Jump to content

niman

Super Administrators
  • Posts

    74,774
  • Joined

  • Last visited

  • Days Won

    31

Everything posted by niman

  1. Isolation of infective Zika virus from urine and saliva of patients in BrazilMyrna C Bonaldo, Ieda P Ribeiro, Noemia S. Lima, Alexandre A. C. Santos,Lidiane S.R. Menezes, Stephanie O.D. Cruz, Iasmim S. Mello, Nathália D. Furtado,Elaine E. Moura, Luana Damasceno, Keli A.B. Silva, Marcia G. Castro, Alexandra L. Gerber, Luiz G.P. Almeida, Ricardo Lourenço-de-Oliveira, Ana Tereza R.Vasconcelos, Patrícia Brasildoi: http://dx.doi.org/10.1101/045443 http://biorxiv.org/content/early/2016/03/24/045443
  2. S1 Table Clinical symptoms Patient 1 2 3 4 Onset date 01/11/16 01/24/16 01/22/16 01/31/16 Days after symptoms onset * 3 2 5 1 Days after rash onset * <1** 1 1 1 Rash duration 5 days 6 days 2 days 2 days Rash type Macular Macular and maculo-papular Maculo-papular Maculo-papular Low grade fever (duration) - + (2 days) + (4 days) - Headache - - + - Retro-orbital pain - - + - Photophobia - - NI - Fatigue/ malaise - + + - Myalgia - + + - Arthralgia (region) + (wrist and elbows) - + (large and small joints) - Arthritis - - - - Anorexia - - + - Nausea/ vomiting - - + - Diarrhea - - - - Abdominal pain - - - - Dysuria - - - - Bleeding/ petechia - - - - Dizziness/ light headedness - - - - Pruritus + - + + Paresthesias + - - - Conjunctivitis - - - - Edema (local/site) + (hands) - - - Lymphadenopathy (local/ site) - - - - Enanthem NI - NI - Respiratory symptoms - - - - Jaundice - - - - Seizures - - - - * Regarding the date of sample collection; **the collection date was in the first day of rash manifestation S2 Table Clinical symptoms Patient 5 6 7 8 9 Onset date 01/26/16 01/26/16 01/31/16 01/31/16 01/28/16 Days after sypmtons onset * 2 3 1 2 5 Days after rash onset * 2 <1 1 2 2 Rash duration 20 days 4 days 5 days 6 days 3 days Rash type Macular Maculo-papular Maculo-papular Macular and maculo-papular Maculo-papular Low grade fever (duration) - + (1 day) - + (2 days) - Headache + - - + + Retro-orbital pain + - - + + Photophobia + - - - + Fatigue/ malaise + + - + - Myalgia + + - - + Arthralgia (region) - + (wrists, ankles, knees, hands) - + (large and small joints) - Arthritis - - - - - Anorexia + + - - - Nausea/ vomiting + - - - - Diarrhea + - - - - Abdominal pain - + - - - Dysuria - - - - - Bleeding/ petechia - - - - Dizziness/ light headedness + - - - - Pruritus + + + + + Paresthesias + + - - - Conjunctivitis + + - - + Edema + (feet and hands) + (hands) - + - Lymphadenopathy (local/ site) + (Cervical and auricular) - - - + (cervical) Enanthem - - - - - Respiratory symptoms + - - + - Jaundice - - - - - Seizures - - - - - * Regarding the date of sample collection; **the collection date was in the first day of rash manifestation S3 Table Social-demographic data Patient 1 2 3 4 Gender female female male female Age 36 30 24 42 Gestational age (weeks) 18 33 NA 21 Family members illness - - + - Partner illness - - NI - Repellent spray use + + NI + Previous DENV infection + - NI - Domicile in Rio de Janeiro State Duque de Caxias Nova Iguaçu Rio de Janeiro Duque de Caxias NA – not applicable; NI- not informed S4 Table Social demographic data Patient 5 6 7 8 9 Gender female male female female female Age 30 68 20 27 22 Gestational age (weeks) NA NA 17 21 20 Family members illness - + - - - Partner illness - - - - - Repellent spray use + - + + + Previous DENV infection + + - + - Domicile in Rio de Janeiro State Rio de Janeiro Rio de Janeiro Rio de Janeiro Duque de Caxias Rio de Janeiro NA – not applicable; NI- not informed
  3. S1 Table Clinical symptoms Patient 1 2 3 4 Onset date 01/11/16 01/24/16 01/22/16 01/31/16 Days after symptoms onset * 3 2 5 1 Days after rash onset * <1** 1 1 1 Rash duration 5 days 6 days 2 days 2 days Rash type Macular Macular and maculo-papular Maculo-papular Maculo-papular Low grade fever (duration) - + (2 days) + (4 days) - Headache - - + - Retro-orbital pain - - + - Photophobia - - NI - Fatigue/ malaise - + + - Myalgia - + + - Arthralgia (region) + (wrist and elbows) - + (large and small joints) - Arthritis - - - - Anorexia - - + - Nausea/ vomiting - - + - Diarrhea - - - - Abdominal pain - - - - Dysuria - - - - Bleeding/ petechia - - - - Dizziness/ light headedness - - - - Pruritus + - + + Paresthesias + - - - Conjunctivitis - - - - Edema (local/site) + (hands) - - - Lymphadenopathy (local/ site) - - - - Enanthem NI - NI - Respiratory symptoms - - - - Jaundice - - - - Seizures - - - - * Regarding the date of sample collection; **the collection date was in the first day of rash manifestation S2 Table Clinical symptoms Patient 5 6 7 8 9 Onset date 01/26/16 01/26/16 01/31/16 01/31/16 01/28/16 Days after sypmtons onset * 2 3 1 2 5 Days after rash onset * 2 <1 1 2 2 Rash duration 20 days 4 days 5 days 6 days 3 days Rash type Macular Maculo-papular Maculo-papular Macular and maculo-papular Maculo-papular Low grade fever (duration) - + (1 day) - + (2 days) - Headache + - - + + Retro-orbital pain + - - + + Photophobia + - - - + Fatigue/ malaise + + - + - Myalgia + + - - + Arthralgia (region) - + (wrists, ankles, knees, hands) - + (large and small joints) - Arthritis - - - - - Anorexia + + - - - Nausea/ vomiting + - - - - Diarrhea + - - - - Abdominal pain - + - - - Dysuria - - - - - Bleeding/ petechia - - - - Dizziness/ light headedness + - - - - Pruritus + + + + + Paresthesias + + - - - Conjunctivitis + + - - + Edema + (feet and hands) + (hands) - + - Lymphadenopathy (local/ site) + (Cervical and auricular) - - - + (cervical) Enanthem - - - - - Respiratory symptoms + - - + - Jaundice - - - - - Seizures - - - - - * Regarding the date of sample collection; **the collection date was in the first day of rash manifestation S3 Table Social-demographic data Patient 1 2 3 4 Gender female female male female Age 36 30 24 42 Gestational age (weeks) 18 33 NA 21 Family members illness - - + - Partner illness - - NI - Repellent spray use + + NI + Previous DENV infection + - NI - Domicile in Rio de Janeiro State Duque de Caxias Nova Iguaçu Rio de Janeiro Duque de Caxias NA – not applicable; NI- not informed S4 Table Social demographic data Patient 5 6 7 8 9 Gender female male female female female Age 30 68 20 27 22 Gestational age (weeks) NA NA 17 21 20 Family members illness - + - - - Partner illness - - - - - Repellent spray use + - + + + Previous DENV infection + + - + - Domicile in Rio de Janeiro State Rio de Janeiro Rio de Janeiro Rio de Janeiro Duque de Caxias Rio de Janeiro NA – not applicable; NI- not informed
  4. S1 Table Clinical symptoms Patient 1 2 3 4 Onset date 01/11/16 01/24/16 01/22/16 01/31/16 Days after symptoms onset * 3 2 5 1 Days after rash onset * <1** 1 1 1 Rash duration 5 days 6 days 2 days 2 days Rash type Macular Macular and maculo-papular Maculo-papular Maculo-papular Low grade fever (duration) - + (2 days) + (4 days) - Headache - - + - Retro-orbital pain - - + - Photophobia - - NI - Fatigue/ malaise - + + - Myalgia - + + - Arthralgia (region) + (wrist and elbows) - + (large and small joints) - Arthritis - - - - Anorexia - - + - Nausea/ vomiting - - + - Diarrhea - - - - Abdominal pain - - - - Dysuria - - - - Bleeding/ petechia - - - - Dizziness/ light headedness - - - - Pruritus + - + + Paresthesias + - - - Conjunctivitis - - - - Edema (local/site) + (hands) - - - Lymphadenopathy (local/ site) - - - - Enanthem NI - NI - Respiratory symptoms - - - - Jaundice - - - - Seizures - - - - * Regarding the date of sample collection; **the collection date was in the first day of rash manifestation S2 Table Clinical symptoms Patient 5 6 7 8 9 Onset date 01/26/16 01/26/16 01/31/16 01/31/16 01/28/16 Days after sypmtons onset * 2 3 1 2 5 Days after rash onset * 2 <1 1 2 2 Rash duration 20 days 4 days 5 days 6 days 3 days Rash type Macular Maculo-papular Maculo-papular Macular and maculo-papular Maculo-papular Low grade fever (duration) - + (1 day) - + (2 days) - Headache + - - + + Retro-orbital pain + - - + + Photophobia + - - - + Fatigue/ malaise + + - + - Myalgia + + - - + Arthralgia (region) - + (wrists, ankles, knees, hands) - + (large and small joints) - Arthritis - - - - - Anorexia + + - - - Nausea/ vomiting + - - - - Diarrhea + - - - - Abdominal pain - + - - - Dysuria - - - - - Bleeding/ petechia - - - - Dizziness/ light headedness + - - - - Pruritus + + + + + Paresthesias + + - - - Conjunctivitis + + - - + Edema + (feet and hands) + (hands) - + - Lymphadenopathy (local/ site) + (Cervical and auricular) - - - + (cervical) Enanthem - - - - - Respiratory symptoms + - - + - Jaundice - - - - - Seizures - - - - - * Regarding the date of sample collection; **the collection date was in the first day of rash manifestation S3 Table Social-demographic data Patient 1 2 3 4 Gender female female male female Age 36 30 24 42 Gestational age (weeks) 18 33 NA 21 Family members illness - - + - Partner illness - - NI - Repellent spray use + + NI + Previous DENV infection + - NI - Domicile in Rio de Janeiro State Duque de Caxias Nova Iguaçu Rio de Janeiro Duque de Caxias NA – not applicable; NI- not informed S4 Table Social demographic data Patient 5 6 7 8 9 Gender female male female female female Age 30 68 20 27 22 Gestational age (weeks) NA NA 17 21 20 Family members illness - + - - - Partner illness - - - - - Repellent spray use + - + + + Previous DENV infection + + - + - Domicile in Rio de Janeiro State Rio de Janeiro Rio de Janeiro Rio de Janeiro Duque de Caxias Rio de Janeiro NA – not applicable; NI- not informed
  5. Zika virus disease in the United States, 2015–2016Language:EnglishEspañolRecommend on FacebookTweetAs of March 16, 2016 (5 am EST) Zika virus disease and Zika virus congenital infection are nationally notifiable conditions.This update from the CDC Arboviral Disease Branch includes provisional data reported to ArboNET for January 1, 2015 – March 16, 2016.US States Travel-associated Zika virus disease cases reported: 258Locally acquired vector-borne cases reported: 0Of the 258 travel-associated infections, 18 are in pregnant women and 6 were sexually transmittedUS Territories Travel-associated cases reported: 3Locally acquired cases reported: 283Of the 283 locally acquired infections, 35 are pregnant women Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of March 16, 2016) StatesTravel-associated cases* No. (%) (N=258)Locally acquired cases† No. (%) (N=0)Alabama1 (<1)0 (0)Arkansas1 (<1)0 (0)California13 (5)0 (0)Colorado2 (1)0 (0)Delaware1 (<1)0 (0)District of Columbia3 (1)0 (0)Florida59 (23)0 (0)Georgia7 (3)0 (0)Hawaii5 (2)0 (0)Illinois7 (3)0 (0)Indiana4 (2)0 (0)Iowa4 (2)0 (0)Kansas1 (<1)0 (0)Kentucky1 (<1)0 (0)Louisiana2 (1)0 (0)Maryland5 (2)0 (0)Massachusetts3 (1)0 (0)Michigan2 (1)0 (0)Minnesota7 (3)0 (0)Missouri1 (<1)0 (0)Montana1 (<1)0 (0)Nebraska2 (1)0 (0)New Hampshire2 (1)0 (0)New Jersey2 (1)0 (0)New York42 (16)0 (0)North Carolina6 (2)0 (0)Ohio8 (3)0 (0)Oklahoma3 (1)0 (0)Oregon6 (2)0 (0)Pennsylvania8 (3)0 (0)Tennessee1 (<1)0 (0)Texas34 (13)0 (0)Virginia7 (3)0 (0)Washington2 (1)0 (0)West Virginia5 (2)0 (0) Territories(N=3)(N=283)American Samoa0 (0)14 (5)Puerto Rico2 (67)259 (92)US Virgin Islands1 (33)10 (4)*Travelers returning from affected areas, their sexual contacts, or infants infected in utero †Presumed local mosquito-borne transmission Page last reviewed: February 4, 2016Page last updated: March 16, 2016Content source: Centers for Disease Control and Prevention National Center for Emerging and Zoonotic Infectious Diseases (NCEZID) Division of Vector-Borne Diseases (DVBD)
  6. http://rense.gsradio.net:8080/rense/special/rense_032316_hr3.mp3
  7. http://www.renseradio.com/listenlive.htm
  8. Midnight special (EDT) tonight on Zika and microcephaly
  9. Sequence map update https://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en
  10. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome1852518525100%0.0100%KU926309.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1840818408100%0.099%KU509998.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1840218402100%0.099%KJ776791.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1839318393100%0.099%KU707826.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1839318393100%0.099%KU365779.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1839318393100%0.099%KU321639.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1838418384100%0.099%KU729218.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1838118381100%0.099%KU501217.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1838118381100%0.099%KU365780.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1837518375100%0.099%KU501216.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1837518375100%0.099%KU365777.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1836618366100%0.099%KU729217.2Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1836618366100%0.099%KU647676.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1836318363100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1836318363100%0.099%KU312312.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome183591835999%0.099%KU497555.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1835718357100%0.099%KU527068.1Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds1835418354100%0.099%KU820897.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1835418354100%0.099%KU501215.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome1834818348100%0.099%KU922960.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome1834518345100%0.099%KU926310.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome1834518345100%0.099%KU922923.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome1834518345100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome1834318343100%0.099%KU853012.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds1833618336100%0.099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds1832718327100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1832718327100%0.099%KU761564.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1830018300100%0.099%KU820899.2Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds1819118191100%0.099%KU866423.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1816818168100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1806018060100%0.099%KU681081.3Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177531775399%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds177061770698%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1760317603100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1744717447100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164201642099%0.095%HQ234499.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1329713297100%0.089%KF383115.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1329013290100%0.089%KU720415.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1328413284100%0.089%KF268948.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds132841328499%0.089%HQ234498.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1327713277100%0.089%KF268950.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1327513275100%0.089%KF268949.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1327513275100%0.089%DQ859059.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1326813268100%0.089%LC002520.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1326313263100%0.089%KF383119.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1323013230100%0.089%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132141321499%0.089%HQ234501.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1320913209100%0.089%AY632535.2Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1316013160100%0.088%KF383117.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131441314499%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1294013008100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128611286197%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108621086297%0.084%KF383120.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4971497127%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4944494427%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4655465525%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4646464625%0.099%KU646827.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3434343418%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3211321117%0.099%KU740199.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds2852418495%0.071%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2691269114%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2048204811%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2017201711%0.099%KU179098.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds174617469%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds174517459%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds174317439%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds173917399%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds173917399%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds173917399%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds173717379%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds159715978%0.099%KJ873160.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds141614167%0.099%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds137913797%0.099%KM851039.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds134613467%0.099%KU556802.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds134213427%0.098%KM851038.1Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds1301130110%0.088%AF013415.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds124012406%0.099%KU232300.1Select seq gb|KT200609.1|Zika virus isolate BR/949/15 NS5 gene, partial cds124012406%0.099%KT200609.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds123112316%0.099%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds122912296%0.099%KU232297.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds122012206%0.099%KU232294.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds121812186%0.099%KU232292.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds121412146%0.099%KU232298.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds121112116%0.099%KU232296.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds121112116%0.099%KU232293.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds120512056%0.099%KU232295.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds119511956%0.099%KU232288.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds119111916%0.099%KU232289.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds118711876%0.099%KU232299.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds118611866%0.099%KU232291.1Select seq gb|KU758878.1|Zika virus polyprotein gene, partial cds113311336%0.099%KU758878.1Select seq gb|KF270886.1|Zika virus strain CCB-870 envelope glycoprotein gene, partial cds107210728%0.088%KF270886.1Select seq gb|KU867812.1|Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds100910095%0.099%KU867812.1
  11. LOCUS KU926309 10795 bp ss-RNA linear VRL 21-MAR-2016 DEFINITION Zika virus isolate Rio-U1, complete genome. ACCESSION KU926309 VERSION KU926309.1 GI:1006593051 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10795) AUTHORS Bonaldo,M.C., Ribeiro,I.P., Lima,N.S., Santos,A.A.C., Raphael,L.M.S., Cruz,S.O.D., Mello,I.S., Furtado,N.D., Moura,E.E., Castro,M.G., Gerber,A.L., Almeida,L.G.P., Lourenco-de-Oliveira,R., Vasconcelos,A.T.R. and Brasil,P. TITLE Isolation of infective Zika virus from urine and saliva of patients in Brazil JOURNAL Unpublished REFERENCE 2 (bases 1 to 10795) AUTHORS Bonaldo,M.C., Ribeiro,I.P., Lima,N.S., Santos,A.A.C., Raphael,L.M.S., Cruz,S.O.D., Mello,I.S., Furtado,N.D., Moura,E.E., Castro,M.G., Gerber,A.L., Almeida,L.G.P., Lourenco-de-Oliveira,R., Vasconcelos,A.T.R. and Brasil,P. TITLE Direct Submission JOURNAL Submitted (16-MAR-2016) Laboratorio Nacional de Bioinformatica / Laboratorio Nacional de Computacao Cientifica, Laboratorio de Biologia Molecular de Flavivirus / Fundacao Oswaldo Cruz, Rua Getulio Vargas, 333, Petropolis, RJ 25651075, Brazil COMMENT ##Assembly-Data-START## Assembly Method :: Ray v. 2.2 Coverage :: 8000 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10795 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Rio-U1" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="14-Jan-2016" /note="passage details: Vero cells" 5'UTR 1..100 CDS 101..10372 /codon_start=1 /product="polyprotein" /protein_id="AMQ48981.1" /db_xref="GI:1006593052" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPIAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMRRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" mat_peptide 101..466 /product="anchored capsid protein C" mat_peptide 101..412 /product="capsid protein C" mat_peptide 467..970 /product="membrane glycoprotein precursor M" mat_peptide 467..745 /product="protein pr" mat_peptide 746..970 /product="membrane glycoprotein M" mat_peptide 971..2482 /product="envelope protein E" mat_peptide 2483..3538 /product="nonstructural protein NS1" mat_peptide 3539..4216 /product="nonstructural protein NS2A" mat_peptide 4217..4606 /product="nonstructural protein NS2B" mat_peptide 4607..6457 /product="nonstructural protein NS3" mat_peptide 6458..6838 /product="nonstructural protein NS4A" mat_peptide 6839..6907 /product="protein 2K" mat_peptide 6908..7660 /product="nonstructural protein NS4B" mat_peptide 7661..10369 /product="RNA-dependent RNA polymerase NS5" 3'UTR 10373..10795 ORIGIN 1 gatctgtgtg aatcagactg cgacagttcg agtttgaagc gaaagctagc aacagtatca 61 acaggtttta ttttggattt ggaaacgaga gtttctggtc atgaaaaacc caaaaaagaa 121 atccggagga ttccggattg tcaatatgct aaaacgcgga gtagcccgtg tgagcccctt 181 tgggggcttg aagaggctgc cagccggact tctgctgggt catgggccca tcaggatggt 241 cttggcgatt ctagcctttt tgagattcac ggcaatcaag ccatcactgg gtctcatcaa 301 tagatggggt tcagtgggga aaaaagaggc tatggaaata ataaagaagt tcaagaaaga 361 tctggctgcc atgctgagaa taatcaatgc taggaaggag aagaagagac gaggcgcaga 421 tactagtgtc ggaattgttg gcctcctgct gaccacagct atggcagcgg aggtcactag 481 acgtgggagt gcatactaca tgtacttgga cagaaacgat gctggggagg ccatatcttt 541 tccaaccaca ttggggatga ataagtgtta tatacagatc atggatcttg gacacatgtg 601 tgatgccacc atgagctatg aatgccctat gctggatgag ggggtggaac cagatgacgt 661 cgattgttgg tgcaacacga cgtcaacttg ggttgtgtac ggaacctgcc atcacaaaaa 721 aggtgaagca cggagatcta gaagagctgt gacgctcccc tcccattcca ctaggaagct 781 gcaaacgcgg tcgcaaacct ggttggaatc gagagaatac acaaagcact tgattagagt 841 cgaaaattgg atattcagga accctggctt cgcgttagca gcagctgcca tcgcttggct 901 tttgggaagc tcaacgagcc aaaaagtcat atacttggtc atgatactgc tgattgcccc 961 ggcatacagc atcaggtgca taggagtcag caatagggac tttgtggaag gtatgtcagg 1021 tgggacttgg gttgatgttg tcttggaaca tggaggttgt gtcaccgtaa tggcacagga 1081 taaaccgact gtcgacatag agctggttac aacaacagtc agcaacatgg cggaggtaag 1141 atcctactgc tatgaggcat caatatcaga catggcttcg gacagccgct gcccaacaca 1201 aggtgaagcc taccttgaca agcaatcaga cactcaatat gtctgcaaaa gaacgttagt 1261 ggacagaggc tggggaaatg gatgtggact ttttggcaaa gggagcctgg tgacatgcgc 1321 taagtttgca tgctccaaga aaatgaccgg gaagagcatc cagccagaga atctggagta 1381 ccggataatg ctgtcagttc atggctccca gcacagtggg atgatcgtta atgacacagg 1441 acatgaaact gatgagaata gagcgaaggt tgagataacg cccaattcac caagagccga 1501 agccaccctg gggggttttg gaagcctagg acttgattgt gaaccgagga caggccttga 1561 cttttcagat ttgtattact tgactatgaa taacaagcac tggttggttc acaaggagtg 1621 gttccacgac attccattgc cttggcacgc tggggcagac accggaactc cacactggaa 1681 caacaaagaa gcactggtag agttcaagga cgcacatgcc aaaaggcaaa ctgtcgtggt 1741 tctagggagt caagaaggag cagttcacac ggcccttgct ggagctctgg aggctgagat 1801 ggatggtgca aagggaaggc tgtcctctgg ccacttgaaa tgtcgcctga aaatggataa 1861 acttagattg aagggcgtgt catactcctt gtgtaccgca gcgttcacat tcaccaagat 1921 cccggctgaa acactgcacg ggacagtcac agtggaggta cagtacgcag ggacagatgg 1981 accttgcaag gttccagctc agatggcggt ggacatgcaa actctgaccc cagttgggag 2041 gttgataacc gctaaccccg taatcactga aagcactgag aactctaaga tgatgctgga 2101 acttgatcca ccatttgggg actcttacat tgtcatagga gtcggggaga agaagatcac 2161 ccaccactgg cacaggagtg gcagcaccat tggaaaagca tttgaagcca ctgtgagagg 2221 tgccaagaga atggcagtct tgggagacac agcctgggac tttggatcag ttggaggcgc 2281 tctcaactca ttgggcaagg gcatccatca aatttttgga gcagctttca aatcattgtt 2341 tggaggaatg tcctggttct cacaaattct cattggaacg ttgctgatgt ggttgggcct 2401 gaacacaaag aatggatcta tttcccttat gtgcttggcc ttagggggag tgttgatctt 2461 cttatccaca gccgtctctg ctgatgtggg gtgctcggtg gacttctcaa agaaggagac 2521 gagatgcggt acaggggtgt tcgtctataa cgacgttgaa gcctggaggg acaggtacaa 2581 gtaccatcct gactcccccc gtagattggc agcagcagtc aagcaagcct gggaagatgg 2641 tatctgcggg atctcctctg tttcaagaat ggaaaacatc atgtggagat cagtagaagg 2701 ggagctcaac gcaatcctgg aagagaatgg agttcaactg acggtcgttg tgggatcggt 2761 aaaaaacccc atgtggagag gtccacagag attgcccgtg cctgtgaacg agctgcccca 2821 cggctggaag gcttggggga aatcgtactt cgtcagagca gcaaagacaa ataacagctt 2881 tgtcgtggat ggtgacacac tgaaggaatg cccactcaaa catagagcat ggaacagctt 2941 tcttgtggag gatcatgggt tcggggtatt tcacactagt gtctggctca aggttagaga 3001 agattattca ttagagtgtg atccagccgt tattggaaca gctgttaagg gaaaggaggc 3061 tgtacacagt gatctaggct actggattga gagtgagaag aatgacacat ggaggctgaa 3121 gagggcccat ctgatcgaga tgaaaacatg tgaatggcca aagtcccaca cattgtggac 3181 agatggaata gaagagagtg atctgatcat acccaagtct ttagctgggc cactcagcca 3241 tcacaatacc agagagggct acaggaccca aatgaaaggg ccatggcaca gtgaagagct 3301 tgaaattcgg tttgaggaat gcccaggcac taaggtccac gtggaggaaa catgtggaac 3361 aagaggacca tctctgagat caaccactgc aagcggaagg gtgatcgagg aatggtgctg 3421 cagggagtgc acaatgcccc cactgtcgtt ccgggctaaa gatggctgtt ggtatggaat 3481 ggagataagg cccaggaaag aaccagaaag caacttagta aggtcaatgg tgactgcagg 3541 atcaactgat cacatggatc acttctccct tggagtgctt gtgattctgc tcatggtgca 3601 ggaagggctg aagaagagaa tgaccacaaa gatcatcata agcacatcaa tggcagtgct 3661 ggtagctatg atcctgggag gattttcaat gagtgacctg gctaagcttg caattttgat 3721 gggtgccacc ttcgcggaaa tgaacactgg aggagatgta gctcatctgg cgctgatagc 3781 ggcattcaaa gtcagaccag cgttgctggt atctttcatc ttcagagcta attggacacc 3841 ccgtgaaagc atgctgctgg ccttggcctc gtgtcttttg caaactgcga tctccgcctt 3901 ggaaggcgac ctgatggttc tcatcaatgg ttttgctttg gcctggttgg caatacgagc 3961 gatggttgtt ccacgcactg ataacatcac cttggcaatc ctggctgctc tgacaccact 4021 ggcccggggc acactgcttg tggcgtggag agcaggcctt gctacttgcg gggggtttat 4081 gctcctctct ctgaagggaa aaggcagtgt gaagaagaac ttaccatttg tcatggccct 4141 gggactaacc gctgtgaggc tggtcgaccc catcaacgtg gtgggactgc tgttgctcac 4201 aaggagtggg aagcggagct ggccccctag cgaagtactc acagctgttg gcctgatatg 4261 cgcattggct ggagggttcg ccaaggcaga tatagagatg gctgggccca tagccgcggt 4321 cggtctgcta attgtcagtt acgtggtctc aggaaagagt gtggacatgt acattgaaag 4381 agcaggtgac atcacatggg aaaaagatgc ggaagtcact ggaaacagtc cccggctcga 4441 tgtggcgcta gatgagagtg gtgatttctc cctggtggag gatgacggtc cccccatgag 4501 agagatcata ctcaaggtgg tcctgatgac catctgtggc atgaacccaa tagccatacc 4561 ttttgcagct ggagcgtggt acgtatacgt gaagactgga aaaaggagtg gtgctctatg 4621 ggatgtgcct gctcccaagg aagtaaaaaa gggggagacc acagatggag tgtacagagt 4681 aatgactcgt agactgctgg gttcaacaca agttggagtg ggagttatgc aagagggggt 4741 ctttcacact atgtggcacg tcacaaaagg atccgcactg agaagcggtg aagggagact 4801 tgatccatac tggggagatg tcaagcagga tctggtgtca tactgtggtc catggaagct 4861 agatgccgcc tgggacgggc acagcgaggt gcagctcttg gccgtgcccc ccggagagag 4921 agcgaggaac atccagactc tgcccggaat atttaagaca aaggatgggg acattggagc 4981 ggttgcgctg gattacccag caggaacttc aggatctcca atcctagaca agtgtgggag 5041 agtgatagga ctttatggca atggggtcgt gatcaaaaat gggagttatg ttagtgccat 5101 cacccaaggg aggagggagg aagagactcc tgttgagtgc ttcgagcctt cgatgctgaa 5161 gaagaagcag ctaactgtct tagacttgca tcctggagct gggaaaacca ggagagttct 5221 tcctgaaata gtccgtgaag ccataaaaac aagactccgt actgtgatct tagctccaac 5281 cagggttgtc gctgctgaaa tggaggaggc ccttagaggg cttccagtgc gttatatgac 5341 aacagcagtc aatgtcaccc actctggaac agaaatcgtc gacttaatgt gccatgccac 5401 cttcacttca cgtctactac agccaatcag agtccccaac tataatctgt atattatgga 5461 tgaggcccac ttcacagatc cctcaagtat agcagcaaga ggatacattt caacaagggt 5521 tgagatgggc gaggcggctg ccatcttcat gaccgccacg ccaccaggaa cccgtgacgc 5581 atttccggac tccaactcac caattatgga caccgaagtg gaagtcccag agagagcctg 5641 gagctcaggc tttgattggg tgacggatca ttctggaaaa acagtttggt ttgttccaag 5701 cgtgaggaac ggcaatgaga tcgcagcttg tctgacaaag gctggaaaac gggtcataca 5761 gctcagcaga aagacttttg agacagagtt ccagaaaaca aaacatcaag agtgggactt 5821 tgtcgtgaca actgacattt cagagatggg cgccaacttt aaagctgacc gtgtcataga 5881 ttccaggaga tgcctaaagc cggtcatact tgatggcgag agagtcattc tggctggacc 5941 catgcctgtc acacatgcca gcgctgccca gaggaggggg cgcataggca ggaatcccaa 6001 caaacctgga gatgagtatc tgtatggagg tgggtgcgca gagactgacg aagaccatgc 6061 acactggctt gaagcaagaa tgctccttga caatatttac ctccaagatg gcctcatagc 6121 ctcgctctat cgacctgagg ccgacaaagt agcagccatt gagggagagt tcaagcttag 6181 gacggagcaa aggaagacct ttgtggaact catgagaaga ggagatcttc ctgtttggct 6241 ggcctatcag gttgcatctg ccggaataac ctacacagat agaagatggt gctttgatgg 6301 cacgaccaac aacaccataa tggaagacag tgtgccggca gaggtgtgga ccagacacgg 6361 agagaaaaga gtgctcaaac cgaggtggat ggacgccaga gtttgttcag atcatgcggc 6421 cctgaagtca ttcaaggagt ttgccgctgg gaaaagagga gcggcttttg gagtgatgga 6481 agccctggga acactgccag gacacatgac agagagattc caggaagcca ttgacaacct 6541 cgctgtgctc atgcgggcag agactggaag caggccttac aaagccgcgg cggcccaatt 6601 gccggagacc ctagagacca ttatgctttt ggggttgttg ggaacagtct cgctgggaat 6661 ctttttcgtc ttgatgagga acaagggcat agggaagatg ggctttggaa tggtgactct 6721 tggggccagc gcatggctca tgtggctctc ggaaattgag ccagccagaa ttgcatgtgt 6781 cctcattgtt gtgttcctat tgctggtggt gctcatacct gagccagaaa agcaaagatc 6841 tccccaggac aaccaaatgg caatcatcat catggtagca gtaggtcttc tgggcttgat 6901 taccgccaat gaactcggat ggttggagag aacaaagagt gacctaagcc atctaatggg 6961 aaggagagag gagggggcaa ccataggatt ctcaatggac attgacctgc ggccagcctc 7021 agcttgggcc atctatgctg ccttgacaac tttcattacc ccagccgtcc aacatgcagt 7081 gaccacttca tacaacaact actccttaat ggcgatggcc acgcaagctg gagtgttgtt 7141 tggtatgggc aaagggatgc cattctacgc atgggacttt ggagtcccgc tgctaatgat 7201 aggttgctac tcacaattaa cacccctgac cctaatagtg gccatcattt tgctcgtggc 7261 gcactacatg tacttgatcc cagggctgca ggcagcagct gcgcgtgctg cccagaagag 7321 aacggcagct ggcatcatga agaaccctgt tgtggatgga atagtggtga ctgacattga 7381 cacaatgaca attgaccccc aagtggagaa aaagatggga caggtgctac tcatagcagt 7441 agccgtctcc agcgccatac tgtcgcggac cgcctggggg tggggggagg ctggggccct 7501 gatcacagcc gcaacttcca ctttgtggga aggctctccg aacaagtact ggaactcctc 7561 tacagccact tcactgtgta acatttttag gggaagttac ttggctggag cttctctaat 7621 ctacacagta acaagaaacg ctggcttggt caagagacgt gggggtggaa caggagagac 7681 cctgggagag aaatggaagg cccgcttgaa ccagatgtcg gccctggagt tctactccta 7741 caaaaagtca ggcatcaccg aggtgtgcag agaagaggcc cgccgcgccc tcaaggacgg 7801 tgtggcaacg ggaggccatg ctgtgtcccg aggaagtgca aagctgagat ggttggtgga 7861 gcggggatac ctgcagccct acggaaaggt cattgatctt ggatgtggca gagggggctg 7921 gagttactac gccgccacca tccgcaaagt tcaagaagtg aaaggataca caaaaggagg 7981 ccctggtcat gaagaacccg tgttggtgca aagctatggg tggaacatag tccgtcttaa 8041 gagtggggtg gacgtctttc atatggcggc tgagccgtgt gacacgttgc tgtgtgacat 8101 aggtgagtca tcatctagtc ctgaagtgga agaagcacgg acgctcagag tcctctccat 8161 ggtgggggat tggcttgaaa aaagaccagg agccttttgt ataaaagtgt tgtgcccata 8221 caccagcact atgatggaaa ccctggagcg actgcagcgt aggtatgggg gaggactggt 8281 cagagtgcca ctctcccgca actctacaca tgagatgtac tgggtctctg gagcgaaaag 8341 caacaccata aaaagtgtgt ccaccacgag ccagctcctc ttggggcgca tggacgggcc 8401 taggaggcca gtgaaatatg aggaggatgt gaatctcggc tctggcacgc gggctgtggt 8461 aagctgcgct gaagctccca acatgaagat cattggtaac cgcattgaaa ggatccgcag 8521 tgagcacgcg gaaacgtggt tctttgacga gaaccaccca tataggacat gggcttacca 8581 tggaagctat gaggccccca cacaagggtc agcgtcctct ctaataaacg gggttgtcag 8641 gctcctgtca aaaccctggg atgtggtgac tggagtcaca ggaatagcca tgaccgacac 8701 cacaccgtat ggtcagcaaa gagttttcaa ggaaaaagtg gacactaggg tgccagaccc 8761 ccaagaaggc actcgtcagg ttatgagcat ggtctcttcc tggttgtgga aagagctagg 8821 caaacacaaa cggccacgag tctgtaccaa agaagagttc atcaacaagg ttcgcagcaa 8881 tgcagcatta ggggcaatat ttgaagagga aaaagagtgg aagactgcag tggaagctgt 8941 gaacgatcca aggttctggg ctctagtgga caaggaaaga gagcaccacc tgagaggaga 9001 gtgccagagt tgtgtgtaca acatgatggg aaaaagagaa aagaaacaag gggaatttgg 9061 aaaggccaag ggcagccgcg ccatctggta tatgtggcta ggggctagat ttctagagtt 9121 cgaagccctt ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg 9181 tgttgaaggg ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc 9241 aggaggaagg atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga 9301 tctggagaat gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt 9361 ggccataatc aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa 9421 agggaaaaca gttatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt 9481 cacttacgct cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc 9541 tgaggaagtt ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa 9601 ctggttgcag agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg 9661 cgttgtgaag ccaattgatg acaggtttgc acatgccctc aggttcttga atgatatggg 9721 aaaagttagg aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga 9781 agttccgttt tgctcccacc acttcaacaa gctccatctc aaggacggga ggtccattgt 9841 ggttccctgc cgccaccaag atgaactgat tggccgggcc cgcgtctctc caggggcggg 9901 atggagcatc cgggagactg cttgcctagc aaaatcatat gcgcaaatgt ggcagctcct 9961 ttatttccat agaagggacc tccgactgat ggccaatgcc atttgttcat ctgtgccagt 10021 tgactgggtt ccaactggga gaactacctg gtcaatccat ggaaagggag aatggatgac 10081 cactgaagac atgcttgtgg tgtggaacag agtgtggatt gaggagaacg accacatgga 10141 agacaagacc ccagttacga aatggacaga cattccctat ttgggaaaaa gggaagactt 10201 gtggtgtgga tctctcatag ggcacagacc gcgcaccacc tgggctgaga acattaaaaa 10261 cacagtcaac atggtgcgca ggatcatagg tgatgaagaa aagtacatgg actacctatc 10321 cacccaagtt cgctacttgg gtgaagaagg gtctacacct ggagtgctgt aagcaccaat 10381 cttaatgttg tcaggcctgc tagtcagcca cagcttgggg aaagctgtgc agcctgtgac 10441 ccccccagga gaagctggga aaccaagcct atagtcaggc cgagaacgcc atggcacgga 10501 agaagccatg ctgcctgtga gcccctcaga ggacactgag tcaaaaaacc ccacgcgctt 10561 ggaggcgcag gatgggaaaa gaaggtggcg accttcccca cccttcaatc tggggcctga 10621 actggagatc agctgtggat ctccagaaga gggactagtg gttagaggag accccccgga 10681 aaacgcaaaa cagcatattg acgctgggaa agaccagaga ctccatgagt ttccaccacg 10741 ctggccgcca ggcacagatc gccgaatagc ggcggccggt gtggggaaat ccatg
  12. Fundacao Oswaldo Cruz has release a full Zika sequence, Rio-U1, from urine collected from a Rio de Janeiro patient on Jan 14,2016 http://www.ncbi.nlm.nih.gov/nuccore/KU926309
  13. Sequence map https://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en
  14. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1838118381100%0.099%KU509998.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1837518375100%0.099%KJ776791.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1836618366100%0.099%KU527068.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1836618366100%0.099%KU321639.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1835718357100%0.099%KU729217.2Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1835718357100%0.099%KU729218.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1835718357100%0.099%KU707826.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1835718357100%0.099%KU365779.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome1834518345100%0.099%KU853013.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1834518345100%0.099%KU501217.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1834518345100%0.099%KU365780.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome1834318343100%0.099%KU853012.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome183411834199%0.099%KU497555.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1833918339100%0.099%KU647676.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1833918339100%0.099%KU501216.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1833918339100%0.099%KU365777.1Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds1833618336100%0.099%KU820897.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1832718327100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1832718327100%0.099%KU312312.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome1832118321100%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome1831818318100%0.099%KU922923.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1831818318100%0.099%KU501215.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds1830018300100%0.099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds1829118291100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1829118291100%0.099%KU761564.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1827318273100%0.099%KU820899.2Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds1816418164100%0.099%KU866423.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1813218132100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1804218042100%0.099%KU681081.3Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177351773599%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds176881768898%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1759817598100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1743417434100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164511645199%0.096%HQ234499.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1329313293100%0.089%KF383115.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1328813288100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1328813288100%0.089%KF268948.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1328113281100%0.089%KF268950.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1327713277100%0.089%KU720415.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds132721327299%0.089%HQ234498.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1327013270100%0.089%DQ859059.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1325913259100%0.089%KF383119.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1325413254100%0.089%LC002520.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1323913239100%0.089%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132321323299%0.089%HQ234501.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1319613196100%0.089%AY632535.2Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131471314799%0.088%HQ234500.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1313313133100%0.088%KF383117.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1293613004100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128551285597%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108441084497%0.084%KF383120.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4958495827%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4931493127%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4632463225%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4623462325%0.099%KU646827.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3416341618%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3214321417%0.099%KU740199.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds2863419595%0.071%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2677267714%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2051205111%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2021202111%0.099%KU179098.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds175217529%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds174817489%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds174617469%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds174517459%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds174517459%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds174517459%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds174317439%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds160216028%0.099%KJ873160.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds142014207%0.099%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds138213827%0.099%KM851039.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds134613467%0.099%KU556802.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds134613467%0.098%KM851038.1Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds1306130610%0.088%AF013415.1Select seq gb|KT200609.1|Zika virus isolate BR/949/15 NS5 gene, partial cds124512456%0.099%KT200609.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds124012406%0.099%KU232300.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds123112316%0.099%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds122912296%0.099%KU232297.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds122012206%0.099%KU232294.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds121812186%0.099%KU232292.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds121412146%0.099%KU232298.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds121112116%0.099%KU232296.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds121112116%0.099%KU232293.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds120512056%0.099%KU232295.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds119511956%0.099%KU232288.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds119111916%0.099%KU232289.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds118711876%0.099%KU232299.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds118611866%0.099%KU232291.1Select seq gb|KU758878.1|Zika virus polyprotein gene, partial cds113311336%0.099%KU758878.1Select seq gb|KF270886.1|Zika virus strain CCB-870 envelope glycoprotein gene, partial cds108610868%0.089%KF270886.1Select seq gb|KU867812.1|Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds101810185%0.0100%KU867812.1
  15. LOCUS KU926310 10805 bp ss-RNA linear VRL 21-MAR-2016 DEFINITION Zika virus isolate Rio-S1, complete genome. ACCESSION KU926310 VERSION KU926310.1 GI:1006593054 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10805) AUTHORS Bonaldo,M.C., Ribeiro,I.P., Lima,N.S., Santos,A.A.C., Raphael,L.M.S., Cruz,S.O.D., Mello,I.S., Furtado,N.D., Moura,E.E., Castro,M.G., Gerber,A.L., Almeida,L.G.P., Lourenco-de-Oliveira,R., Vasconcelos,A.T.R. and Brasil,P. TITLE Isolation of infective Zika virus from urine and saliva of patients in Brazil JOURNAL Unpublished REFERENCE 2 (bases 1 to 10805) AUTHORS Bonaldo,M.C., Ribeiro,I.P., Lima,N.S., Santos,A.A.C., Raphael,L.M.S., Cruz,S.O.D., Mello,I.S., Furtado,N.D., Moura,E.E., Castro,M.G., Gerber,A.L., Almeida,L.G.P., Lourenco-de-Oliveira,R., Vasconcelos,A.T.R. and Brasil,P. TITLE Direct Submission JOURNAL Submitted (16-MAR-2016) Laboratorio Nacional de Bioinformatica / Laboratorio Nacional de Computacao Cientifica, Laboratorio de Biologia Molecular de Flavivirus / Fundacao Oswaldo Cruz, Rua Getulio Vargas, 333, Petropolis, RJ 25651075, Brazil COMMENT ##Assembly-Data-START## Assembly Method :: Ray v. 2.2.0 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10805 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Rio-S1" /isolation_source="saliva" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="29-Jan-2016" /note="passage details: Vero cells" 5'UTR 1..106 CDS 107..10378 /codon_start=1 /product="polyprotein" /protein_id="AMQ48982.1" /db_xref="GI:1006593055" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG ADGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSVVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGATFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMAGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" mat_peptide 107..472 /product="anchored capsid protein C" mat_peptide 107..418 /product="capsid protein C" mat_peptide 473..976 /product="membrane glycoprotein precursor M" mat_peptide 473..751 /product="protein pr" mat_peptide 752..976 /product="membrane glycoprotein M" mat_peptide 977..2488 /product="envelope protein E" mat_peptide 2489..3544 /product="nonstructural protein NS1" mat_peptide 3545..4222 /product="nonstructural protein NS2A" mat_peptide 4223..4612 /product="nonstructural protein NS2B" mat_peptide 4613..6463 /product="nonstructural protein NS3" mat_peptide 6464..6844 /product="nonstructural protein NS4A" mat_peptide 6845..6913 /product="protein 2K" mat_peptide 6914..7666 /product="nonstructural protein NS4B" mat_peptide 7667..10375 /product="RNA-dependent RNA polymerase NS5" 3'UTR 10379..10805 ORIGIN 1 gttgttgatc tgtgtgaatc agactgcgac agttcgagtt tgaagcgaaa gctagcaaca 61 gtatcaacag gttttatttt ggatttggaa acgagagttt ctggtcatga aaaacccaaa 121 aaagaaatcc ggaggattcc ggattgtcaa tatgctaaaa cgcggagtag cccgtgtgag 181 cccctttggg ggcttgaaga ggctgccagc cggacttctg ctgggtcatg ggcccatcag 241 gatggtcttg gcgattctag cctttttgag attcacggca atcaagccat cactgggtct 301 catcaataga tggggttcag tggggaaaaa agaggctatg gaaataataa agaagttcaa 361 gaaagatctg gctgccatgc tgagaataat caatgctagg aaggagaaga agagacgagg 421 cgcagatact agtgtcggaa ttgttggcct cctgctgacc acagctatgg cagcggaggt 481 caccagacgt gggagtgcat actatatgta cttggacaga aacgatgctg gggaggccat 541 atcttttcca accacattgg ggatgaataa gtgttatata cagatcatgg atcttggaca 601 catgtgtgat gccaccatga gctatgaatg ccctatgctg gatgaggggg tggaaccaga 661 tgacgtcgat tgttggtgca acacgacgtc aacttgggtt gtgtacggaa cctgccatca 721 caaaaaaggt gaagcacgga gatctagaag agctgtgacg ctcccctccc attccactag 781 gaagctgcaa acgcggtcgc aaacctggtt ggaatcaaga gaatacacaa agcacttgat 841 tagagtcgaa aattggatat tcaggaaccc tggcttcgcg ttagcagcag ctgccatcgc 901 ttggcttttg ggaagctcaa cgagccaaaa agtcatatac ttggtcatga tactgctgat 961 tgccccggca tacagcatca ggtgcatagg agtcagcaat agggactttg tggaaggtat 1021 gtcaggtggg acttgggttg atgttgtctt ggaacatgga ggttgtgtca ccgtaatggc 1081 acaggacaaa ccgactgtcg acatagagct ggttacaaca acagtcagca acatggcgga 1141 ggtaagatcc tactgctatg aggcatcaat atcagacatg gcttcggaca gccgctgccc 1201 aacacaaggt gaagcctacc ttgacaagca atcagacact caatatgtct gcaaaagaac 1261 gttggtggac agaggctggg gaaatggatg tggacttttt ggcaaaggga gcctggtgac 1321 atgcgctaag tttgcatgct ccaagaaaat gaccgggaag agcatccagc cagagaatct 1381 ggagtaccgg ataatgctgt cagttcatgg ctcccagcac agtgggatga tcgttaatga 1441 cacaggacat gaaactgatg agaatagagc gaaggttgag ataacgccca attcaccaag 1501 agccgaagcc accctggggg gttttggaag cctaggactt gattgtgaac cgaggacagg 1561 ccttgacttt tcagatttgt attacttgac tatgaataac aagcattggt tggttcacaa 1621 ggagtggttc cacgacattc cattaccttg gcacgctggg gcagacaccg gaactccaca 1681 ctggaacaac aaagaagcac tggtagagtt caaggacgca catgccaaaa ggcaaactgt 1741 cgtggttcta gggagtcaag aaggagcagt tcacacggcc cttgctggag ctctggaggc 1801 tgagatggat ggtgcaaagg gaaggctgtc ctctggccac ttgaaatgtc gcctgaaaat 1861 ggataaactt agattgaagg gcgtgtcata ctccttgtgt accgcagcgt tcacattcac 1921 caagatcccg gctgaaacac tgcacgggac agtcacagtg gaggtacagt acgcaggggc 1981 agatggaccc tgcaaggttc cagctcagat ggcggtggac atgcaaactc tgaccccagt 2041 tgggaggttg ataaccgcca accccgtaat cactgaaagc actgagaact ctaagatgat 2101 gctggaactt gatccaccat ttggggactc ttacattgtc ataggagtcg gggagaagaa 2161 gatcacccac cactggcaca ggagtggcag caccattgga aaagcatttg aagccactgt 2221 gagaggtgcc aagagaatgg cagtcttggg agacacagcc tgggactttg gatcagttgg 2281 aggcgctctc aactcattgg gcaagggcat ccatcaaatt tttggagcag ctttcaaatc 2341 attgtttgga ggaatgtcct ggttctcaca aatcctcatt ggaacgttgc tgatgtggtt 2401 gggtctgaac acaaagaatg gatctatttc ccttatgtgc ttggccttag ggggagtgtt 2461 gatcttctta tccacagccg tctctgctga tgtggggtgc tcggtggact tctcaaagaa 2521 ggagacgaga tgcggtacag gggtgttcgt ctataacgac gttgaagcct ggagggatag 2581 gtacaagtac catcctgact ccccccgtag attggcagca gcagtcaagc aagcctggga 2641 agatggtatc tgcgggatct cctctgtttc aagaatggag aacatcatgt ggagatcagt 2701 agaaggggag ctcaacgcaa tcctggaaga gaatggagtt caactgacgg tcgttgtggg 2761 atctgtaaaa aaccccatgt ggagaggtcc acagagattg cccgtgcctg tgaacgagct 2821 gccccacggc tggaaggctt gggggaaatc gtacttcgtc agagcagcaa agacaaataa 2881 cagctttgtc gtggatggtg acacactgaa ggaatgccca ctcaaacata gagcatggaa 2941 cagctttctt gtggaggatc atgggttcgg ggtatttcac actagtgtct ggctcaaggt 3001 tagagaagat tattcattag agtgtgatcc agccgttatt ggaacagctg ttaagggaaa 3061 ggaggctgta cacagtgatc taggctactg gattgagagt gagaagaatg acacatggag 3121 gctgaagagg gcccatctga tcgagatgaa aacatgtgaa tggccaaagt cccacacatt 3181 gtggacagat ggaatagaag agagtgatct gatcataccc aagtctttag ctgggccact 3241 cagccatcac aataccagag agggctacag gacccaaatg aaagggccat ggcacagtga 3301 agagcttgaa attcggtttg aggaatgccc aggcactaag gtccacgtgg aggaaacatg 3361 tggaacaaga ggaccatctc tgagatcaac cactgcaagc ggaagggtga tcgaggaatg 3421 gtgctgcagg gagtgcacaa tgcccccact gtcgttccgg gctaaagatg gctgttggta 3481 tggaatggag ataaggccca ggaaagaacc agaaagcaac ttagtaaggt cagtggtgac 3541 tgcaggatca actgatcaca tggatcactt ctcccttgga gtgcttgtga ttctgctcat 3601 ggtgcaggaa gggctgaaga agagaatgac cacaaagatc atcataagca catcaatggc 3661 agtgctggta gctatgatcc tgggaggatt ttcaatgagt gacctggcta agcttgcaat 3721 tttgatgggt gccaccttcg cggaaatgaa cactggagga gatgtagctc atctggcgct 3781 gatagcggca ttcaaagtca gaccagcgtt gctggtatct ttcatcttca gagctaattg 3841 gacaccccgt gaaagcatgc tgctggcctt ggcctcgtgt cttttgcaaa ctgcgatctc 3901 cgccttggaa ggcgacctga tggttctcat caatggtttt gctttggcct ggttggcaat 3961 acgagcgatg gttgttccac gcactgataa catcaccttg gcaatcctgg ctgctctgac 4021 accactggcc cggggcacac tgcttgtggc gtggagagca ggccttgcta cttgcggggg 4081 gtttatgctc ctctctctga agggaaaagg cagtgtgaag aagaacttac catttgtcat 4141 ggccctggga ctaaccgctg tgaggctggt cgaccccatc aacgtggtgg gactgctgtt 4201 gctcacaagg agtgggaagc ggagctggcc ccctagcgaa gtactcacag ctgttggcct 4261 gatatgcgca ttggctggag ggttcgccaa ggcagatata gagatggctg ggcccatggc 4321 cgcggtcggt ctgctaattg tcagttacgt ggtctcagga aagagtgtgg acatgtacat 4381 tgaaagagca ggtgacatca catgggaaaa agatgcggaa gtcactggaa acagtccccg 4441 gctcgatgtg gcgctagatg agagtggtga tttctccctg gtggaggatg acggtccccc 4501 catgagagag atcatactca aggtggtcct gatgaccatc tgtggcatga acccaatagc 4561 catacccttt gcagctggag cgtggtacgt atacgtgaag actggaaaaa ggagtggtgc 4621 tctatgggat gtgcctgctc ccaaggaagt aaaaaagggg gagaccacag atggagtgta 4681 cagagtaatg actcgtagac tgctaggttc aacacaagtt ggagtgggag ttatgcaaga 4741 gggggtcttt cacactatgt ggcacgtcac aaaaggatcc gcgctgagaa gcggtgaagg 4801 gagacttgat ccatactggg gagatgtcaa gcaggatctg gtgtcatact gtggtccatg 4861 gaagctagat gccgcctggg acgggcacag cgaggtgcag ctcttggccg tgccccccgg 4921 agagagagcg aggaacatcc agactctgcc cggaatattt aagacaaagg atggggacat 4981 tggagcggtt gcgctggatt acccagcagg aacttcagga tctccaatcc tagacaagtg 5041 tgggagagtg ataggacttt atggcaatgg ggtcgtgatc aaaaatggga gttatgttag 5101 tgccatcacc caagggagga gggaggaaga gactcctgtt gagtgcttcg agccttcgat 5161 gctgaagaag aagcagctaa ctgtcttaga cttgcatcct ggagccggga aaaccaggag 5221 agttcttcct gaaatagtcc gtgaagccat aaaaacaaga ctccgtactg tgatcttagc 5281 tccaaccagg gttgtcgctg ctgaaatgga ggaagccctt agagggcttc cagtgcgtta 5341 tatgacaaca gcagtcaatg tcacccactc tggaacagaa atcgtcgact taatgtgcca 5401 tgccaccttc acttcacgtc tactacagcc aatcagagtc cccaactata atctgtatat 5461 tatggatgag gcccacttca cagatccctc aagcatagca gcaagaggat acatttcaac 5521 aagggttgag atgggcgagg cggctgccat cttcatgacc gccacgccac caggaacccg 5581 tgacgcattt ccggactcca actcaccaat tatggacacc gaagtggaag tcccagagag 5641 agcctggagc tcaggctttg attgggtgac ggatcattct ggaaaaacag tttggtttgt 5701 tccaagcgtg aggaacggca atgagatcgc agcttgtctg acaaaggctg gaaaacgggt 5761 catacagctc agcagaaaga cttttgagac agagttccag aaaacaaaac atcaagagtg 5821 ggactttgtc gtgacaactg acatttcaga gatgggcgcc aactttaaag ctgaccgtgt 5881 catagattcc aggagatgcc taaagccggt catacttgat ggcgagagag tcattctggc 5941 tggacccatg cctgtcacac atgccagcgc tgcccagagg agggggcgca taggcaggaa 6001 tcccaacaaa cctggagatg agtatctgta tggaggtggg tgcgcagaga ctgatgaaga 6061 ccatgcacac tggcttgaag caagaatgct ccttgacaat atttacctcc aagatggcct 6121 catagcctcg ctctatcgac ctgaggccga caaagtagca gccattgagg gagagttcaa 6181 gcttaggacg gagcaaagga agacctttgt ggaactcatg aaaagaggag atcttcctgt 6241 ttggctggcc tatcaggttg catctgccgg aataacctac acagatagaa gatggtgctt 6301 tgatggcacg accaacaaca ccataatgga agacagtgtg ccggcagagg tgtggaccag 6361 acacggagag aaaagagtgc tcaaaccgag gtggatggac gccagagttt gttcagatca 6421 tgcggccctg aagtcattca aggagtttgc cgctgggaaa agaggagcga cttttggagt 6481 gatggaagcc ctgggaacac tgccaggaca catgacagag agattccagg aagccattga 6541 caacctcgct gtgctcatgc gggcagagac tggaagcagg ccttacaaag ccgcggcggc 6601 ccaattgccg gagaccttag agaccattat gcttttggga ttgctgggaa cagtctcgtt 6661 gggaatcttt ttcgtcttga tgaggaacaa gggcataggg aagatgggct ttggaatggt 6721 gactcttggg gccagcgcat ggctcatgtg gctctcggaa attgagccag ccagaattgc 6781 atgtgtcctc attgttgtgt tcctattgct ggtggtgctc atacctgagc cagaaaagca 6841 aagatctccc caggacaacc aaatggcaat catcatcatg gtagcagtag gtcttctggg 6901 cttgattacc gccaatgaac tcggatggtt ggagagaaca aagagtgacc taagccatct 6961 aatgggaagg agagaggagg gagcaaccat aggattctca atggacattg acctgcggcc 7021 agcctcagct tgggccatct atgctgcctt gacaactttc attactccag ccgtccaaca 7081 tgcagtgacc acttcataca acaactactc cttaatggcg atggccacgc aagctggagt 7141 gttgtttggt atgggcaaag ggatgccatt ctacgcatgg gactttggag tcccgctgct 7201 aatgataggt tgctactcac aattaacacc cctgacccta atagtggcca tcattttgct 7261 cgtggcgcac tacatgtact tgatcccagg gctgcaggca gcagctgcgc gtgctgccca 7321 gaagagaacg gcagctggca tcatgaagaa ccctgttgtg gatggaatag tggtgactga 7381 cattgacaca atgacaattg acccccaagt ggagaaaaag atgggacagg tgctactcat 7441 agcagtagcc gtctccagcg ccatactgtc gcggaccgcc tgggggtggg gggaggctgg 7501 ggccctgatc acagccgcaa cttccacttt gtgggaaggc tctccgaaca agtactggaa 7561 ctcctctaca gccacttcac tgtgtaacat ttttagggga agttacttgg ctggagcttc 7621 tctaatctac acagtaacaa gaaacgctgg cttggtcaag agacgtgggg gtggaacagg 7681 agagaccctg ggagagaaat ggaaggcccg cttgaaccag atgtcggccc tggagttcta 7741 ctcctacaaa aagtcaggca tcaccgaggt gtgcagagaa gaggcccgcc gcgccctcaa 7801 ggacggtgtg gcaacgggag gccatgctgt gtcccgagga agtgcaaagc tgagatggtt 7861 agtggagcgg ggatacctgc agccctatgg aaaggtcatt gatcttggat gtggcagagg 7921 gggctggagt tactacgccg ccaccatccg caaagttcaa gaagtgaaag gatacacaaa 7981 aggaggccct ggtcatgaag aacccgtgtt ggtgcaaagc tatgggtgga acatagtccg 8041 tcttaagagt ggggtggacg tctttcatat ggcggctgag ccgtgtgaca cgttgctgtg 8101 tgacataggt gagtcatcat ctagtcctga agtggaagaa gcacggacgc tcagagtcct 8161 ctccatggcg ggggattggc ttgaaaaaag accaggagcc ttttgtataa aagtgttgtg 8221 cccatacacc agcaccatga tggaaaccct ggagcgactg cagcgtaggt atgggggagg 8281 actggtcaga gtgccactct cccgcaactc tacacatgag atgtactggg tctctggagc 8341 gaaaagcaac accataaaaa gtgtgtccac cacgagccag ctcctcttgg ggcgcatgga 8401 cgggcctagg aggccagtga aatatgagga ggatgtgaat ctcggctctg gcacgcgggc 8461 tgtggtaagc tgcgctgaag ctcccaacat gaagatcatt ggtaaccgca ttgaaaggat 8521 ccgcagtgag cacgcggaaa cgtggttctt tgacgagaac cacccatata ggacatgggc 8581 ttaccatgga agctatgagg cccccacaca agggtcagcg tcctctctaa taaacggggt 8641 tgtcaggctc ctgtcaaaac cctgggatgt ggtgactgga gtcacaggaa tagccatgac 8701 cgacaccaca ccgtatggtc agcaaagagt tttcaaggaa aaagtggaca ctagggtgcc 8761 agacccccaa gaaggcactc gtcaggttat gagcatggtc tcttcctggt tgtggaaaga 8821 gctaggcaaa cacaaacggc cacgagtctg taccaaagaa gagttcatca acaaggttcg 8881 tagcaatgca gcattagggg caatatttga agaggaaaaa gagtggaaga ctgcagtgga 8941 agctgtgaac gatccaaggt tctgggctct agtggacaag gaaagagagc accacctgag 9001 aggagagtgc cagagttgtg tgtacaacat gatgggaaaa agagaaaaga aacaagggga 9061 atttggaaag gccaagggca gccgcgccat ctggtatatg tggctagggg ctagatttct 9121 agagttcgaa gcccttggat tcttgaacga ggatcactgg atggggagag agaactcagg 9181 aggtggtgtt gaagggctgg gattacaaag actcggatat gtcctagaag agatgagtcg 9241 cataccagga ggaaggatgt atgcagatga cactgctggc tgggacaccc gcatcagcag 9301 gtttgatctg gagaatgaag ctctaatcac caaccaaatg gagaaagggc acagggcctt 9361 ggcattggcc ataatcaagt acacatacca aaacaaagtg gtaaaggtcc ttagaccagc 9421 tgaaaaaggg aaaacagtta tggacattat ttcgagacaa gaccaaaggg ggagcggaca 9481 agttgtcact tacgctctta acacatttac caatctagtg gtgcaactca ttcggaatat 9541 ggaggctgag gaagttctag agatgcaaga cttgtggctg ctgcggaggt cagagaaagt 9601 gaccaactgg ttgcagagca acggatggga taggctcaaa cgaatggcag tcagtggaga 9661 tgattgcgtt gtgaagccaa ttgatgatag gtttgcacat gccctcaggt tcttgaatga 9721 tatgggaaaa gttaggaagg acacacaaga gtggaaaccc tcaactggat gggacaactg 9781 ggaagaagtt ccgttttgct cccaccactt caacaagctc catctcaagg acgggaggtc 9841 cattgtggtt ccctgccgcc accaagatga actgattggc cgggcccgcg tctctccagg 9901 ggcgggatgg agcatccggg agactgcttg cctagcaaaa tcatatgcgc aaatgtggca 9961 gctcctttat ttccacagaa gggacctccg actgatggcc aatgccattt gttcatctgt 10021 gccagttgac tgggttccaa ctgggagaac tacctggtca atccatggaa agggagaatg 10081 gatgaccact gaagacatgc ttgtggtgtg gaacagagtg tggattgagg agaacgacca 10141 catggaagac aagaccccag ttacgaaatg gacagacatt ccctatttgg gaaaaaggga 10201 agacttgtgg tgtggatctc tcatagggca cagaccgcgc accacctggg ctgagaacat 10261 taaaaacaca gtcaacatgg tgcgcaggat cataggtgat gaagaaaagt acatggacta 10321 cctatccacc caagttcgct acttgggtga agaagggtct acacctggag tgctgtaagc 10381 accaatctta atgttgtcag gcctgctagt cagccacagc ttggggaaag ctgtgcagcc 10441 tgtgaccccc ccaggagaag ctgggaaacc aagcctatag tcaggccgag aacgccatgg 10501 cacggaagaa gccatgctgc ctgtgagccc ctcagaggac actgagtcaa aaaaccccac 10561 gcgcttggag gcgcaggatg ggaaaagaag gtggcgacct tccccaccct tcaatctggg 10621 gcctgaactg gagatcagct gtggatctcc agaagaggga ctagtggtta gaggagaccc 10681 cccggaaaac gcaaaacagc atattgacgc tgggaaagac cagagactcc atgagtttcc 10741 accacgctgg ccgccaggca cagatcgccg aatagcggcg gccggtgtgg ggaaatccat 10801 gggcc
  16. Fundacao Oswaldo Cruz has released a full sequence from a Rio de Janiero patient isolated from saliva, Rio-S1, collected Jan 29, 2016.http://www.ncbi.nlm.nih.gov/nuccore/KU926310
  17. LOCUS KU926310 10805 bp ss-RNA linear VRL 21-MAR-2016 DEFINITION Zika virus isolate Rio-S1, complete genome. ACCESSION KU926310 VERSION KU926310.1 GI:1006593054 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10805) AUTHORS Bonaldo,M.C., Ribeiro,I.P., Lima,N.S., Santos,A.A.C., Raphael,L.M.S., Cruz,S.O.D., Mello,I.S., Furtado,N.D., Moura,E.E., Castro,M.G., Gerber,A.L., Almeida,L.G.P., Lourenco-de-Oliveira,R., Vasconcelos,A.T.R. and Brasil,P. TITLE Isolation of infective Zika virus from urine and saliva of patients in Brazil JOURNAL Unpublished REFERENCE 2 (bases 1 to 10805) AUTHORS Bonaldo,M.C., Ribeiro,I.P., Lima,N.S., Santos,A.A.C., Raphael,L.M.S., Cruz,S.O.D., Mello,I.S., Furtado,N.D., Moura,E.E., Castro,M.G., Gerber,A.L., Almeida,L.G.P., Lourenco-de-Oliveira,R., Vasconcelos,A.T.R. and Brasil,P. TITLE Direct Submission JOURNAL Submitted (16-MAR-2016) Laboratorio Nacional de Bioinformatica / Laboratorio Nacional de Computacao Cientifica, Laboratorio de Biologia Molecular de Flavivirus / Fundacao Oswaldo Cruz, Rua Getulio Vargas, 333, Petropolis, RJ 25651075, Brazil COMMENT ##Assembly-Data-START## Assembly Method :: Ray v. 2.2.0 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10805 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Rio-S1" /isolation_source="saliva" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="29-Jan-2016" /note="passage details: Vero cells"http://www.ncbi.nlm.nih.gov/nuccore/KU926310
  18. LOCUS KU926309 10795 bp ss-RNA linear VRL 21-MAR-2016 DEFINITION Zika virus isolate Rio-U1, complete genome. ACCESSION KU926309 VERSION KU926309.1 GI:1006593051 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10795) AUTHORS Bonaldo,M.C., Ribeiro,I.P., Lima,N.S., Santos,A.A.C., Raphael,L.M.S., Cruz,S.O.D., Mello,I.S., Furtado,N.D., Moura,E.E., Castro,M.G., Gerber,A.L., Almeida,L.G.P., Lourenco-de-Oliveira,R., Vasconcelos,A.T.R. and Brasil,P. TITLE Isolation of infective Zika virus from urine and saliva of patients in Brazil JOURNAL Unpublished REFERENCE 2 (bases 1 to 10795) AUTHORS Bonaldo,M.C., Ribeiro,I.P., Lima,N.S., Santos,A.A.C., Raphael,L.M.S., Cruz,S.O.D., Mello,I.S., Furtado,N.D., Moura,E.E., Castro,M.G., Gerber,A.L., Almeida,L.G.P., Lourenco-de-Oliveira,R., Vasconcelos,A.T.R. and Brasil,P. TITLE Direct Submission JOURNAL Submitted (16-MAR-2016) Laboratorio Nacional de Bioinformatica / Laboratorio Nacional de Computacao Cientifica, Laboratorio de Biologia Molecular de Flavivirus / Fundacao Oswaldo Cruz, Rua Getulio Vargas, 333, Petropolis, RJ 25651075, Brazil COMMENT ##Assembly-Data-START## Assembly Method :: Ray v. 2.2 Coverage :: 8000 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10795 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Rio-U1" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="14-Jan-2016" /note="passage details: Vero cells"http://www.ncbi.nlm.nih.gov/nuccore/KU926309
  19. Department Of Health Daily Zika Update: No New Cases TodayBy Florida Department of Health, Office of Communications March 23, 2016 Press ReleaseSHARE THIS PAGEFacebookTwitter March 23, 2016 DEPARTMENT OF HEALTH DAILY ZIKA UPDATE: NO NEW CASES TODAY Contact:Communications [email protected](850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the Florida Department of Health will issue a Zika virus update each week day at 2 p.m. Updates will include a CDC-confirmed Zika case count by county and information to better keep Floridians prepared. There are no new cases today. Of the cases confirmed in Florida, eight cases are still exhibiting symptoms. According to the CDC, symptoms associated with the Zika virus last between seven to 10 days. Based on CDC guidance, several pregnant women who have traveled to countries with local-transmission of Zika have received antibody testing, and of those, four have tested positive for the Zika virus. The CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. It is recommended that women who are pregnant or thinking of becoming pregnant postpone travel to Zika affected areas. County Number of Cases (all travel related) Alachua 4 Brevard 2 Broward 11 Hillsborough 3 Lee 3 Miami-Dade 32 Orange 4 Osceola 4 Polk 2 Santa Rosa 1 Seminole 1 St. Johns 1 Cases involving pregnant women* 4 Total 72 *Counties of pregnant women will not be shared. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 1,150 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. All cases are travel-associated. There have been no locally-acquired cases of Zika in Florida. For more information on the Zika virus, click here. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. More Information on DOH action on Zika: On Feb. 3, Governor Scott directed the State Surgeon General to issue a Declaration of Public Health Emergency for the counties of residents with travel-associated cases of Zika.The Declaration currently includes the 12 affected counties – Alachua, Brevard, Broward, Hillsborough, Lee, Miami-Dade, Orange, Osceola, Polk, Santa Rosa, Seminole and St. Johns – and will be updated as needed. DOH encourages Florida residents and visitors to protect themselves from all mosquito-borne illnesses by draining standing water; covering their skin with repellent and clothing; and covering windows with screens.DOH has a robust mosquito-borne illness surveillance system and is working with the CDC, the Florida Department of Agriculture and Consumer Services and local county mosquito control boards to ensure that the proper precautions are being taken to protect Florida residents and visitors.Florida currently has the capacity to test 4,173 people for active Zika virus and 1,759 for Zika antibodies.Federal Guidance on Zika: According to the CDC, Zika illness is generally mild with a rash, fever and joint pain. CDC researchers are examining a possible link between the virus and harm to unborn babies exposed during pregnancy.The FDA released guidance regarding donor screening, deferral and product management to reduce the risk of transfusion-transmission of Zika virus. Additional information is available on the FDA website here.The CDC has put out guidance related to the sexual transmission of the Zika virus. This includes the CDC recommendation that if you have traveled to a country with local transmission of Zika you should abstain from unprotected sex.For more information on Zika virus, click here. About the Florida Department of Health The department works to protect, promote and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov. http://www.floridahealth.gov/newsroom/2016/03/032316-zika-update.html
  20. Zika Aquired ThroughCase CountTravel*5Locally**0_______________________________________________________________*: Case became infected with Zika Virus while traveling outside of West Virginia. For more information on Zika-affected areas, click here.**: Case became infected with Zika virus in West Virginia.
  21. Latest Facts and Advisories as of 3/23/2016 [ Español (PDF)]Reported cases of Zika in New York City: 20 Two of the twenty cases were pregnant women;All cases contracted Zika while visiting other countries; andAll patients have recovered.
  22. Zika and Birth Defects: The Evidence MountsPosted on March 15, 2016 by Dr. Francis CollinsCaption: Human neural progenitor cells (gray) infected with Zika virus (green) increased the enzyme caspase-3 (red), suggesting increased cell death. Credit: Sarah C. Ogden, Florida State University, Tallahassee Recently, public health officials have raised major concerns over the disturbing spread of the mosquito-borne Zika virus among people living in and traveling to many parts of Central and South America [1]. While the symptoms of Zika infection are typically mild, grave concerns have arisen about its potential impact during pregnancy. The concerns stem from the unusual number of births of children with microcephaly, a very serious condition characterized by a small head and damaged brain, coinciding with the spread of Zika virus. Now, two new studies strengthen the connection between Zika and an array of birth defects, including, but not limited to, microcephaly. In the first study, NIH-funded laboratory researchers show that Zika virus can infect and kill human neural progenitor cells [2]. Those progenitor cells give rise to the cerebral cortex, a portion of the brain often affected in children with microcephaly. The second study, involving a small cohort of women diagnosed with Zika virus during their pregnancies in Rio de Janeiro, Brazil, suggests that the attack rate is disturbingly high, and microcephaly is just one of many risks to the developing fetus. [3] The NIH-supported study, described in a recent issue of Cell Stem Cell, was led by Guo-li Ming and Hongjun Song of Johns Hopkins University School of Medicine, Baltimore, and Hengli Tang of Florida State University, Tallahassee. Their research teams turned to human induced pluripotent stem (iPS) cells, derived from skin biopsies, to produce human neural progenitor cells (hNPCs). These cells are readily found in the developing brain and are capable of becoming neurons in the cerebral cortex. The researchers found that Zika virus could readily infect those neural progenitors in lab dishes. In fact, within three days of inoculation, the virus had infected 65 to 90 percent of the cells. The infection also led to a 30 percent reduction in viable hNPCs, as some cells died and others grew more slowly. In another important experiment, the group discovered that, once infected, a neural progenitor cell turns into “a virus factory.” In other words, the virus exploits the cell’s own machinery to produce and release more Zika to infect more cells. While these findings will need to be confirmed in clinical studies, they suggest for the first time that Zika virus can directly target these essential neural cells. They also help to explain how Zika infection could cause harm to the developing brain, providing a possible link to microcephaly. Unfortunately, it now appears that microcephaly isn’t the only cause for worry about children exposed to Zika virus in the womb. In the second study, reported recently inThe New England Journal of Medicine, a team of U.S. and Brazilian researchers enrolled 88 healthy pregnant Brazilian women who within the past five days had developed a red skin rash, one of the symptoms associated with Zika infection. Seventy-two of these women were later confirmed by blood and/or urine tests to have Zika virus, and 42 of those agreed to undergo an abdominal ultrasound. Of the Zika-infected women, almost a third had developing babies that showed signs of very serious abnormalities by ultrasound. Five babies showed growth restrictions with or without microcephaly. Seven had other abnormalities of the central nervous system. Seven babies showed abnormally low levels of amniotic fluid or blood flow to the brain or umbilical cord. Doctors delivered one of the babies by emergency C-section due to a dangerous lack of amniotic fluid. Two babies in the study were stillborn just weeks before their due dates. None of the 16 Zika-uninfected women had pregnancies with fetal abnormalities. These preliminary findings suggest that exposure to Zika virus is risky at any stage of pregnancy—even for developing babies that don’t appear to have microcephaly or other malformations. Further research is urgently needed, and these researchers have now enrolled a total of 280 Brazilian women into their ongoing study. They’ll also continue to follow the outcomes for these women and their children over the coming months. Taken together, these studies strengthen the case that the Zika virus may well be behind the deeply troubling rise in microcephaly in Brazil. These new developments raise the question of why the ability of Zika virus to cause birth defects wasn’t previously known—after all, this virus has been around for a long time (it was originally described in 1947 in the Zika forest in Uganda). One possibility is that in endemic areas nearly all individuals are infected as children, have a mild illness, and then develop lifelong immunity. Only in the situation where a previously unexposed population encounters the virus in adulthood is the risk of active infection in pregnancy, and subsequent birth defects in the offspring, possible. (Scholars of virology will recognize this phenomenon as having similarities to rubella, or “German measles.”) The NIH is now working aggressively to develop a vaccine. But there are still many steps in development and testing before a vaccine could be made available to vulnerable populations. Meanwhile, CDC recommendations for travelers should be scrutinized by everyone. References: [1] Zika virus disease in the United States, 2015-2016. Centers for Disease Control and Prevention. 2016 Mar 9. [2] Zika virus infects human cortical neural progenitors and attenuates their growth. Tang H, Hammack C, Ogden SC, Wen Z, Qian X, Li Y, Yao B, Shin J, Zhang F, Lee EM, Christian KM, Didier RA, Jin P, Song H, Ming G. Cell Stem Cell. 2016 Mar 4. [Epub ahead of print] [3] Zika Virus Infection in Pregnant Women in Rio de Janeiro – Preliminary Report. Brasil P, Pereira JP Jr, Raja Gabaglia C, Damasceno L, Wakimoto M, Ribeiro Nogueira RM, Carvalho de Sequeira P, Machado Siqueira A, Abreu de Carvalho LM, Cotrim da Cunha D, Calvet GA, Neves ES, Moreira ME, Rodrigues Baião AE, Nassar de Carvalho PR, Janzen C, Valderramos SG, Cherry JD, Bispo de Filippis AM, Nielsen-Saines K. N Engl J Med. 2016 Mar 4. [Epub ahead of print] Links: Zika Virus (National Institute of Allergy and Infectious Diseases/NIH) Microcephaly Information Page (National Institute of Neurological Disorders and Stroke/NIH) Hongjun Song (Johns Hopkins University, Baltimore) Hengli Tang (Florida State University, Tallahassee) NIH Support: National Institute of Allergy and Infectious Diseases; National Institute of Neurological Disorders and Stroke http://directorsblog.nih.gov/2016/03/15/zika-and-birth-defects-the-evidence-mounts/
×
×
  • Create New...