Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX101061.1|Zika virus isolate Bahia03, partial genome18461467693%0.0100%KX101061.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome18461442892%0.0100%KX087102.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome18461455593%0.0100%KX051563.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome18461457693%0.0100%KU509998.3Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds18461452993%0.0100%KU820897.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds18461443792%0.0100%KU647676.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds18461400589%0.0100%KU312312.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome18461447492%0.0100%KU321639.1Select seq gb|KX087101.1|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome18401450893%0.099%KX087101.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds18401446192%0.099%KU991811.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome18401455193%0.099%KU926309.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome18401442192%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome18401442192%0.099%KU922923.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome18401433792%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome18401433892%0.099%KU853012.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome18401440792%0.099%KU501215.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds18401451393%0.099%KU365778.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome18371454092%0.099%KU940228.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome18371453892%0.099%KU940224.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome18371451593%0.099%KU870645.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome18371452993%0.099%KU497555.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome18371444892%0.099%KU707826.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome18371453193%0.099%KU527068.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds18371444192%0.099%KU365779.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds18371446692%0.099%KJ776791.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome18311448493%0.099%KX117076.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds18311386889%0.099%KX056898.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds18311447593%0.099%KU963796.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds18311432092%0.099%KU955590.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds18311431392%0.099%KU955589.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome18311451393%0.099%KU926310.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds18311386489%0.099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds18311428291%0.099%KU740184.2Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds18311456493%0.099%KU729218.1Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds18311399690%0.099%KU761564.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds18311389589%0.099%KU501217.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds18311442192%0.099%KU365780.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds18311442192%0.099%KU365777.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome18281448193%0.099%KU820899.2Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds18281442792%0.099%KU729217.2Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome18281430993%0.099%KU681081.3Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds18281389189%0.099%KU501216.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome18241431892%0.099%KU744693.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds18221374989%0.099%KU866423.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds18191347188%0.099%KF993678.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome17841405793%0.099%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds17841343389%0.099%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds17831333489%0.099%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome17681383093%0.098%KU681082.3Select seq gb|KX101066.1|Zika virus isolate Bahia01, partial genome17591158675%0.099%KX101066.1Select seq gb|KX101060.1|Zika virus isolate Bahia02, partial genome16631159674%0.099%KX101060.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds16441235589%0.096%HQ234499.1Select seq gb|KX101064.1|Zika virus isolate Bahia11, partial genome1627901660%0.096%KX101064.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome15841165283%0.091%KU940227.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds1575358324%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds1566357424%0.099%KU646827.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds1566268916%0.099%KU312315.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds1566386023%0.099%KU312314.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds1566205612%0.099%KJ634273.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds1557384223%0.099%KU312313.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome14691049293%0.093%KU955595.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome14691048693%0.093%KU955592.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID14671054293%0.093%LC002520.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome14651045993%0.093%KU955591.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome14621051793%0.093%KU955594.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds14621055193%0.093%KU720415.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome14581048893%0.093%AY632535.2Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds1451233715%0.094%KU740199.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds14111041493%0.092%KF268949.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds13971045093%0.092%KF268950.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds13971045293%0.092%KF268948.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds13751043692%0.093%KU963573.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1310993689%0.089%KF383115.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1297988289%0.088%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds1292986489%0.088%HQ234501.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1283980889%0.088%KF383117.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1283991689%0.088%DQ859059.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds1274997989%0.088%KU963574.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds1274978189%0.088%HQ234500.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds1256956785%0.087%KF383121.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1256997189%0.087%KF383119.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds1256996589%0.087%HQ234498.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1252969189%0.087%KF383118.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence1099800384%0.084%KF383120.1Select seq gb|KX101067.1|Zika virus isolate Bahia12, partial genome1038747250%0.093%KX101067.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds1018159010%0.099%KU686218.1Select seq gb|KF270886.1|Zika virus strain CCB-870 envelope glycoprotein gene, partial cds101210128%0.088%KF270886.1Select seq gb|KU758878.1|Zika virus polyprotein gene, partial cds9879876%0.099%KU758878.1
  2. Brazilian study links Zika virus to more neurological disorders Source: Xinhua | 2016-04-30 22:14:46 | Editor: huaxia Gabrielly Santana da Paz holds her child who suffered microcephaly while waiting for examination at the Oswaldo Cruz Hospital, in Cabo de Santo Agostinho, 35 km from Recife, capital of Pernambuco in northeastern Brazil, on Feb. 1, 2016. (Xinhua/Diego Herculano/Brazil Photo Press/AGENCIA ESTADO) RIO DE JANEIRO, April 29 (Xinhua) -- A Brazilian medical study reveals a link between the mosquito-borne virus Zika and acute disseminated encephalomyelitis (ADEM), a condition often misdiagnosed as multiple sclerosis (MS). The study, the findings of which was released on Friday, was carried out by a hospital in Recife, capital of the northeastern Pernambuco state worst affected by the Zika epidemic. The Zika epidemic has swept through Brazil and much of Latin America in the past two years. Pernambuco has seen a sharp rise in the number of microcephaly cases, babies born with abnormally small heads, leading health authorities to believe that it is Zika-related, though there has as yet been no definite scientific proof. Brazilian news network Globo reported on Friday that doctors at the hospital's department of neurology tested samples taken from 180 patients infected with the Zika virus and showing neurological symptoms, and found 30 of them had developed ADEM, encephalitis or myelitis. Another 60 patients came down with Guillain-Barre syndrome, a disorder previously associated with Zika that causes the immune system to mistakenly attack the nervous system, leading to muscle weakness and paralysis. "Without a doubt there is a link between the diseases and the Zika virus," Lucia Brito, head of the medical team, told the news agency. Brito said that ADEM is a more complicated condition in which "the patient's level of consciousness can change. In other words, they can enter into a coma." A woman walks pass a tent for accompanying suspected cases of dengue, zika and chinkungunya, in Sao Paulo, Brazil, on Feb. 24, 2016. (Xinhua/Ale Vianna/AGENCIA ESTADO) Of those with ADEM, two continue to suffer with symptoms almost a year after the onset of the disease, including "a boy with motor deficit and an adult with motor difficulty and impaired vision," Brito said. The National Multiple Sclerosis Society describes ADEM as "a brief but intense attack of inflammation (swelling) in the brain and spinal cord and occasionally the optic nerves that damages the brain's myelin (the white coating of nerve fibers)." Unlike MS, which is gradual, ADEM appears rapidly and is passing, though it can leave permanent damage. Common symptoms include rapid onset fever, weakness and loss of vision, and in extreme cases, coma. Mosquitos that carries the Zika virus also transmit dengue and chikungunya. Brazil has reported 31,616 confirmed cases of Zika and over 90,000 suspected cases, with three deaths caused by the disease. On Feb. 1, the World Health Organization (WHO) declared "the cluster of microcephaly cases and other neurological disorders a health emergency" and called for concerted efforts to curb the spread of Zika. http://news.xinhuanet.com/english/2016-04/30/c_135325685.htm
  3. LOCUS KX101061 10564 bp RNA linear VRL 26-APR-2016 DEFINITION Zika virus isolate Bahia03, partial genome. ACCESSION KX101061 VERSION KX101061.1 GI:1022831291 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10564) AUTHORS Naccache,S.N., Theze,J., Sardi,S.I., Somasekar,S., Greninger,A.L., Bandeira,A.C., Campos,G.S., Tauro,L.B., Faria,N.R., Pybus,O.G. and Chiu,C.Y. TITLE Discovery of a persistent Zika virus lineage in Bahia, Brazil JOURNAL Unpublished REFERENCE 2 (bases 1 to 10564) AUTHORS Naccache,S.N., Somasekar,S., Sardi,S.I., Bandeira,A.C., Campos,G.S. and Chiu,C.Y. TITLE Direct Submission JOURNAL Submitted (22-APR-2016) Laboratory Medicine, University of California, San Francisco, 185 Berry Street, #0134, San Francisco, CA 94107, USA COMMENT ##Assembly-Data-START## Assembly Method :: SURP+ v. 1.0 2016; Geneious v. 6.1.8 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10564 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Bahia03" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="May-2015" CDS <1..10209 /codon_start=1 /product="polyprotein" /protein_id="ANA85188.1" /db_xref="GI:1022831292" /translation="ARVSPFGGLKRLPAGLLLGHGPIRMVLAILAFLRFTAIKPSLGL INRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKKRRGADTSVGIVGLLLTTAMAA EVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMSYECPMLDEG VEPDDVDCWCNTTSTWVVYGTCHHKKGEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXFRNPGFALAAAAIAWLLGSSTSQKVIYXXXXXXXXXXXXXXXXXXX XXXXXXGMSGGTWVDIVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASI SDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCXXXXXXXXXXXXXXXXXX XXXXXXXXXXXLEYRIMLSVHGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLG GFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNK EALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDK LRLKGVSYSLCNAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPV GRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEA TVRGAKRMAVLGDTAWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGVFVYNDV EAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSRMENIMWRSVEGELNAILEENG VQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGKSXFVRAAKTNXSFVXDGDTLK ECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLECDPAVIGTAVKXXXXXXXXXG YWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGIEESDLIIPKSXXXXXXXXXXX XGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTRGPSLRSTTASGRXXXXXXXXX XXXXPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTAGSTDHMDHFSLGVLVILLMVQ EXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTGGDVAHLAL IAAFKVRPALLVSFIFXXXXXPRESMLLALASCLLQTAISALEGDLMVLINGFALAWL AIRAMVVPXXXXXXXXXXXXXXXXXXXXXXXXWRAGLATCGGFMLLSLKGKGSVKKNL PFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSEVLTAVGLICALAGGFAKADIE MAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKDAEVTGNXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGAWYVYVKTGKRSGALWDVPAPKEV KKXXXXXXXXXXXXXXXXGSTQVGVGVMQEGVFHTMWHVTKGSALRSGEGRLDPYWGD VKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARNIQTLPGIFKTKDGDIGAVALD YPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGRREEETPVECFEPSMLKKK QLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAPTRVVAAEMEEALRGLPVRYMT TAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLYIMDEAHFTXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKTKHQEWDFVVTTDISXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXMPVTHASAAQRRGRIGRNPNKPGDEYLYGGXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIMEDSVPAEVWTRHGEKRVLKPR WMDARVCSDHAALKSFKEFAAGKRGAALGVMEALGTLPGHMTERFQEAIDNLAVLMRA ETGSRPYKAAAAQMPETLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASA WLMWLSEIEPARIACVLIVVFLLLVVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPASAWAIYAALTTFITPAVQHAV TTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPLLMIGCYSQLTPLTLIVAIILL VAHYMYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLCNIFRGSYL AGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQMSALEFYSYKKSGITEVCREE ARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGKVIDLGCGRGGWSYYAATIRKV QEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFHMAAEPCDTLLCDIGESSSSPE VEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMMETLERLQRRYGGGLVRVPLSR NSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRPVKYEEDVNLGSGTRAVVSCAE APNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHGSYXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXTTPYGQQRVFKEKVDTRVPDPQEGTRQVMSMVSSWLWKELG KHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAVEAVNDPRFWALVDKEREHHLR GECQSXXXXXXXXXXXXXXXXXXXXXXXXXXXMWLGARFLEFEALGFLNEDHWMGREN SGGGVEGLGLQXXXXXXXXXXXXXXXXXXXXXXXXXDTRISRFDLENEALITNQMEKG HRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQDQRGSGQVVTYALNTFTNLVV QLIRNMEAEEVLEMQDLWLLRRPEKVTNWLQSNGWDRLKRMAVSGDDCVVKPIXXXXX XXXXXXXXXXXXXXXXXXWKPSTGWDNWEEVPFCSHHFNKLHLKDGRSIVVPCRHQDE LIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRRDLRLMANAICSSVPVDWVPTG RTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKTPVTKWTDIPYLGKREDLWCGS LIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLSTQVRYLGEEGSTPGVL" mat_peptide 1..312 /product="capsid peptide" mat_peptide 313..582 /product="propeptide" mat_peptide 583..807 /product="membane protein peptide" mat_peptide 808..2322 /product="envelope protein peptide" mat_peptide 2323..3408 /product="NS1 peptide" mat_peptide 3409..4062 /product="NS2A peptide" mat_peptide 4063..4494 /product="NS2B peptide" mat_peptide 4495..6303 /product="NS3 peptide" mat_peptide 6304..6744 /product="NS4A peptide" mat_peptide 6745..8250 /product="NS4B peptide" mat_peptide 8251..10206 /product="NS5 peptide" gap 568..690 /estimated_length=123 gap 2096..2365 /estimated_length=270 gap 3442..3578 /estimated_length=137 gap 4264..4402 /estimated_length=139 gap 5316..5529 /estimated_length=214 gap 5868..6050 /estimated_length=183 gap 6652..6752 /estimated_length=101 gap 7111..7405 /estimated_length=295 gap 8429..8534 /estimated_length=106 3'UTR 10210..10564 ORIGIN 1 gcccgtgtga gcccctttgg gggcttgaag aggctgccag ccggacttct gctgggtcat 61 gggcccatca ggatggtctt ggcgattcta gcctttttga gattcacggc aatcaagcca 121 tcactgggtc tcatcaatag atggggttca gtggggaaaa aagaggctat ggaaataata 181 aagaagttca agaaagatct ggctgccatg ctgagaataa tcaatgctag gaaggagaag 241 aagagacgag gcgcagatac tagtgtcgga attgttggcc tcctgctgac cacagctatg 301 gcagcggagg tcactagacg tgggagtgca tactatatgt acttggacag aaacgatgct 361 ggggaggcca tatcttttcc aaccacattg gggatgaata agtgttatat acagatcatg 421 gatcttggac acatgtgtga tgccaccatg agctatgaat gccctatgct ggatgagggg 481 gtggaaccag atgacgtcga ttgttggtgc aacacgacgt caacttgggt tgtgtacgga 541 acctgccatc acaaaaaagg tgaagca [gap 123 bp] Expand Ns 691 ttcaggaacc ctggcttcgc gttagcagca 721 gctgccatcg cttggctttt gggaagctca acgagccaaa aagtcatata cnnnnnnnnn 781 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 841 nnnnnnggta tgtcaggtgg gacttgggtt gatattgtct tggaacatgg aggttgtgtc 901 accgtaatgg cacaggacaa accgactgtc gacatagagc tggttacaac aacagtcagc 961 aacatggcgg aggtaagatc ctactgctat gaggcatcaa tatcagacat ggcttcggac 1021 agccgctgcc caacacaagg tgaagcctac cttgacaagc aatcagacac tcaatatgtc 1081 tgcaaaagaa cgttagtgga cagaggctgg ggaaatggat gtnnnnnnnn nnnnnnnnnn 1141 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 1201 nnnnnnnnnc tggagtaccg gataatgctg tcagttcatg gctcccagca cagtgggatg 1261 atcgttaatg acacaggaca tgaaactgat gagaatagag cgaaggttga gataacgccc 1321 aattcaccaa gagccgaagc caccctgggg ggttttggaa gcctaggact tgattgtgaa 1381 ccgaggacag gccttgactt ttcagatttg tattacttga ctatgaataa caagcactgg 1441 ttggttcaca aggagtggtt ccacgacatt ccattacctt ggcacgctgg ggcagacacc 1501 ggaactccac actggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa 1561 aggcaaactg tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga 1621 gctctagagg ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt 1681 cgcctgaaaa tggataaact tagattgaag ggcgtgtcat actccttgtg taacgcagcg 1741 ttcacattca ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag 1801 tacgcaggga ctgatggacc ttgcaaggtt ccagctcaga tggcggtgga catgcaaact 1861 ctgaccccag ttgggaggtt gataaccgct aaccccgtaa tcactgaaag cactgagaac 1921 tctaagatga tgctggaact tgatccacca tttggggact cctacattgt cataggagtc 1981 ggggagaaga agatcaccca ccactggcac aggagtggca gcaccattgg aaaagcattt 2041 gaagccactg tgagaggtgc caagagaatg gcagtcttgg gagacacagc ctggg [gap 270 bp] Expand Ns 2366 gtaca ggggtgttcg tctataacga cgttgaagcc 2401 tggagggaca ggtacaagta ccatcctgac tccccccgta gattggcagc agcagtcaag 2461 caagcctggg aagatggtat ctgcgggatc tcctctgttt caagaatgga aaacatcatg 2521 tggagatcag tagaagggga gctcaacgca atcctggaag agaatggagt tcaactgacg 2581 gtcgttgtgg gatctgtaaa aaaccccatg tggagaggtc cacagagatt gcccgtgcct 2641 gtgaacgagc tgccccacgg ctggaaggct tgggggaaat cgtmcttcgt cagagcagca 2701 aagacaaatm acagctttgt cgnggatggt gacacactga aggaatgccc actcaaacat 2761 agagcatgga acagctttct tgtggaggat catgggttcg gggtatttca cactagtgtc 2821 tggctcaagg ttagagaaga ttattcatta gagtgtgatc cagccgttat tggaacagct 2881 gttaagnnnn nnnnnnnnnn nnnnnnnnnn nnnggctact ggattgagag tgagaagaat 2941 gacacatgga ggctgaagag ggcccatctg atcgagatga aaacatgtga atggccaaag 3001 tcccacacat tgtggacaga tggaatagaa gagagtgatc tgatcatacc caagtcttnn 3061 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nngggctaca ggacccaaat gaaagggcca 3121 tggcacagtg aagagcttga aattcggttt gaggaatgcc caggcactaa ggtccacgtg 3181 gaggaaacat gtggaacaag aggaccatct ctgagatcaa ccactgcaag cggaagggnn 3241 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnccccac tgtcgttccg ggctaaagat 3301 ggctgttggt atggaatgga gataaggccc aggaaagaac cagaaagcaa cttagtaagg 3361 tcaatggtga ctgcaggatc aactgatcac atggatcact tctcccttgg agtgcttgtg 3421 attctgctca tggtgcagga a [gap 137 bp] Expand Ns 3579 ga acactggagg agatgtagct 3601 catctggcgc tgatagcggc attcaaagtc agaccagcgt tgctggtatc tttcatcttc 3661 nnnnnnnnnn nnnnnccccg tgaaagcatg ctgctggcct tggcctcgtg tcttttgcaa 3721 actgcgatct ccgccttgga aggcgacctg atggttctca tcaatggttt tgctttggcc 3781 tggttggcaa tacgagcgat ggttgttcca nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 3841 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngtggagagc aggccttgct 3901 acttgcgggg ggtttatgct cctctctctg aagggaaaag gcagtgtgaa gaagaactta 3961 ccatttgtca tggccctggg actaaccgct gtgaggctgg tcgaccccat caacgtggtg 4021 ggactgctgt tgctcacaag gagtgggaag cggagctggc cccccagcga agtactcaca 4081 gctgttggcc tgatatgcgc attggctgga gggttcgcca aggcagatat agagatggct 4141 gggcccatgg ccgcggtcgg tctgctaatt gtcagttacg tggtctcagg aaagagtgtg 4201 gacatgtaca ttgaaagagc aggtgacatc acatgggaaa aagatgcgga agtcactgga 4261 aac [gap 139 bp] Expand Ns 4403 cagctgga gcgtggtacg tatacgtgaa gactggaaaa 4441 aggagtggtg ctctatggga tgtgcctgct cccaaggaag taaaaaagnn nnnnnnnnnn 4501 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtt caacacaagt tggagtggga 4561 gttatgcaag agggggtctt tcacactatg tggcacgtca caaaaggatc cgcgctgaga 4621 agcggtgaag ggagacttga tccatactgg ggagatgtca agcaggatct ggtgtcatac 4681 tgtggtccat ggaagctaga tgccgcctgg gacgggcaca gcgaggtgca gctcttggcc 4741 gtgccccccg gagagagagc gaggaacatc cagactctgc ccggaatatt taagacaaag 4801 gatggggaca ttggagcggt tgcgctggat tacccagcag gaacttcagg atctccaatc 4861 ctagacaagt gtgggagagt gataggactt tatggcaatg gggtcgtgat caaaaatggg 4921 agttatgtta gtgccatcac ccaagggagg agggaggaag agactcctgt tgagtgcttc 4981 gagccttcga tgctgaagaa gaagcagcta actgtcttag acttgcatcc tggagctggg 5041 aaaaccagga gagttcttcc tgaaatagtc cgtgaagcca taaaaacaag actccgtact 5101 gtgatcttag ctccaaccag ggttgtcgct gctgaaatgg aggaagccct tagagggctt 5161 ccagtgcgtt atatgacaac agcagtcaat gtcacccact ctggaacaga aatcgtcgac 5221 ttaatgtgcc atgccacctt cacttcacgt ctactacagc caatcagagt ccccaattat 5281 aatctgtata ttatggatga ggcccacttc acaga [gap 214 bp] Expand Ns 5530 g ttccaagcgt gaggaacggc aatgagatcg cagcttgtct gacaaaggct 5581 ggaaaacggg tcatacagct cagcagaaag acttttgaga cagagttcca gaaaacaaaa 5641 catcaagagt gggactttgt cgtgacaact gacatttcag nnnnnnnnnn nnnnnnnnnn 5701 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 5761 nnnnnnnnnn nnnnnnccat gcctgtcaca catgccagcg ctgcccagag gagggggcgc 5821 ataggcagga atcccaacaa acctggagat gagtatctgt atggagg [gap 183 bp] Expand Ns 6051 gaaaagagga 6061 gatcttcctg tttggctggc ctatcaggtt gcatctgccg gaataaccta cacagataga 6121 agatggtgct ttgatggcac gaccaacaac accataatgg aagacagtgt gccggcagag 6181 gtgtggacca gacacggaga gaaaagagtg ctcaaaccga ggtggatgga tgccagagtt 6241 tgttcagatc atgcggccct gaagtcattc aaggagtttg ccgctgggaa aagaggagcg 6301 gctcttggag tgatggaagc cctgggaaca ctgccaggac acatgacaga gagattccag 6361 gaagccattg acaacctcgc tgtgctcatg cgggcagaga ctggaagcag gccttacaaa 6421 gccgcggcgg cccaaatgcc ggagacccta gagaccatta tgcttttggg gttgctagga 6481 acagtctcgc tgggaatctt tttcgtcttg atgaggaaca agggcatagg gaagatgggc 6541 tttggaatgg tgactcttgg ggccagcgca tggctcatgt ggctctcgga aattgagcca 6601 gccagaattg catgtgtcct cattgttgtg ttcctattgc tggtggtgct c [gap 101 bp] Expand Ns 6753 cggatggt tggagagaac aaagagtgac 6781 ctaagccatc taatgggaag gagagaggag ggggcaacca taggattctc aatggacatt 6841 gacctgcggc cagcctcagc ttgggccatc tatgctgcct tgacaacttt cattacccca 6901 gccgtccaac atgcagtgac cacttcatac aacaactact ccttaatggc gatggccacg 6961 caagctggag tgttgtttgg tatgggcaaa gggatgccat tctacgcatg ggactttgga 7021 gtcccgctgc taatgatagg ttgctactca caattaacac ccctgaccct aatagtggcc 7081 atcattttgc tcgtggcgca ctacatgtac [gap 295 bp] Expand Ns 7406 cttca ctgtgtaaca tttttagggg aagttacttg 7441 gctggagctt ctctaatcta cacagtaaca agaaacgctg gcttggtcaa gagacgtggg 7501 ggtggaacag gagagaccct gggagagaaa tggaaggccc gcttgaacca gatgtcggcc 7561 ctggagttct actcctacaa aaagtcaggc atcaccgagg tgtgcagaga agaggcccgc 7621 cgcgccctca aggacggtgt ggcaacggga ggccatgctg tgtcccgagg aagtgcaaag 7681 ctgagatggt tggtggagcg gggatacctg cagccctatg gaaaggtcat tgatcttgga 7741 tgtggcagag ggggctggag ttactacgcc gccaccatcc gcaaagttca agaagtgaaa 7801 ggatacacaa aaggaggccc tggtcatgaa gaacccgtgt tggtgcaaag ctatgggtgg 7861 aacatagtcc gtcttaagag tggggtggac gtctttcata tggcggctga gccgtgtgac 7921 acgttgctgt gtgacatagg tgagtcatca tctagtcctg aagtggaaga agcacggacg 7981 ctcagagtcc tctccatggt gggggattgg cttgaaaaaa gaccaggagc cttttgtata 8041 aaagtgttgt gcccatacac cagcactatg atggaaaccc tggagcgact gcagcgtagg 8101 tatgggggag gactggtcag agtgccactc tcccgcaact ctacacatga gatgtactgg 8161 gtctctggag cgaaaagcaa caccataaaa agtgtgtcca ccacgagcca gctcctcttg 8221 gggcgcatgg acgggcctag gaggccagtg aaatatgagg aggatgtgaa tctcggctct 8281 ggcacgcggg ctgtggtaag ctgcgctgaa gctcccaaca tgaagatcat tggtaaccgc 8341 attgaaagga tccgcagtga gcacgcggaa acgtggttct ttgacgagaa ccacccatat 8401 aggacatggg cttaccatgg aagctatg [gap 106 bp] Expand Ns 8535 caccac accgtatggt cagcaaagag ttttcaagga aaaagtggac 8581 actagggtgc cagaccccca agaaggcact cgtcaggtta tgagcatggt ctcttcctgg 8641 ttgtggaaag agctaggcaa acacaaacgg ccacgagtct gtaccaaaga agagttcatc 8701 aacaaggttc gtagcaatgc agcactaggg gcaatatttg aagaggaaaa agagtggaag 8761 actgcagtgg aagctgtgaa cgatccaagg ttctgggctc tagtggacaa ggaaagagag 8821 caccacctga gaggagagtg ccagagttgn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 8881 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnatat gtggctaggg 8941 gctagatttc tagagttcga agcccttgga ttcttgaacg aggatcactg gatggggaga 9001 gagaactcag gaggtggtgt tgaagggctg ggattacaan nnnnnnnnnn nnnnnnnnnn 9061 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nngggacacc 9121 cgcatcagca ggtttgatct ggagaatgaa gctctaatca ccaaccaaat ggagaaaggg 9181 cacagggcct tggcattggc cataatcaag tacacatacc aaaacaaagt ggtaaaggtc 9241 cttagaccag ctgaaaaagg gaaaacagtt atggacatta tttcgagaca agaccaaagg 9301 gggagcggac aagttgtcac ttacgctctt aacacattta ccaacctagt ggtgcaactc 9361 attcggaata tggaggctga ggaagttctc gagatgcaag acttgtggct gctgcggagg 9421 ccagagaaag tgaccaactg gttgcagagc aacggatggg ataggctcaa acgaatggca 9481 gtcagtggag atgattgcgt tgtgaagcca attgannnnn nnnnnnnnnn nnnnnnnnnn 9541 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngtggaaacc ctcaactgga 9601 tgggacaact gggaagaagt tccgttttgc tcccaccact tcaacaagct ccatctcaag 9661 gacgggaggt ccattgtggt tccctgccgc caccaagatg aactgattgg ccgggcccgc 9721 gtctctccag gggcgggatg gagcatccgg gagactgctt gcctagcaaa atcatatgcg 9781 caaatgtggc agctccttta tttccacaga agggacctcc gactgatggc caatgccatt 9841 tgttcatctg tgccagttga ctgggttcca actgggagaa ctacctggtc aatccatgga 9901 aagggagaat ggatgaccac tgaagacatg cttgtggtgt ggaacagagt gtggattgag 9961 gagaacgacc acatggaaga caagacccca gttacgaaat ggacagacat tccctatttg 10021 ggaaaaaggg aagacttgtg gtgtggatct ctcatagggc acagaccgcg caccacctgg 10081 gctgagaaca ttaaaaacac agtcaacatg gtgcgcagga tcataggtga tgaagaaaag 10141 tacatggact acctatccac ccaagttcgc tacttgggtg aagaagggtc tacacctgga 10201 gtgctgtaag caccagtctt aatgttgtca ggcctgctag tcagccacag cttggggaaa 10261 gctgtgcagc ctgtgacccc cccaggagaa gctgggaaac caagcctata gtcaggccga 10321 gaacgccatg gcacggaaga agccatgctg cctgtgagcc cctcagagga cactgagtca 10381 aaaaacccca cgcgcttgga ggcgcaggat gggaaaagaa ggtggcgacc ttccccaccc 10441 ttcaatctgg ggcctgaact ggagatcagc tgtggatctc cagaagaggg actagtggtt 10501 agaggagacc ccccggaaaa cgcaaaacag catattgacg ctgggaaaga ccagagactc 10561 catg
  4. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KX101060.1|Zika virus isolate Bahia02, partial genome48071399078%0.0100%KX101060.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome47891394878%0.096%KU940228.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome47891394178%0.096%KU940224.1Select seq gb|KU509998.3|Zika virus strain Haiti/1225/2014, complete genome47741389878%0.096%KU509998.3Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome47741388778%0.096%KU321639.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds47731386478%0.096%KU647676.1Select seq gb|KX051563.1|Zika virus isolate Haiti/1/2016, complete genome47691386578%0.096%KX051563.1Select seq gb|KX087102.1|Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome47651384578%0.096%KX087102.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome47651385678%0.096%KU926309.1Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds47651384578%0.096%KU820897.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome47621383378%0.095%KU870645.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome47621383378%0.095%KU926310.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds47621388578%0.095%KU729218.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome47621386478%0.095%KU527068.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds47601387478%0.095%KU991811.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome47601384578%0.095%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome47601384278%0.095%KU922923.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds47601387478%0.095%KJ776791.1Select seq gb|KX087101.1|Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome47561381778%0.095%KX087101.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome47531381878%0.095%KU501215.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds47511384978%0.095%KU729217.2Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome47451385178%0.095%KU707826.1Select seq gb|KX117076.1|Zika virus isolate Zhejiang04, complete genome47441380678%0.095%KX117076.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome47441384978%0.095%KU497555.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds47421383578%0.095%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds47381384478%0.095%KU365779.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome47351379378%0.095%KU820899.2Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds47351381778%0.095%KU365778.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds47331382678%0.095%KU365777.1Select seq gb|KU963796.1|Zika virus isolate SZ-WIV01 polyprotein gene, complete cds47291378878%0.095%KU963796.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome47201375078%0.095%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome46811363478%0.095%KU681081.3Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome46721374877%0.095%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome46701374877%0.095%KU853012.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds46621372177%0.095%KU955589.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds46551373777%0.095%KU955590.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds46371371277%0.095%KU740184.2Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome46081340778%0.094%KU955593.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome45451318478%0.094%KU681082.3Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds43511342576%0.095%KU761564.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds43381342276%0.095%KU312312.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds42221331275%0.095%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds42221331275%0.095%KU501216.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds42131328375%0.095%KU820898.1Select seq gb|KX056898.1|Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds42041328375%0.095%KX056898.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds41451316975%0.094%KU866423.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds41181299275%0.094%KF993678.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds40801288175%0.094%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds40781281975%0.094%EU545988.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds37071188275%0.091%HQ234499.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds34581002478%0.086%KU720415.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID34581000878%0.086%LC002520.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome3454998678%0.086%KU955594.1Select seq gb|KU963573.1|Zika virus isolate ZIKV/Macaca mulatta/UGA/MR-766_SM150-V8/1947 polyprotein (GP1) gene, complete cds3449998678%0.085%KU963573.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome3445996878%0.085%AY632535.2Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome3440998178%0.085%KU955595.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome3431996878%0.085%KU955592.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome3422994578%0.085%KU955591.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds3391993078%0.085%KF268949.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds3353993078%0.085%KF268950.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds3353993878%0.085%KF268948.1Select seq gb|KU963574.1|Zika virus isolate ZIKV/Homo sapiens/NGA/IbH-30656_SM21V1-V3/1968 polyprotein (GP1) gene, complete cds3012958476%0.084%KU963574.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds3007944375%0.085%DQ859059.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds2978945175%0.084%KF383116.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds2964953775%0.084%KF383119.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds2964953075%0.084%HQ234498.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds2942927575%0.084%KF383118.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds2919944775%0.084%HQ234501.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds2913937775%0.084%HQ234500.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds2892946175%0.084%KF383115.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds2879938075%0.084%KF383117.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds2792369119%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds2778367119%0.099%KU312313.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds2562913572%0.083%KF383121.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds2315275014%0.099%KU312315.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds2300326217%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds2287324917%0.099%KU646827.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2287228712%0.099%KJ634273.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome19501142569%0.092%KU940227.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence1804766570%0.083%KF383120.1Select seq gb|KX101061.1|Zika virus isolate Bahia03, partial genome16631159465%0.099%KX101061.1Select seq gb|KX101066.1|Zika virus isolate Bahia01, partial genome16581059859%0.099%KX101066.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds1654165411%0.090%KU179098.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds164917959%0.099%KU740199.1Select seq gb|KX101064.1|Zika virus isolate Bahia11, partial genome1577909552%0.096%KX101064.1Select seq gb|KX059014.1|Zika virus isolate Haiti/1230/2014 NS5 gene, partial cds148914899%0.090%KX059014.1Select seq gb|KX059013.1|Zika virus isolate Haiti/1227/2014 NS5 gene, partial cds148914899%0.090%KX059013.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds140214029%0.090%KM078936.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds140214029%0.090%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds140014009%0.090%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds140014009%0.090%KM078970.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds140014009%0.090%KM078961.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds139813989%0.090%KM078929.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds139513959%0.090%KM078933.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds125212528%0.089%KJ873160.1Select seq gb|KT200609.1|Zika virus isolate BR/949/15 NS5 gene, partial cds122312236%0.098%KT200609.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds107610767%0.088%KJ873161.1Select seq gb|KF270886.1|Zika virus strain CCB-870 envelope glycoprotein gene, partial cds107210728%0.088%KF270886.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds103410347%0.087%KM851039.1Select seq gb|KX101062.1|Zika virus isolate Bahia04, partial genome1032621534%0.096%KX101062.1Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds102910299%0.080%AF013415.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds102010207%0.086%KM851038.1Select seq gb|AF372422.1|AF372422Zika virus envelope protein (E) gene, partial cds101410148%0.086%AF372422.1Select seq gb|KU985087.1|Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds100910097%0.087%KU985087.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds100210027%0.087%KU556802.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds99614548%0.098%KU686218.1Select seq gb|KF383022.1|Zika virus strain ArD127988 envelope protein gene, partial cds9719717%0.089%KF383022.1Select seq gb|KF383026.1|Zika virus strain ArD127994 envelope protein gene, partial cds9669667%0.088%KF383026.1Select seq gb|KF383037.1|Zika virus strain ArA506 envelope protein gene, partial cds9609607%0.088%KF383037.1Select seq gb|KF383036.1|Zika virus strain ArA975 envelope protein gene, partial cds9579577%0.088%KF383036.1Select seq gb|KF383032.1|Zika virus strain ArD30101 envelope protein gene, partial cds9579577%0.088%KF383032.1Select seq gb|KF383034.1|Zika virus strain ArD30156 envelope protein gene, partial cds9539537%0.088%KF383034.1Select seq gb|KF383029.1|Zika virus strain ArD165522 envelope protein gene, partial cds9539537%0.088%KF383029.1Select seq gb|KF383033.1|Zika virus strain AnD30332 envelope protein gene, partial cds9489487%0.088%KF383033.1Select seq gb|EU303241.1|Zika virus note MR766 (p4 15/9/76) nonstructural protein 5 (NS5) gene, partial cds9469467%0.087%EU303241.1Select seq gb|KX101067.1|Zika virus isolate Bahia12, partial genome931670739%0.092%KX101067.1Select seq gb|KF383039.1|Zika virus strain HD78788 envelope protein gene, partial cds9309307%0.087%KF383039.1Select seq gb|KF383038.1|Zika virus strain ArA986 envelope protein gene, partial cds9309307%0.087%KF383038.1Select seq gb|KF383028.1|Zika virus strain ArD165531 envelope protein gene, partial cds9309307%0.087%KF383028.1Select seq gb|KF383031.1|Zika virus strain ArD9957 envelope protein gene, partial cds9269267%0.087%KF383031.1Select seq gb|KF383046.1|Zika virus strain ArA982 envelope protein gene, partial cds9219217%0.087%KF383046.1Select seq gb|KF383035.1|Zika virus strain MR1429 envelope protein gene, partial cds9019017%0.086%KF383035.1Select seq gb|KF383045.1|Zika virus strain ArA27106 envelope protein gene, partial cds8978977%0.087%KF383045.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds8958956%0.086%KU232300.1Select seq gb|KF383043.1|Zika virus strain ArA27443 envelope protein gene, partial cds8938937%0.086%KF383043.1Select seq gb|KX101063.1|Zika virus isolate Bahia05, partial genome890594234%0.090%KX101063.1Select seq gb|KF383041.1|Zika virus strain ArA27290 envelope protein gene, partial cds8888887%0.086%KF383041.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds8868866%0.086%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds8848846%0.086%KU232297.1Select seq gb|KF383042.1|Zika virus strain ArA27096 envelope protein gene, partial cds8848847%0.086%KF383042.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds8778776%0.086%KU232292.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds8758756%0.086%KU232294.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds8708706%0.086%KU232298.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds8668666%0.086%KU232296.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds8668666%0.086%KU232293.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds8618616%0.086%KU232295.1Select seq gb|KF383040.1|Zika virus strain ArA27101 envelope protein gene, partial cds8578577%0.085%KF383040.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds8508506%0.086%KU232288.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds8478476%0.086%KU232289.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds8438436%0.085%KU232299.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds8418416%0.085%KU232291.1Select seq dbj|AB908162.1|Zika virus gene for polyprotein, partial cds, strain: ZIKV Hu/Tahiti/01u/2014NIID8368364%0.099%AB908162.1Select seq gb|KF383083.1|Zika virus strain AnD30332 3' UTR8298295%0.095%KF383083.1Select seq gb|KF383052.1|Zika virus strain ArD165531 3' UTR8298295%0.095%KF383052.1Select seq gb|KF383064.1|Zika virus strain ArD127994 3' UTR8258255%0.094%KF383064.1Select seq gb|KF383049.1|Zika virus strain ArD7117 3' UTR8258255%0.094%KF383049.1Select seq gb|KF383048.1|Zika virus strain ArD9957 3' UTR8258255%0.094%KF383048.1Select seq gb|KF383047.1|Zika virus strain HD78788 3' UTR8218215%0.094%KF383047.1Select seq gb|KF383066.1|Zika virus strain ArD127987 3' UTR8208205%0.094%KF383066.1Select seq gb|KF383065.1|Zika virus strain ArD127988 3' UTR8208205%0.094%KF383065.1Select seq gb|KF383072.1|Zika virus strain ArA982 3' UTR8188185%0.094%KF383072.1Select seq gb|KF383054.1|Zika virus strain ArD158084 3' UTR8188185%0.094%KF383054.1Select seq gb|KF383069.1|Zika virus strain ArD127707 3' UTR8168165%0.094%KF383069.1Select seq gb|KF383073.1|Zika virus strain ArA975 3' UTR8148145%0.094%KF383073.1Select seq gb|KF383071.1|Zika virus strain ArA986 3' UTR8148145%0.094%KF383071.1Select seq gb|KF383074.1|Zika virus strain ArA506 3' UTR8098095%0.094%KF383074.1Select seq gb|KF383068.1|Zika virus strain ArD127710 3' UTR8078075%0.094%KF383068.1Select seq gb|KF383050.1|Zika virus strain ArD30156 3' UTR8018015%0.093%KF383050.1Select seq gb|KF383070.1|Zika virus strain ArB1362 3' UTR8008005%0.093%KF383070.1Select seq gb|KF383079.1|Zika virus strain ArA27106 3' UTR7987985%0.093%KF383079.1Select seq gb|KF383076.1|Zika virus strain ArA27407 3' UTR7927925%0.093%KF383076.1Select seq gb|KF383063.1|Zika virus strain ArD128000 3' UTR7927925%0.093%KF383063.1Select seq gb|KF383081.1|Zika virus strain ArA27096 3' UTR7897895%0.093%KF383081.1Select seq gb|KU867812.1|Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds7837835%0.090%KU867812.1Select seq gb|KF383080.1|Zika virus strain ArA27101 3' UTR7837835%0.093%KF383080.1Select seq gb|KF383075.1|Zika virus strain ArA27443 3' UTR7837835%0.093%KF383075.1Select seq gb|KF383051.1|Zika virus strain ArD30101 3' UTR7627625%0.092%KF383051.1Select seq gb|KF383017.1|Zika virus strain ArD149938 envelope protein gene, partial cds7087087%0.081%KF383017.1Select seq gb|KF383016.1|Zika virus strain ArD147917 envelope protein gene, partial cds7047047%0.081%KF383016.1Select seq gb|KF383015.1|Zika virus strain ArD149810 envelope protein gene, partial cds7047047%0.081%KF383015.1Select seq gb|KF383020.1|Zika virus strain ArA1465 envelope protein gene, partial cds6996997%0.081%KF383020.1Select seq gb|KF383021.1|Zika virus strain ArD132912 envelope protein gene, partial cds6976977%0.081%KF383021.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds695283865%0.069%DQ859064.1Select seq gb|KF383019.1|Zika virus strain ArD132915 envelope protein gene, partial cds6816817%0.080%KF383019.1Select seq gb|KF258813.1|Zika virus isolate Java non-structural protein 5 mRNA, partial cds6776773%0.097%KF258813.1Select seq gb|KU985088.1|Zika virus isolate MEX/InDRE/Zika-2/2015 envelope protein gene, partial cds6456453%8e-18099%KU985088.1Select seq gb|KX062045.1|Zika virus isolate Haiti/1230/2014 envelope protein gene, partial cds6216213%9e-17399%KX062045.1Select seq gb|KX062044.1|Zika virus isolate Haiti/1227/2014 envelope protein gene, partial cds6166163%4e-17199%KX062044.1Select seq gb|KF383103.1|Zika virus strain ArA986 nonstructural protein 5 gene, partial cds6166166%4e-17177%KF383103.1Select seq gb|KF383086.1|Zika virus strain ArA975 nonstructural protein 5 gene, partial cds6166166%4e-17177%KF383086.1Select seq gb|KF383104.1|Zika virus strain ArA982 nonstructural protein 5 gene, partial cds5925926%4e-16476%KF383104.1Select seq gb|KF383085.1|Zika virus strain ArD9957 nonstructural protein 5 gene, partial cds5805806%3e-16076%KF383085.1Select seq gb|KR815989.1|Zika virus isolate 15095 envelope protein gene, partial cds5785783%9e-16099%KR815989.1Select seq gb|KF383114.1|Zika virus strain AnD30332 nonstructural protein 5 gene, partial cds5715716%1e-15775%KF383114.1Select seq gb|KF383088.1|Zika virus strain ArD30101 nonstructural protein 5 gene, partial cds5715716%1e-15775%KF383088.1Select seq gb|KF383106.1|Zika virus strain ArA27443 nonstructural protein 5 gene, partial cds5655656%6e-15675%KF383106.1Select seq gb|KF383087.1|Zika virus strain ArD30156 nonstructural protein 5 gene, partial cds5655656%6e-15675%KF383087.1Select seq gb|KF383107.1|Zika virus strain ArA27407 nonstructural protein 5 gene, partial cds5625626%7e-15575%KF383107.1Select seq gb|KF383089.1|Zika virus strain ArD165531 nonstructural protein 5 gene, partial cds5535536%4e-15275%KF383089.1Select seq gb|KF383062.1|Zika virus strain ArD132912 3' UTR5535535%4e-15283%KF383062.1Select seq gb|EU082199.2|Yaounde virus strain Dak Ar Y276 polyprotein gene, complete cds549131837%5e-15168%EU082199.2Select seq gb|KF383101.1|Zika virus strain ArD127710 nonstructural protein 5 gene, partial cds5475476%2e-15075%KF383101.1Select seq gb|KF383097.1|Zika virus strain ArD127994 nonstructural protein 5 gene, partial cds5475476%2e-15075%KF383097.1Select seq gb|KF383099.1|Zika virus strain ArD127987 nonstructural protein 5 gene, partial cds5445446%2e-14974%KF383099.1Select seq gb|KF383082.1|Zika virus strain ArA1465 3' UTR5445445%2e-14983%KF383082.1Select seq gb|KF383098.1|Zika virus strain ArD127988 nonstructural protein 5 gene, partial cds5385386%8e-14874%KF383098.1Select seq gb|KF383056.1|Zika virus strain ArD149938 3' UTR5385385%8e-14883%KF383056.1Select seq gb|KR816334.1|Zika virus isolate BR/UFBA/LabViro/Ex1 envelope protein gene, partial cds5365362%3e-14799%KR816334.1Select seq gb|KF383057.1|Zika virus strain ArD147917 3' UTR5365365%3e-14783%KF383057.1Select seq gb|KR816333.1|Zika virus isolate BR/UFBA/LabViro/23 envelope protein gene, partial cds5355352%1e-14699%KR816333.1Select seq gb|KM212966.1|Zika virus isolate NC13(FP)-26112013-22072 glycoprotein gene, partial cds5355352%1e-146100%KM212966.1Select seq gb|KF383061.1|Zika virus strain ArD132915 3' UTR5355355%1e-14683%KF383061.1Select seq gb|EF158064.1|St. Louis encephalitis virus strain GML 902612 polyprotein gene, partial cds535145839%1e-14667%EF158064.1Select seq gb|KR816335.1|Zika virus isolate BR/UFBA/LabViro/18 envelope protein gene, partial cds5315312%1e-14598%KR816335.1Select seq gb|KM212965.1|Zika virus isolate NC13(FP)-20112013-22015 glycoprotein gene, partial cds5295292%4e-14599%KM212965.1Select seq gb|KM212964.1|Zika virus isolate NC14-17042014-4554 glycoprotein gene, partial cds5295292%4e-14599%KM212964.1Select seq gb|KM212963.1|Zika virus isolate NC14-23012014-250 glycoprotein gene, partial cds5295292%4e-14599%KM212963.1Select seq gb|EF158060.1|St. Louis encephalitis virus strain GML 903797 polyprotein gene, partial cds529137138%4e-14567%EF158060.1Select seq gb|KF383084.1|Zika virus strain HD78788 nonstructural protein 5 gene, partial cds5115116%1e-13973%KF383084.1Select seq gb|KJ579441.1|Zika virus isolate PF13-CP221013c polyprotein gene, partial cds5085082%1e-138100%KJ579441.1Select seq gb|KF383113.1|Zika virus strain ArA1465 nonstructural protein 5 gene, partial cds5085086%1e-13873%KF383113.1Select seq gb|KX101065.1|Zika virus isolate Bahia15, partial genome506605534%5e-13898%KX101065.1Select seq gb|GQ851604.1|West Nile virus strain G15578 polyprotein gene, complete cds504133137%2e-13767%GQ851604.1Select seq gb|KJ680134.1|Zika virus strain PF13-091213-121 polyprotein gene, partial cds5025022%6e-13799%KJ680134.1Select seq gb|EF158062.1|St. Louis encephalitis virus strain FL 79-411 polyprotein gene, partial cds502137538%6e-13767%EF158062.1Select seq gb|JX041632.1|West Nile virus strain Ig2266, complete genome497138338%2e-13567%JX041632.1Select seq gb|DQ256376.1|West Nile virus strain 804994, complete genome493123435%3e-13467%DQ256376.1Select seq gb|EF158058.1|St. Louis encephalitis virus strain Kern 217 polyprotein gene, partial cds486134238%5e-13266%EF158058.1Select seq gb|DQ525916.1|St. Louis encephalitis virus strain Kern217, complete genome486134238%5e-13266%DQ525916.1Select seq gb|FJ753286.2|St. Louis encephalitis virus strain CbaAr-4005, complete genome477143136%2e-12967%FJ753286.2Select seq gb|KT823415.1|St. Louis encephalitis virus strain RT 121B polyprotein gene, complete cds468142536%1e-12666%KT823415.1Select seq gb|FJ753287.2|St. Louis encephalitis virus strain 79V-2533, complete genome462139139%5e-12566%FJ753287.2Select seq gb|KJ501495.1|West Nile virus isolate WNV-1/US/BID-V6530/2002, complete genome443120637%5e-11966%KJ501495.1Select seq gb|KU758878.1|Zika virus polyprotein gene, partial cds4395393%6e-11898%KU758878.1Select seq gb|KU954085.1|Zika virus isolate ZIKCOLSC67 polyprotein gene, partial cds4254252%1e-11399%KU954085.1Select seq gb|KR348977.1|West Nile virus isolate INYO_25_2011 polyprotein gene, partial cds425116937%1e-11366%KR348977.1Select seq gb|KR348976.1|West Nile virus isolate INYO_2_2011 polyprotein gene, partial cds425116937%1e-11366%KR348976.1Select seq gb|KF270887.1|Zika virus strain CCB-870 NS3 protein gene, partial cds4255864%1e-11388%KF270887.1Select seq gb|KU926326.1|Zika virus isolate Zika 2235 Israel ex Colombia 2015 polyprotein gene, partial cds4174172%2e-111100%KU926326.1Select seq gb|KU926325.1|Zika virus isolate Zika 356 Israel ex Mexico 2016 polyprotein gene, partial cds4174172%2e-111100%KU926325.1Select seq gb|KU926324.1|Zika virus isolate Zika 352 Israel ex Vietnam 2016 polyprotein gene, partial cds4174172%2e-111100%KU926324.1Select seq gb|KU926323.1|Zika virus isolate Zika 269 Israel ex Colombia 2016 polyprotein gene, partial cds4174172%2e-111100%KU926323.1Select seq gb|KT381874.1|Zika virus strain Zika1697_BR-RJ/2015 envelope protein gene, partial cds4164162%7e-11199%KT381874.1Select seq gb|KM212961.1|Zika virus isolate NC14-17042014-4554 polyprotein gene, partial cds4084082%1e-108100%KM212961.1
  5. LOCUS KX101060 10331 bp RNA linear VRL 26-APR-2016 DEFINITION Zika virus isolate Bahia02, partial genome. ACCESSION KX101060 VERSION KX101060.1 GI:1022831289 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10331) AUTHORS Naccache,S.N., Theze,J., Sardi,S.I., Somasekar,S., Greninger,A.L., Bandeira,A.C., Campos,G.S., Tauro,L.B., Faria,N.R., Pybus,O.G. and Chiu,C.Y. TITLE Discovery of a persistent Zika virus lineage in Bahia, Brazil JOURNAL Unpublished REFERENCE 2 (bases 1 to 10331) AUTHORS Naccache,S.N., Somasekar,S., Sardi,S.I., Bandeira,A.C., Campos,G.S. and Chiu,C.Y. TITLE Direct Submission JOURNAL Submitted (22-APR-2016) Laboratory Medicine, University of California, San Francisco, 185 Berry Street, #0134, San Francisco, CA 94107, USA COMMENT ##Assembly-Data-START## Assembly Method :: SURP+ v. 1.0 2016; Geneious v. 6.1.8 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10331 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Bahia02" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="May-2015" CDS <1..10032 /codon_start=1 /product="polyprotein" /protein_id="ANA85187.1" /db_xref="GI:1022831290" /translation="IKKFKKDLAAMLRIINARKEKKRRGADTSVGIVGLLLTTAMAAE VTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXVVYGTCHHKKGEARRSRRAVTLPSHSTRKLQTRSQTXLESREY TKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKVIYLVMILLIAPAYSIRCIGVSN RDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASIS DMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKK MTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGG FGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNKE ALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKL RLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVG RLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEAT VRGAKRMAVLGDTAWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXGICGISSVSRMENIMWRSVEGELNAILEENGV QLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGKSYFVRAAKTNNSFVXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX GYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTRGPSLRSTTASGRVIEEWCCXXX XXXPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTAGSTDHMDHFSLGVLVILLMVQE GLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLAILMGATFAEMNTGGDVAHLALI AAFKVRPALLVSFIFRANWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXLGLTAVRLVDPINVVGLLLLTRSGKRXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX VEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWYVYVKTGKRSGALWDVPAPKEVK KGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGSALRSGEGRLDPYWGDV KQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARNIQTLPGIFKTKDGDIGAVALDY PAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGRREEETPVECFEPSMLKKKQ LTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAPTRVVAAEMEEALRGLPVRYMTT AVNVTHSGTEIVDLMCHAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXNGNEIAACLTKAGKRVIQLSRKTFETEFQKTKHQEWDFVVTTDISXXXXXXXX XXXXXXXXXXXXXXXXXXXVILAGPMPVTHASAAQRRGRIGRNPNKPGDEYLYGGGCA ETDEDHAHWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX KRGDLPVWLAYQVASAGITYTDRRWCFDSTTNNTIMEDSVPAEVWTRHGEKRVLKPRW MDARVCSDHAALKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVLMRAE TGSRPYKAAAAQMPETLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLXASAW LMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSPQDNQMAIIIMVAVGLLGLITAN ELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPASAWAIYAALTTFITPAVQHAVT TSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPLLMIGCYSQLTPLTLIVAIILLV AHYMYLIPGLQAAAARAAQKRTAAGXXXXXXXXXXXXTDIDTMTIDPQVEKKMGQVLL IAVAVSSAXLSRTAWGWGEAGALITAATSTLWEGSPNKYWNSSTATSLXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCREEA RRALKDGVATGGHAVSRGSAKLRWLVERGYLQPHGKVIDLGCGRGGWSYYAATIRKVQ EVXXXXXXXXGHEEPVLVQSYGWNIVRLKSGVDVFHMAAEPCDTLLCDIGESSSSPEV EEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMMETLERLQRRYGGGLVRVPLSRN STHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRPVKYEEDVNLGSGTRAVVSCAEA PNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHGSYEAPTQGSASSLINGVVRLLS KPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPDPQEGTRQVMSMVSSWLWKELGK HKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAVEAVNDPRFWALVDKEREHHLRG ECQSXXXNMMGKREKKQGEFGKAKGSRAIWYMWLGARFLEFEALGFLNEDHWMGRENS GGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWDTRISRFDLENEALITNQMEKGH RALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQDQRGSGQVVTYALNTFTNLXXX XXXXXXXXXXXEMQDLWLLRRPEKVTNWLQSNGWDRLXXXXXXXXXXXXXXXXXXFAH ALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHHFNKLHLKDGRSIVVPCRHQDEL IGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRRDLRLMANAICSSVPVDWVPTGR TTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKTPVTKWTDIPYLGKREDLWCGSL IGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLSTQVRYLGEEGSTPGVL" mat_peptide 1..135 /product="capsid peptide" mat_peptide 136..405 /product="propeptide" mat_peptide 406..630 /product="membane protein peptide" mat_peptide 631..2145 /product="envelope protein peptide" mat_peptide 2146..3231 /product="NS1 peptide" mat_peptide 3232..3885 /product="NS2A peptide" mat_peptide 3886..4317 /product="NS2B peptide" mat_peptide 4318..6126 /product="NS3 peptide" mat_peptide 6127..6567 /product="NS4A peptide" mat_peptide 6568..8073 /product="NS4B peptide" mat_peptide 8074..10029 /product="NS5 peptide" gap 1919..2298 /estimated_length=380 gap 2546..2915 /estimated_length=370 gap 3496..3796 /estimated_length=301 gap 3877..4134 /estimated_length=258 gap 5059..5366 /estimated_length=308 gap 5728..5873 /estimated_length=146 gap 6088..6200 /estimated_length=113 gap 7238..7424 /estimated_length=187 3'UTR 10033..10331 ORIGIN 1 ataaagaagt tcaagaaaga tctggctgcc atgctgagaa taatcaatgc taggaaggag 61 aagaagagac gaggcgcaga tactagtgtc ggaattgttg gcctcctgct gaccacagct 121 atggcagcgg aggtcactag acgtgggagt gcatactata tgtacttgga cagaaacgat 181 gctggggagg ccatatcttt tccaaccaca ttggggatga ataagtgtta tatacagatc 241 atggatcttg gacacannnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 301 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttgtgtac 361 ggaacctgcc atcacaaaaa aggtgaagca cggagatcta gaagagctgt gacgctcccc 421 tcccattcca ctaggaagct gcaaacgcgg tcgcaaacct gkttggaatc aagagaatac 481 acaaagcact tgattagagt cgaaaattgg atattcagga accctggctt cgcgttagca 541 gcagctgcca tcgcttggct tttgggaagc tcaacgagcc aaaaagtcat atacttggtc 601 atgatactgc tgattgcccc ggcatacagc atcaggtgca taggagtcag caatagggac 661 tttgtggaag gtatgtcagg tgggacttgg gttgatgttg tcttggaaca tggaggttgt 721 gtcaccgtaa tggcacagga caaaccgact gtcgacatag agctggttac aacaacagtc 781 agcaacatgg cggaggtaag atcctactgc tatgaggcat caatatcaga catggcttcg 841 gacagccgct gcccaacaca aggtgaagcc taccttgaca agcaatcaga cactcaatat 901 gtctgcaaaa gaacgttagt ggacagaggc tggggaaatg gatgtggact ttttggcaaa 961 gggagtctgg tgacatgcgc taagtttgca tgctccaaga aaatgaccgg gaagagcatc 1021 cagccagaga atctggagta ccggataatg ctgtcagttc atggctccca gcacagtggg 1081 atgatcgtta atgacacagg acatgaaact gatgagaata gagcgaaggt tgagataacg 1141 cccaattcac caagagccga agccaccctg gggggttttg gaagcctagg acttgattgt 1201 gaaccgagga caggccttga cttttcagat ttgtattact tgactatgaa taacaagcac 1261 tggttggttc acaaggagtg gttccacgac attccattac cttggcacgc tggggcagac 1321 accggaactc cacactggaa caacaaagaa gcactggtag agttcaagga cgcacatgcc 1381 aaaaggcaaa ctgtcgtggt tctagggagt caagaaggag cagttcacac ggcccttgct 1441 ggagctctag aggctgagat ggatggtgca aagggaaggc tgtcctctgg ccacttgaaa 1501 tgtcgcctga aaatggataa acttagattg aagggcgtgt catactcctt gtgtaccgca 1561 gcgttcacat tcaccaagat cccggctgaa acactgcacg ggacagtcac agtggaggta 1621 cagtacgcag ggactgatgg accttgcaag gttccagctc agatggcggt ggacatgcaa 1681 actctgaccc cagttgggag gttgataacc gctaaccccg taatcactga aagcactgag 1741 aactctaaga tgatgctgga acttgatcca ccatttgggg actcctacat tgtcatagga 1801 gtcggggaga agaagatcac ccaccactgg cacaggagtg gcagcaccat tggaaaagca 1861 tttgaagcca ctgtgagagg tgccaagaga atggcagtct tgggagacac agcctggg [gap 380 bp] Expand Ns 2299 gg tatctgcggg atctcctctg tttcaagaat ggaaaacatc 2341 atgtggagat cagtagaagg ggagctcaac gcaatcctgg aagagaatgg agttcaactg 2401 acggtcgttg tgggatctgt aaaaaacccc atgtggagag gtccacagag attgcccgtg 2461 cctgtgaacg agctgcccca cggctggaag gcttggggga aatcgtactt cgtcagagca 2521 gcaaagacaa ataacagctt tgtcg [gap 370 bp] Expand Ns 2916 gggct acaggaccca aatgaaaggg 2941 ccatggcaca gtgaagagct tgaaattcgg tttgaggaat gcccaggcac taaggtccac 3001 gtggaggaaa catgtggaac aagaggacca tctctgagat caaccactgc aagcggaagg 3061 gtgatcgagg aatggtgctg cagnnnnnnn nnnnnnnccc cactgtcgtt ccgggctaaa 3121 gatggctgtt ggtatggaat ggagataagg cccaggaaag aaccagaaag caacttagta 3181 aggtcaatgg tgactgcagg atcaactgat cacatggatc acttctccct tggagtgctt 3241 gtgattctgc tcatggtgca ggaagggctg aagaagagaa tgaccacaaa gatcatcata 3301 agcacatcaa tggcagtgct ggtagctatg atcctgggag gattttcaat gagtgacctg 3361 gctaagcttg caattttgat gggtgccacc ttcgcggaaa tgaacactgg aggagatgta 3421 gctcatctgg cgctgatagc ggcattcaaa gtcagaccag cgttgctggt atctttcatc 3481 ttcagagcta attgg [gap 301 bp] Expand Ns 3797 ccct gggactaacc gctgtgaggc tggtcgaccc catcaacgtg 3841 gtgggactgc tgttgctcac aaggagtggg aagcgg [gap 258 bp] Expand Ns 4135 gtggag 4141 gatgacggtc cccccatgag agagatcata ctcaaggtgg tcctgatgac catctgtggc 4201 atgaacccaa tagccatacc ctttgcagct ggagcgtggt acgtatacgt gaagactgga 4261 aaaaggagtg gtgctctatg ggatgtgcct gctcccaagg aagtaaaaaa gggggagacc 4321 acagatggag tgtacagagt aatgactcgt agactgctag gttcaacaca agttggagtg 4381 ggagttatgc aagagggggt ctttcacact atgtggcacg tcacaaaagg atccgcgctg 4441 agaagcggtg aagggagact tgatccatac tggggagatg tcaagcagga tctggtgtca 4501 tactgtggtc catggaagct agatgccgcc tgggacgggc acagcgaggt gcagctcttg 4561 gccgtgcccc ccggagagag agcgaggaac atccagactc tgcccggaat atttaagaca 4621 aaggatgggg acattggagc ggttgcgctg gattacccag caggaacttc aggatctcca 4681 atcctagaca agtgtgggag agtgatagga ctttatggca atggggtcgt gatcaaaaat 4741 gggagttatg ttagtgccat cacccaaggg aggagggagg aagagactcc tgttgagtgc 4801 ttcgagcctt cgatgctgaa gaagaagcag ctaactgtct tagacttgca tcctggagct 4861 gggaaaacca ggagagttct tcctgaaata gtccgtgaag ccataaaaac aagactccgt 4921 actgtgatct tagctccaac cagggttgtc gctgctgaaa tggaggaagc ccttagaggg 4981 cttccagtgc gttatatgac aacagcagtc aatgtcaccc actctggaac agaaatcgtc 5041 gacttaatgt gccatgcc [gap 308 bp] Expand Ns 5367 gaac ggcaatgaga tcgcagcttg tctgacaaag 5401 gctggaaaac gggtcataca gctcagcaga aagacttttg agacagagtt ccagaaaaca 5461 aaacatcaag agtgggactt tgtcgtgaca actgacattt cagnnnnnnn nnnnnnnnnn 5521 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 5581 nnagtcattc tggctggacc catgcctgtc acacatgcca gcgctgccca gaggaggggg 5641 cgcataggca ggaatcccaa caaacctgga gatgagtatc tgtatggagg tgggtgcgca 5701 gagactgacg aagaccatgc acactgg [gap 146 bp] Expand Ns 5874 gaaaaga 5881 ggagatcttc ctgtttggct ggcctatcag gttgcatctg ccggaataac ctacacagat 5941 agaagatggt gctttgatag cacgaccaac aacaccataa tggaagacag tgtgccggca 6001 gaggtgtgga ccagacacgg agagaaaaga gtgctcaaac cgaggtggat ggatgccaga 6061 gtttgttcag atcatgcggc cctgaag [gap 113 bp] Expand Ns 6201 cgctgtgctc atgcgggcag agactggaag caggccttac 6241 aaagccgcgg cggcccaaat gccggagacc ctagagacca ttatgctttt ggggttgcta 6301 ggaacagtct cgctgggaat ctttttcgtc ttgatgagga acaagggcat agggaagatg 6361 ggctttggaa tggtgactct trgggccagc gcatggctca tgtggctctc ggaaattgag 6421 ccagccagaa ttgcatgtgt cctcattgtt gtgttcctat tgctggtggt gctcatacct 6481 gagccagaaa agcaaagatc tccccaggac aaccaaatgg caatcatcat catggtagca 6541 gtaggtcttc tgggcttgat taccgccaat gaactcggat ggttggagag aacaaagagt 6601 gacctaagcc atctaatggg aaggagagag gagggggcaa ccataggatt ctcaatggac 6661 attgacctac ggccagcctc agcttgggcc atctatgctg ccttgacaac tttcattacc 6721 ccagccgtcc aacatgcagt gaccacttca tacaacaact actccttaat ggcgatggcc 6781 acgcaagctg gagtgttgtt tggtatgggc aaagggatgc cattctacgc atgggacttt 6841 ggagtcccgc tgctaatgat aggttgctac tcacaattaa cacccctgac cctaatagtg 6901 gccatcattt tgctcgtggc gcactacatg tacttgatcc cagggctgca ggcagcagct 6961 gcgcgtgctg cccagaagag aacggcagct ggcannnnnn nnnnnnnnnn nnnnnnnnnn 7021 nnnnnnnnga ctgacattga cacaatgaca attgaccccc aagtggagaa aaagatggga 7081 caggtgctac tcatagcagt agccgtctcc agcgccntac tgtcgcggac cgcctggggg 7141 tggggggagg ctggggccct gatcacagcc gcaacttcca ctttgtggga aggctctccg 7201 aacaagtact ggaactcctc tacagccact tcactgt [gap 187 bp] Expand Ns 7425 gtgcag agaagaggcc 7441 cgccgcgccc tcaaggacgg tgtggcaacg ggaggccatg ctgtgtcccg aggaagtgca 7501 aagctgagat ggttggtgga gcggggatac ctgcagcccc atggaaaggt cattgatctt 7561 ggatgtggca gagggggctg gagttactac gccgccacca tccgcaaagt tcaagaagtg 7621 aannnnnnnn nnnnnnnnnn nnnnggtcat gaagaacccg tgttggtgca aagctatggg 7681 tggaacatag tccgtcttaa gagtggggtg gacgtctttc atatggcggc tgagccgtgt 7741 gacacgttgc tgtgtgacat aggtgagtca tcatctagtc ctgaagtgga agaagcacgg 7801 acgctcagag ttctctccat ggtgggggat tggcttgaaa aaagaccagg agccttttgt 7861 ataaaagtgt tgtgcccata caccagcact atgatggaaa ccctggagcg actgcagcgt 7921 aggtatgggg gaggactggt cagagtgcca ctctcccgca actctacaca tgagatgtac 7981 tgggtctctg gagcgaaaag caacaccata aaaagtgtgt ccaccacgag ccagctcctc 8041 ttggggcgca tggacgggcc taggaggcca gtgaaatatg aggaggatgt gaatctcggc 8101 tctggcacgc gggctgtggt aagctgcgct gaagctccca acatgaagat cattggtaac 8161 cgcattgaaa ggatccgcag tgagcacgcg gaaacgtggt tctttgacga gaaccaccca 8221 tataggacat gggcttacca tggaagctat gaggccccca cacaagggtc agcgtcctct 8281 ctaataaacg gggttgtcag gctcctgtca aaaccctggg atgtggtgac tggagtcaca 8341 ggaatagcca tgaccgacac cacaccgtat ggtcagcaaa gagttttcaa ggaaaaagtg 8401 gacactaggg tgccagaccc ccaagaaggc actcgtcagg ttatgagcat ggtctcttcc 8461 tggttgtgga aagagctagg caaacacaaa cggccacgag tctgtaccaa agaagagttc 8521 atcaacaagg ttcgtagcaa tgcagcatta ggggcaatat ttgaagagga aaaagagtgg 8581 aagactgcag tggaagctgt gaacgatcca aggttctggg ctctagtgga caaggaaaga 8641 gagcaccacc tgagaggaga gtgccagagt tgnnnnnnca acatgatggg aaaaagagaa 8701 aagaaacaag gggaatttgg aaaggccaag ggcagccgcg ccatctggta tatgtggcta 8761 ggggctagat ttctagagtt cgaagccctt ggattcttga acgaggatca ctggatgggg 8821 agagagaact caggaggtgg tgttgaaggg ctgggattac aaagactcgg atatgtccta 8881 gaagagatga gtcgcatacc aggaggaagg atgtatgcag atgacactgc tggctgggac 8941 acccgcatca gcaggtttga tctggagaat gaagctctaa tcaccaacca aatggagaaa 9001 gggcacaggg ccttggcatt ggccataatc aagtacacat accaaaacaa agtggtaaag 9061 gtccttagac cagctgaaaa agggaaaaca gttatggaca ttatttcgag acaagaccaa 9121 agggggagcg gacaagttgt cacttacgct ctcaacacat ttaccaacct agnnnnnnnn 9181 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nncgagatgc aagacttgtg gctgctgcgg 9241 aggccagaga aagtgaccaa ctggttgcag agcaacggat gggataggct nnnnnnnnnn 9301 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnggtttgc acatgccctc 9361 aggttcttga atgatatggg aaaagttagg aaggacacac aagagtggaa accctcaact 9421 ggatgggaca actgggaaga agttccgttt tgctcccacc acttcaacaa gctccatctc 9481 aaggacggga ggtccattgt ggttccctgc cgccaccaag atgaactgat tggccgggcc 9541 cgcgtctctc caggggcggg atggagcatc cgggagactg cttgcctagc aaaatcatat 9601 gcgcaaatgt ggcagctcct ttatttccac agaagggacc tccgactgat ggccaatgcc 9661 atttgctcat ctgtgccagt tgactgggtt ccaactggga gaactacctg gtcaatccat 9721 ggaaagggag aatggatgac cactgaagac atgcttgtgg tgtggaacag agtgtggatt 9781 gaggagaacg accacatgga agacaagacc ccagttacga aatggacaga cattccctat 9841 ttgggaaaaa gggaagactt gtggtgtgga tctctcatag ggcacagacc gcgcaccacc 9901 tgggctgaga acattaaaaa cacagtcaac atggtgcgca ggatcatagg tgatgaagaa 9961 aagtacatgg actacctatc cacccaagtt cgctacttgg gtgaagaagg gtctacacct 10021 ggagtgctgt aagcaccaat cttaatgttg tcaggcctgc tagtcagcca cagcttgggg 10081 aaagctgtgc agcctgtgac ccccccagga gaagctggga aaccaagcct atagtcaggc 10141 cgagaacgcc atggcacgga agaagccatg ctgcctgtga gcccctcaga ggacactgag 10201 tcaaaaaacc ccacgcgctt ggaggcgcag gatgggaaaa gaaggtggcg accttcccca 10261 cccttcaatc tggggcctga actggagatc agctgtggat ctccagaaga gggactagtg 10321 gttagaggag a
  6. UCSF researchers have released a series of partial Bahia, Brazil sequence.
  7. Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  8. Alameda 4 0 Contra Costa 3 0 Los Angeles 10 0 Napa 1 0 Orange 2 0 San Bernardino 2 0 San Diego 11** 0 San Francisco 2 0 San Joaquin 2 0 San Mateo 2 0 Santa Clara 1 0 Sonoma 1 0 Yolo 2 0 Total 43 0
  9. Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  10. April 29, 2016 DEPARTMENT OF HEALTH DAILY ZIKA UPDATE: TWO NEW TRAVEL-RELATED CASES TODAY IN ORANGE AND PASCO COUNTIES Contact:Communications [email protected](850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the Florida Department of Health will issue a Zika virus update each week day at 2 p.m. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. There are two new travel-related cases today with one in Pasco County and one in Orange County. The Declaration of Public Health Emergency has been updated to include Pasco County. Of the cases confirmed in Florida, three cases are still exhibiting symptoms. According to the CDC, symptoms associated with the Zika virus last between seven to 10 days. Based on CDC guidance, several pregnant women who have traveled to countries with local-transmission of Zika have received antibody testing, and of those, five have tested positive for the Zika virus. The CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. It is recommended that women who are pregnant or thinking of becoming pregnant postpone travel to Zika affected areas. County Number of Cases (all travel related) Alachua 4 Brevard 2 Broward 15 Clay 1 Collier 1 Hillsborough 3 Lee 4 Miami-Dade 39 Orange 6 Osceola 4 Palm Beach 5 Pasco 1 Polk 3 Santa Rosa 1 Seminole 1 St. Johns 1 Cases involving pregnant women* 5 Total 96 *Counties of pregnant women will not be shared. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 1,559 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. All cases are travel-associated. There have been no locally-acquired cases of Zika in Florida. For more information on the Zika virus, click here. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. More Information on DOH action on Zika: On Feb. 3, Governor Scott directed the State Surgeon General to issue a Declaration of Public Health Emergency for the counties of residents with travel-associated cases of Zika.There have been 16 counties included in the declaration– Alachua, Brevard, Broward, Clay, Collier, Hillsborough, Lee, Miami-Dade, Orange, Osceola, Palm Beach, Pasco, Polk, Santa Rosa, Seminole and St. Johns – and will be updated as needed. DOH encourages Florida residents and visitors to protect themselves from all mosquito-borne illnesses by draining standing water; covering their skin with repellent and clothing; and covering windows with screens.DOH has a robust mosquito-borne illness surveillance system and is working with the CDC, the Florida Department of Agriculture and Consumer Services and local county mosquito control boards to ensure that the proper precautions are being taken to protect Florida residents and visitors.On April 6, Governor Rick Scott and Interim State Surgeon General Dr. Celeste Philip hosted a conference call with Florida Mosquito Control Districts to discuss ongoing preparations to fight the possible spread of the Zika virus in Florida. There were 74 attendees on the call.Florida currently has the capacity to test 6,565 people for active Zika virus and 1,396 for Zika antibodies.Federal Guidance on Zika: According to the CDC, Zika illness is generally mild with a rash, fever and joint pain. CDC researchers have concluded that Zika virus is a cause of microcephaly and other birth defects.The FDA released guidance regarding donor screening, deferral and product management to reduce the risk of transfusion-transmission of Zika virus. Additional information is available on the FDA website here.The CDC has put out guidance related to the sexual transmission of the Zika virus. This includes the CDC recommendation that if you have traveled to a country with local transmission of Zika you should abstain from unprotected sex.For more information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov. http://www.floridahealth.gov/newsroom/2016/04/042916-zika-update.html
  11. County Number of Cases (all travel related) Alachua 4 Brevard 2 Broward 15 Clay 1 Collier 1 Hillsborough 3 Lee 4 Miami-Dade 39 Orange 6 Osceola 4 Palm Beach 5 Pasco 1 Polk 3 Santa Rosa 1 Seminole 1 St. Johns 1 Cases involving pregnant women* 5 Total 96
  12. Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=1FlIB7hHnVgGD9TlbSx5HwAj-PEQ
  13. FOR IMMEDIATE RELEASE April 29, 2016 South Carolina confirms first travel-associated case of Zika virusCOLUMBIA, S.C. – The S.C. Department of Health and Environmental Control (DHEC) announced today the first case of travel-associated Zika virus infection in a South Carolina resident. The case was confirmed in a person who recently traveled to a country with active transmission of the Zika virus. The individual did not have symptoms and was not contagious by the time they returned to the United States. Therefore, there is no risk to public health and no risk of transmission to people or mosquitoes in South Carolina at this time. To protect patient confidentiality no additional details on this individual will be provided. "We had expected to see a case appear in South Carolina eventually as more people vacation to countries where the Zika virus is actively spreading," said Teresa Foo, M.D. and DHEC medical consultant. "As our state's public health agency, we actively monitor for the arrival of new diseases in South Carolina in an effort to help stop the spread of the illness." Mosquitoes in South Carolina do not carry the Zika virus at this time. While the primary mosquito that can carry Zika virus, Aedes aegypti, is only found in small numbers in the Lowcountry, another possible carrier, Aedes albopictus, is more common. DHEC encourages all individuals, as a routine precaution, to protect themselves against mosquito bites. Mosquitoes in some other countries carry the virus and transmit it through biting. When traveling to any country with active Zika transmission, travelers should proactively take steps to prevent mosquito bites, such as: using insect repellent,wearing long sleeves and pants,staying in places with air conditioning or that use window and door screens.Most people infected with the Zika virus do not have any symptoms. When symptoms are present, the most common are fever, rash, joint pain and conjunctivitis (red eyes). Oftentimes, symptoms of Zika infection can be mild, yet last as long as one week. Zika virus can be passed from a pregnant woman to her fetus, and infection during pregnancy can cause serious birth defect of the brain called microcephaly and other severe birth defects. The CDC recommends that all women who are pregnant should not travel to areas abroad where Zika virus transmission is ongoing. Learn more about Zika and how to protect yourself at www.scdhec.gov/Zika. Read CDC's travel health notices at www.cdc.gov/travel/notices. ### NOTE TO EDITORS AND REPORTERS: Due to federal and state privacy restrictions, DHEC is unable to provide additional information concerning any individual, including details about physical condition, hospitalization, age, sex, and residence. CONTACT: Jennifer Read, Chief Communications Officer [email protected] (803) 898-1127
  14. The S.C. Department of Health and Environmental Control (DHEC) announced today the first case of travel-associated Zika virus infection in a South Carolina resident. The case was confirmed in a person who recently traveled to a country with active transmission of the Zika virus. The individual did not have symptoms and was not contagious by the time they returned to the United States. http://www.scdhec.gov/Agency/NewsReleases/2016/nr20160429-01/
  15. Zika Virus InformationAs of April 29, 2016 there is one confirmed travel-associated case of Zika virus in South Carolina.
  16. ReferencesPetersen LR, Jamieson DJ, Powers AM, Honein MA. Zika virus. N Engl J Med 2016;374:1552–63. CrossRef PubMedRasmussen SA, Jamieson DJ, Honein MA, Petersen LR. Zika virus and birth defects—reviewing the evidence for causality. N Engl J Med 2016. Epub April 13, 2016.http://www.nejm.org/doi/full/10.1056/NEJMsr1604338http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=27074377&dopt=Abstract PubMedCao-Lormeau VM, Blake A, Mons S, et al. Guillain-Barré syndrome outbreak associated with Zika virus infection in French Polynesia: a case-control study. Lancet 2016;387:1531–9.CrossRef PubMedThomas DL, Sharp TM, Torres J, et al. Local transmission of Zika virus—Puerto Rico, November 23, 2015-January 28, 2016. MMWR Morb Mortal Wkly Rep 2016;65:154–8. CrossRefPubMedOster AM, Russell K, Stryker JE, et al. Update: interim guidance for prevention of sexual transmission of Zika virus—United States, 2016. MMWR Morb Mortal Wkly Rep 2016;65:323–5.CrossRef PubMedPetersen EE, Polen KN, Meaney-Delman D, et al. Update: interim guidance for health care providers caring for women of reproductive age with possible Zika virus exposure—United States, 2016. MMWR Morb Mortal Wkly Rep 2016;65:315–22. CrossRef PubMedVasquez AM, Sapiano MR, Basavaraju SV, Kuehnert MJ, Rivera-Garcia B. Survey of blood collection centers and implementation of guidance for prevention of transfusion-transmitted Zika virus infection—Puerto Rico, 2016. MMWR Morb Mortal Wkly Rep 2016;65:375–8. CrossRef PubMedTepper NK, Goldberg HI, Bernal MI, et al. Estimating contraceptive needs and increasing access to contraception in response to the Zika virus disease outbreak—Puerto Rico, 2016. MMWR Morb Mortal Wkly Rep 2016;65:311–4. CrossRef PubMedBrasil P, Calvet GA, Siqueira AM, et al. Zika virus outbreak in Rio de Janeiro, Brazil: clinical characterization, epidemiological and virological aspects. PLoS Negl Trop Dis 2016;10:e0004636.CrossRef PubMedSarmiento-Ospina A, Vásquez-Serna H, Jimenez-Canizales CE, Villamil-Gómez WE, Rodriguez-Morales AJ. Zika virus associated deaths in Colombia. Lancet Infect Dis 2016;16:523–4.CrossRef PubMed Top * http://www.cdc.gov/zika/. † http://www.salud.gov.pr/Sobre-tu-Salud/Pages/Condiciones/Zika.aspx. § http://www.salud.gov.pr/Sobre-tu-Salud/Documents/NEW%20Arbovirus%20Case%20Investigation%20Form%20-%20March%2029%202016.pdf. ¶ http://www.fda.gov/%20EmergencyPreparedness/Counterterrorism/MedicalCountermeasures/MCMIssues/ucm485199.htm. ** The Enhanced Fatal Acute Febrile Illness Surveillance System is co-operated by PRDH, Institute of Forensic Sciences of Puerto Rico, and CDC. †† Patients from across the island with clinical suspicion of Guillain-Barré syndrome can be reported to PRDH (http://www.salud.gov.pr/Sobre-tu-Salud/Documents/ingl%c3%a9s.pdf). §§ http://www.salud.gov.pr/Estadisticas-Registros-y-Publicaciones/Pages/Informe-Arboviral.aspx. ¶¶ Zika Active Pregnancy Surveillance System is co-operated by PRDH and CDC. *** PRDH routinely monitors birth defects throughout the island through the Birth Defect Surveillance System. ††† http://www.cdc.gov/zika/prevention/.
  17. FIGURE 2. Municipality of residence of persons with Zika virus disease (n = 679)* — Puerto Rico, November 1, 2015–April 14, 2016 * Four cases were reported with unknown municipality of residence.
  18. FIGURE 1. Cases of Zika virus disease (n = 683), dengue (n = 110), and chikungunya (n = 61) by week of onset of patient’s illness — Puerto Rico, November 1, 2015–April 14, 2016
  19. TABLE. Demographic characteristics, clinical course, and signs and symptoms of patients* with Zika virus disease (N = 683) — Puerto Rico, November 1, 2015–April 14, 2016CharacteristicNo. of patients (%)History of recent travel†4 (1)Female436 (64)Pregnant65 (10)Hospitalized17 (2)Suspected GBS§5 (1)Thrombocytopenia¶9 (1)Deaths1 (<1)Signs and symptoms**Rash505 (74)Myalgia462 (68)Headache433 (63)Fever429 (63)Arthralgia428 (63)Eye pain350 (51)Chills344 (50)Sore throat233 (34)Petechiae213 (31)Conjunctivitis137 (20)Nausea/Vomiting123 (18)Diarrhea115 (17)Abbreviation: GBS = Guillain-Barré syndrome. * Patients were aged 35 days–89 years (median age = 34 years). † Travel outside of Puerto Rico and the United States in the 14 days before illness onset. § All GBS patients were hospitalized. ¶ Defined as blood platelets levels <100,000 cells/mm3. ** Signs and symptoms were reported by the patients' clinician.
  20. DiscussionZika virus remains a public health challenge in Puerto Rico, and cases are expected to continue to occur throughout 2016. Building upon existing dengue and chikungunya virus surveillance systems, PRDH collaborated with CDC to establish a comprehensive surveillance system to characterize the incidence and epidemiology of Zika virus disease on the island. Expanded laboratory capacity and surveillance provided timely availability of data, allowing for continuous analysis and adapted public health response. Following CDC guidelines, both symptomatic and asymptomatic pregnant women are tested for evidence of Zika virus infection. Information from the Zika Active Pregnancy Surveillance System will be used to raise awareness about the complications associated with Zika virus during pregnancy, encourage prevention through use of mosquito repellent and other methods, and inform health care providers of the additional care needed by women infected with Zika virus during pregnancy, as well as congenitally exposed fetuses and children. In addition, the prevalence of adverse fetal outcomes documented through this system can be compared with baseline rates as further evidence of associations between Zika virus infections and adverse outcomes, such as microcephaly (2). The finding that women constitute the majority of cases might be attributable to targeted outreach and testing. The most common symptoms among Zika virus disease cases were rash, myalgia, headache, fever, and arthralgia, which are similar to the most common signs and symptoms reported elsewhere in the Americas (9). Although Zika virus–associated deaths are rare (10), the first identified death in Puerto Rico highlights the possibility of severe cases, as well as the need for continued outreach to raise health care providers’ awareness of complications that might lead to severe disease or death. To ensure continued blood safety, blood collection resumed with a donor screening program for Zika virus infection, and all units screened positive are removed. Residents of and travelers to Puerto Rico should continue to employ mosquito bite avoidance behaviors, including using mosquito repellents, wearing long-sleeved shirts and pants, and ensuring homes are properly enclosed (e.g., screening windows and doors, closing windows, and using air conditioning) to avoid bites while indoors.††† To reduce the risk for sexual transmission, especially to pregnant women, precautions should include consistent and proper use of condoms or abstinence (5). Such measures can also help avoid unintended pregnancies and minimize risk for fetal Zika virus infection (6). Clinicians who suspect Zika virus disease in patients who reside in or have recently returned from areas with ongoing Zika virus transmission should report cases to public health officials. Top AcknowledgmentKathryn Conlon, PhD, National Center for Environmental Health, CDC
  21. Public Health ResponseThrough the Zika Active Pregnancy Surveillance System, Zika virus–infected pregnant women and their offspring are monitored for adverse maternal, fetal, neonatal, infant, and child health outcomes.¶¶ Surviving offspring across the island will be referred to the Children with Special Health Care Needs program for developmental surveillance and coordination of specialized services, as needed, up to age 3 years. The Birth Defects Surveillance System*** will identify newborns with congenital microcephaly, including those born to women infected with Zika virus during pregnancy, and refer all cases to Avanzando Juntos, Puerto Rico's Early Intervention Services System. With CDC’s assistance, PRDH has also implemented comprehensive strategies to prevent Zika virus transmission. Health messaging, including posters and electronic monitors, have been implemented and health education materials are available at various locations, including health care facilities and ports of entry. Community intervention strategies have focused on pregnant women. PRDH has worked closely with Women, Infants, and Children (WIC) clinics, where 90% of Puerto Rican pregnant women received services in 2015 (Dana Miró Medina, WIC Puerto Rico, personal communication, 2016). As of April 13, a total of 13,351 pregnant women participated in Zika virus educational orientations offered by WIC clinics. PRDH and the CDC Foundation financed the purchase and delivery of Zika Prevention Kits, which include locally adapted health information, mosquito repellent, a bed net, larvicidal tablets (tablets placed in water sources where mosquitoes might breed that prevent larvae from maturating into adults), and condoms. In addition, to reduce the risk for unintended pregnancies with adverse fetal outcomes related to Zika virus infection, the response includes increasing the availability of contraceptives (8). During February–March, an insecticide resistance study of Aedes aegypti mosquitoes was conducted to develop vector control strategies, such as truck-mounted, ultra-low volume spraying and indoor and outdoor residual spraying. Mosquitoes from across Puerto Rico were tested using the CDC bottle bioassay to determine insecticide susceptibility, particularly against pyrethroids. Results indicated a high degree of geographical variation with respect to susceptibility to insecticides, and deltamethrin was identified as the most suitable pyrethroid candidate for use in vector control programs (data not shown). Insecticide susceptibility surveillance is ongoing. A home-based vector control program focused on pregnant women is underway. Women are contacted through WIC clinics, and are offered source reduction services (e.g., removal of water containers that can serve as mosquito breeding sites), larvicide application, and indoor and outdoor residual spraying using deltamethrin. PRDH and CDC have collaborated with the Puerto Rico Department of Housing to incorporate these services into its vector control activities.
  22. Epidemiologic SurveillanceIn response to the introduction of Zika virus, PRDH and CDC Dengue Branch incorporated Zika virus case reporting and diagnostic testing into existing dengue and chikungunya virus surveillance systems and developed a laboratory-based Passive Arboviral Diseases Surveillance System.†Health providers submit serum specimens to PRDH from patients with a clinical suspicion of Zika, chikungunya, or dengue virus infection using a case report form.§ Depending on the number of days between onset of illness and specimen collection, specimens are tested for the three arboviruses by a Trioplex RT-PCR assay, for evidence of Zika and dengue virus infection by IgM ELISA, or by both assays (4).¶ Zika virus–infected patients were defined by positive results from either RT-PCR (confirmed) or IgM ELISA with negative dengue virus IgM ELISA (presumptive positive). Zika virus testing has been incorporated into the Sentinel Enhanced Dengue Surveillance System, which tests specimens from all febrile patients treated at either one outpatient clinic or one hospital emergency department in Ponce. Tissue and blood specimens collected during autopsy from patients who died after an acute febrile illness are tested for Zika virus infection through the Enhanced Fatal Acute Febrile Illness Surveillance System.** Following CDC interim guidance (6), symptomatic pregnant women are tested using the diagnostic algorithm, and asymptomatic pregnant women are tested for evidence of Zika and dengue virus infection by IgM ELISA. Initiated in February 2016, the Guillain-Barré syndrome Passive Surveillance System allows health providers from across the island to report clinically suspected Guillain-Barré syndrome cases by sending a case report form and serum specimen to PRDH.†† Specimens from patients with suspected Guillain-Barré syndrome are tested by both RT-PCR and IgM ELISA for all three arboviruses. Diagnostic test results are managed through an integrated data management system. Results are reported to providers, and aggregate data are available online in a weekly arboviral report.§§ During November 1, 2015–April 14, 2016, specimens from 6,157 suspected arbovirus-infected patients were evaluated and 683 (11%) were either laboratory-confirmed or presumptive positive for Zika virus infection (Table). Of these 683 Zika virus laboratory confirmed or presumptive patients, 581 (85%) were confirmed by RT-PCR, 73 (11%) were presumptive positive by IgM ELISA, and 29 (4%) were positive by both RT-PCR and IgM ELISA. Dengue, chikungunya, or unspecified flavivirus infection was identified in 110 (2%), 61 (1%), and 32 (<1%) suspected arbovirus-infected patients, respectively. No patients with evidence of coinfection with Zika, dengue, or chikungunya viruses were identified by RT-PCR. Of all identified Zika virus–infected patients, 646 (95%) were reported to the Passive Arboviral Diseases Surveillance System. Thirty-two (5%) Zika virus–infected patients were reported through the Sentinel Enhanced Dengue Surveillance System. Five (1%) suspected cases of Guillain-Barré syndrome reported to the Guillain-Barré syndrome Passive Surveillance System were presumptive positive for Zika virus infection, and two had unspecified flavivirus infection. Weekly Zika virus disease case counts gradually increased since late November 2015, whereas incidence of dengue and chikungunya cases remained comparatively low (Figure 1). Zika virus–infected patients were reported from 50 (64%) of the 78 total municipalities (Figure 2); 146 (21%) patients were residents of the San Juan metropolitan area. Among all identified Zika virus–infected patients, 436 (64%) were female, and median age was 34 years (range = 35 days–89 years). The most frequently reported signs and symptoms were rash (74%), myalgia (68%), headache (63%), fever (63%), and arthralgia (63%). Thrombocytopenia (defined as blood platelets levels <100,000 cells/mm3) was reported in nine (1%) cases. Sixty-five (10%) symptomatic pregnant women were Zika virus–infected patients. Seventeen (2%) patients required hospitalization, including five (1%) suspected Guillain-Barré syndrome cases. In one (<1%) identified Zika virus–associated case, the patient died of complications related to severe thrombocytopenia. To ensure the safety of the blood supply, Puerto Rico imported all blood products from the United States during March 5–April 14 (7). On April 2, blood collection resumed with donor screening using a Food and Drug Administration–approved Zika virus investigational nucleic acid detection test (Roche Molecular Systems, Inc., Pleasanton, California). Emergency blood imports ended on April 15. During April 2–14, nine (<1%) of 1,910 screened donated blood units had positive test results. These units were removed from the blood supply, and testing is pending to confirm presumptive Zika virus infection.
  23. Zika virus is a flavivirus transmitted primarily by Aedes species mosquitoes, and symptoms of infection can include rash, fever, arthralgia, and conjunctivitis (1).* Zika virus infection during pregnancy is a cause of microcephaly and other severe brain defects (2). Infection has also been associated with Guillain-Barré syndrome (3). In December 2015, Puerto Rico became the first U.S. jurisdiction to report local transmission of Zika virus, with the index patient reporting symptom onset on November 23, 2015 (4). This report provides an update to the epidemiology of and public health response to ongoing Zika virus transmission in Puerto Rico. During November 1, 2015–April 14, 2016, a total of 6,157 specimens from suspected Zika virus–infected patients were evaluated by the Puerto Rico Department of Health (PRDH) and CDC Dengue Branch (which is located in San Juan, Puerto Rico), and 683 (11%) had laboratory evidence of current or recent Zika virus infection by one or more tests: reverse transcription–polymerase chain reaction (RT-PCR) or immunoglobulin M (IgM) enzyme-linked immunosorbent assay (ELISA). Zika virus–infected patients resided in 50 (64%) of 78 municipalities in Puerto Rico. Median age was 34 years (range = 35 days–89 years). The most frequently reported signs and symptoms were rash (74%), myalgia (68%), headache (63%), fever (63%), and arthralgia (63%). There were 65 (10%) symptomatic pregnant women who tested positive by RT-PCR or IgM ELISA. A total of 17 (2%) patients required hospitalization, including 5 (1%) patients with suspected Guillain-Barré syndrome. One (<1%) patient died after developing severe thrombocytopenia. The public health response to the outbreak has included increased laboratory capacity to test for Zika virus infection (including blood donor screening), implementation of enhanced surveillance systems, and prevention activities focused on pregnant women. Vector control activities include indoor and outdoor residual spraying and reduction of mosquito breeding environments focused around pregnant women’s homes. Residents of and travelers to Puerto Rico should continue to employ mosquito bite avoidance behaviors, take precautions to reduce the risk for sexual transmission (5), and seek medical care for any acute illness with rash or fever.
  24. SummaryWhat is already known about this topic? Zika virus transmission in Puerto Rico has been ongoing, with the first patient reporting symptom onset in November 2015. Zika virus infection is a cause of microcephaly and other severe birth defects. Zika virus infection has also been associated with Guillain-Barré syndrome. What is added by this report? During November 1, 2015–April 14, 2016, a total of 6,157 specimens from suspected Zika virus–infected patients from Puerto Rico were evaluated and 683 (11%) had laboratory evidence of current or recent Zika virus infection. The public health response includes increased capacity to test for Zika virus, preventing infection in pregnant women, monitoring infected pregnant women and their fetus for adverse outcomes, controlling mosquitos, and assuring the safety of blood products. What are the implications for public health practice? Residents of and travelers to Puerto Rico should continue to employ mosquito bite avoidance behaviors, take precautions to reduce the risk for sexual transmission, and seek medical care for any acute illness with rash or fever. Clinicians who suspect Zika virus disease in patients who reside in or have recently returned from areas with ongoing Zika virus transmission should report cases to public health officials.

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.