggata tgtcctagaa gagatgagtt 9241 gcatatcagg aggaaggatg tatgcagatg acactgctgg ctgggacacc cgcatcagca 9301 ggtttgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg cacagggcct 9361 tggcattggc cataatcaag tacacatacc aaaacaaagt ggtaaaggtc cttagaccag 9421 ctgaaaaagg gaaaacagtt atggacatta tttcgagaca agaccaaagg gggagcggac 9481 aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc attcggaata 9541 tggaggctga ggaagttcta gagatgcaag acttgtggct gctgcggagg tcagagaaag 9601 tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca gtcagtggag 9661 atgattgcgt tgtgaagcca attgatgata ggtttgcaca tgccctcagg ttcttgaatg 9721 atatgggaaa agttaggaag gacacacaag agtggaaacc ctcaactgga tgggacaact 9781 gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag gacgggaggt 9841 ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc gtctctccag 9901 gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg caaatgtggc 9961 agctccttta tttccacaga agggacctcc gactgatggc caatgccatt tgttcatctg 10021 tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga aagggagaat 10081 ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag gagaacgacc 10141 acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg ggaaaaaggg 10201 aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg gctgagaaca 10261 ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag tacatggact 10321 acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctgga gtgctgtaag 10381 caccaatctt aatgttgtca ggcctgctag tcagccacag cttggggaaa gctgtgcagc 10441 ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga gaacgccatg 10501 gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca aaaaacccca 10561 cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc ttcaatctgg 10621 ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt agaggagacc 10681 ccccggaaaa cgcaaaacag catattgacg ctgggaaaga ccagagactc catgagtttc 10741 caccacgctg gccgccaggc acagatcgcc gaacagc

UT Galveston has released a full 2015 Mexico sequence, MEX_I_7, that is closely related to the District of Columbia severe brain atrophy case, FB-GWUH/2016 case.

State: 2 pregnant women in Wash. test positive for Zika The CDC has detected 279 pregnant women in the US infected with Zika, some in Washington. KTVB 3:26 PM. MDT May 21, 20161661CONNECT TWEET LINKEDIN GOOGLE+ PINTERESTState health officials on Friday said two pregnant women in Washington state have tested positive for the Zika virus. During a joint news conference with Senator Patty Murray at Harborview Medical Center, doctors say they don't know how the virus will affect the women's pregnancies, and that they were monitoring the women. "Currently in Washington, we have tested 350 travelers who have had a concern or exposure to Zika," said Dr. Scott Lindquist, State Communicable Disease Epidemiologist . "Two of those women entered into our pregnancy registry." "(The CDC) has created a pregnancy registry. Essentially, if you are pregnant and you either have confirmation of the virus or what's called the equivocal results where we can't rule it out, they want to follow those pregnancies through their term and also following the outcome. So we're talking about two people who meet those criteria." "We know that they have Zika, or the antibodies test is positive for it, but we don't know what the outcome of the pregnancy is going to be yet." Including the two pregnant women, Washington state now has four cases of the Zika virus, which has the potential to cause birth defects. Meanwhile, Senator Patty Murray visited with doctors and health officials in Seattle Friday. She talked about her $1.1 billion emergency funding plan to prepare for the Zika fight as mosquito season gets underway. The CDC put out new numbers Friday related to the Zika virus: 279 pregnant women in the U.S. are infected with the Zika virus, 122 of those are in the U.S. territory of Puerto Rico. So far, fewer than a dozen pregnant women with Zika have had a problem, such as a miscarriage, or evidence that the fetus has a birth defect. Reported Zika Virus Cases in the United States | HealthGrovehttp://www.ktvb.com/news/health/uw-medicine-2-pregnant-women-in-wash-test-positive-for-zika/208425611