niman

Many developments in last few days Link to wet market 45 cases to date 2 deaths - older with co-morbidities for 1 Limited H2H 3 Travelers

Risk is low

LOCUS MN908947 29903 bp ss-RNA linear VRL 17-JAN-2020 DEFINITION Wuhan seafood market pneumonia virus isolate Wuhan-Hu-1, complete genome. ACCESSION MN908947 VERSION MN908947.3 KEYWORDS . SOURCE Wuhan seafood market pneumonia virus ORGANISM Wuhan seafood market pneumonia virus Viruses; Riboviria; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; unclassified Betacoronavirus. REFERENCE 1 (bases 1 to 29903) AUTHORS Wu,F., Zhao,S., Yu,B., Chen,Y.-M., Wang,W., Hu,Y., Song,Z.-G., Tao,Z.-W., Tian,J.-H., Pei,Y.-Y., Yuan,M.L., Zhang,Y.-L., Dai,F.-H., Liu,Y., Wang,Q.-M., Zheng,J.-J., Xu,L., Holmes,E.C. and Zhang,Y.-Z. TITLE A novel coronavirus associated with a respiratory disease in Wuhan of Hubei province, China JOURNAL Unpublished REFERENCE 2 (bases 1 to 29903) AUTHORS Wu,F., Zhao,S., Yu,B., Chen,Y.-M., Wang,W., Hu,Y., Song,Z.-G., Tao,Z.-W., Tian,J.-H., Pei,Y.-Y., Yuan,M.L., Zhang,Y.-L., Dai,F.-H., Liu,Y., Wang,Q.-M., Zheng,J.-J., Xu,L., Holmes,E.C. and Zhang,Y.-Z. TITLE Direct Submission JOURNAL Submitted (05-JAN-2020) Shanghai Public Health Clinical Center & School of Public Health, Fudan University, Shanghai, China COMMENT On Jan 17, 2020 this sequence version replaced MN908947.2. ##Assembly-Data-START## Assembly Method :: Megahit v. V1.1.3 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..29903 /organism="Wuhan seafood market pneumonia virus" /mol_type="genomic RNA" /isolate="Wuhan-Hu-1" /host="Homo sapiens" /db_xref="taxon:2697049" /country="China" /collection_date="Dec-2019" 5'UTR 1..265 gene 266..21555 /gene="orf1ab" CDS join(266..13468,13468..21555) /gene="orf1ab" /ribosomal_slippage /note="translated by -1 ribosomal frameshift" /codon_start=1 /product="orf1ab polyprotein (pp1ab)" /protein_id="QHD43415.1" /translation="MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQ HLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGE TLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQEN WNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQ LDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFP LNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQTG DFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESG LKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNL LEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGN FKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAA ITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKL KPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLV NKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEII FLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEK YCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEK CSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEF KLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPE EEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSG YLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESD DYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLA PLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIA EIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGN LHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREM LAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLIN TLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSS KTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVIT FDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPH NSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIK WADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELG DVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQ IPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSK ETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYY KKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVT FFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWST KPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGD IILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNS VPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRI KASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTA ALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLET IQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWL MWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVE CTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRP INPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPI NVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVN TFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVEC LKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALI WNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWL KQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFA NKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLP RVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVA YESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSG RWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTN DVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFE EAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHL AKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNG LWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVL KLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSC GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVN VLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAV LDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHW LLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFL LPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTAR TVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLAR GIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYL VSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVL LSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKL CEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAK SEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALN NIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDA DSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTA CTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTP KGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAK AYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDH PNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSA DAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKD EDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQR LTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYA NLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVV DSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQ TYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRE LGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQ TVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDI RQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQ DALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAAT RGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLAR KHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQ AVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMM ILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCS QHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKH PNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTV LQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCD VTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDW TNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKP RPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSH TVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGK SHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKF KVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQ LPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLK AHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNA VASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSD RDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT EGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEG CHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIP LMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCL CDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNA HVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLADK FPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCL FWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQ LPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYN MMISAGFSLWVYKQFDTYNLWNTFTRLQSLENVAFNVVNKGHFDGQQGEVPVSIINNT VYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDY KRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEG SVKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFK PRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESP FELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKV TIDYTEISFMLWCKDGHVETFYPKLQSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGD SATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLP TGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEG FFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFL IGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKE GQINDMILSLLSKGRLIIRENNRVVISSDVLVNN" gene 21563..25384 /gene="S" CDS 21563..25384 /gene="S" /note="structural protein" /codon_start=1 /product="surface glycoprotein" /protein_id="QHD43416.1" /translation="MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFR SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIR GWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVY SSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQ GFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFL LKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITN LCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCF TNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYN YLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPY RVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFG RDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAI HADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR RARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTM YICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFG GFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFN GLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQN VLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGA ISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMS ECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAH FPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELD SFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELG KYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSE PVLKGVKLHYT" gene 25393..26220 /gene="ORF3a" CDS 25393..26220 /gene="ORF3a" /codon_start=1 /product="ORF3a protein" /protein_id="QHD43417.1" /translation="MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASLPFG WLIVGVALLAVFQSASKIITLKKRWQLALSKGVHFVCNLLLLFVTVYSHLLLVAAGLE APFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPY NSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQ LSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL" gene 26245..26472 /gene="E" CDS 26245..26472 /gene="E" /note="structural protein; E protein" /codon_start=1 /product="envelope protein" /protein_id="QHD43418.1" /translation="MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCC NIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV" gene 26523..27191 /gene="M" CDS 26523..27191 /gene="M" /note="structural protein" /codon_start=1 /product="membrane glycoprotein" /protein_id="QHD43419.1" /translation="MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNR FLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRL FARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCD IKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIA LLVQ" gene 27202..27387 /gene="ORF6" CDS 27202..27387 /gene="ORF6" /codon_start=1 /product="ORF6 protein" /protein_id="QHD43420.1" /translation="MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSL TENKYSQLDEEQPMEID" gene 27394..27759 /gene="ORF7a" CDS 27394..27759 /gene="ORF7a" /codon_start=1 /product="ORF7a protein" /protein_id="QHD43421.1" /translation="MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNS PFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFL IVAAIVFITLCFTLKRKTE" gene 27894..28259 /gene="ORF8" CDS 27894..28259 /gene="ORF8" /codon_start=1 /product="ORF8 protein" /protein_id="QHD43422.1" /translation="MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSK WYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRC SFYEDFLEYHDVRVVLDFI" gene 28274..29533 /gene="N" CDS 28274..29533 /gene="N" /note="structural protein" /codon_start=1 /product="nucleocapsid phosphoprotein" /protein_id="QHD43423.2" /translation="MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQG LPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMK DLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQ LPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAA LALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGR RGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYT GAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTV TLLPAADLDDFSKQLQQSMSSADSTQA" gene 29558..29674 /gene="ORF10" CDS 29558..29674 /gene="ORF10" /codon_start=1 /product="ORF10 protein" /protein_id="QHI42199.1" /translation="MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT" 3'UTR 29675..29903 ORIGIN 1 attaaaggtt tataccttcc caggtaacaa accaaccaac tttcgatctc ttgtagatct 61 gttctctaaa cgaactttaa aatctgtgtg gctgtcactc ggctgcatgc ttagtgcact 121 cacgcagtat aattaataac taattactgt cgttgacagg acacgagtaa ctcgtctatc 181 ttctgcaggc tgcttacggt ttcgtccgtg ttgcagccga tcatcagcac atctaggttt 241 cgtccgggtg tgaccgaaag gtaagatgga gagccttgtc cctggtttca acgagaaaac 301 acacgtccaa ctcagtttgc ctgttttaca ggttcgcgac gtgctcgtac gtggctttgg 361 agactccgtg gaggaggtct tatcagaggc acgtcaacat cttaaagatg gcacttgtgg 421 cttagtagaa gttgaaaaag gcgttttgcc tcaacttgaa cagccctatg tgttcatcaa 481 acgttcggat gctcgaactg cacctcatgg tcatgttatg gttgagctgg tagcagaact 541 cgaaggcatt cagtacggtc gtagtggtga gacacttggt gtccttgtcc ctcatgtggg 601 cgaaatacca gtggcttacc gcaaggttct tcttcgtaag aacggtaata aaggagctgg 661 tggccatagt tacggcgccg atctaaagtc atttgactta ggcgacgagc ttggcactga 721 tccttatgaa gattttcaag aaaactggaa cactaaacat agcagtggtg ttacccgtga 781 actcatgcgt gagcttaacg gaggggcata cactcgctat gtcgataaca acttctgtgg 841 ccctgatggc taccctcttg agtgcattaa agaccttcta gcacgtgctg gtaaagcttc 901 atgcactttg tccgaacaac tggactttat tgacactaag aggggtgtat actgctgccg 961 tgaacatgag catgaaattg cttggtacac ggaacgttct gaaaagagct atgaattgca 1021 gacacctttt gaaattaaat tggcaaagaa atttgacacc ttcaatgggg aatgtccaaa 1081 ttttgtattt cccttaaatt ccataatcaa gactattcaa ccaagggttg aaaagaaaaa 1141 gcttgatggc tttatgggta gaattcgatc tgtctatcca gttgcgtcac caaatgaatg 1201 caaccaaatg tgcctttcaa ctctcatgaa gtgtgatcat tgtggtgaaa cttcatggca 1261 gacgggcgat tttgttaaag ccacttgcga attttgtggc actgagaatt tgactaaaga 1321 aggtgccact acttgtggtt acttacccca aaatgctgtt gttaaaattt attgtccagc 1381 atgtcacaat tcagaagtag gacctgagca tagtcttgcc gaataccata atgaatctgg 1441 cttgaaaacc attcttcgta agggtggtcg cactattgcc tttggaggct gtgtgttctc 1501 ttatgttggt tgccataaca agtgtgccta ttgggttcca cgtgctagcg ctaacatagg 1561 ttgtaaccat acaggtgttg ttggagaagg ttccgaaggt cttaatgaca accttcttga 1621 aatactccaa aaagagaaag tcaacatcaa tattgttggt gactttaaac ttaatgaaga 1681 gatcgccatt attttggcat ctttttctgc ttccacaagt gcttttgtgg aaactgtgaa 1741 aggtttggat tataaagcat tcaaacaaat tgttgaatcc tgtggtaatt ttaaagttac 1801 aaaaggaaaa gctaaaaaag gtgcctggaa tattggtgaa cagaaatcaa tactgagtcc 1861 tctttatgca tttgcatcag aggctgctcg tgttgtacga tcaattttct cccgcactct 1921 tgaaactgct caaaattctg tgcgtgtttt acagaaggcc gctataacaa tactagatgg 1981 aatttcacag tattcactga gactcattga tgctatgatg ttcacatctg atttggctac 2041 taacaatcta gttgtaatgg cctacattac aggtggtgtt gttcagttga cttcgcagtg 2101 gctaactaac atctttggca ctgtttatga aaaactcaaa cccgtccttg attggcttga 2161 agagaagttt aaggaaggtg tagagtttct tagagacggt tgggaaattg ttaaatttat 2221 ctcaacctgt gcttgtgaaa ttgtcggtgg acaaattgtc acctgtgcaa aggaaattaa 2281 ggagagtgtt cagacattct ttaagcttgt aaataaattt ttggctttgt gtgctgactc 2341 tatcattatt ggtggagcta aacttaaagc cttgaattta ggtgaaacat ttgtcacgca 2401 ctcaaaggga ttgtacagaa agtgtgttaa atccagagaa gaaactggcc tactcatgcc 2461 tctaaaagcc ccaaaagaaa ttatcttctt agagggagaa acacttccca cagaagtgtt 2521 aacagaggaa gttgtcttga aaactggtga tttacaacca ttagaacaac ctactagtga 2581 agctgttgaa gctccattgg ttggtacacc agtttgtatt aacgggctta tgttgctcga 2641 aatcaaagac acagaaaagt actgtgccct tgcacctaat atgatggtaa caaacaatac 2701 cttcacactc aaaggcggtg caccaacaaa ggttactttt ggtgatgaca ctgtgataga 2761 agtgcaaggt tacaagagtg tgaatatcac ttttgaactt gatgaaagga ttgataaagt 2821 acttaatgag aagtgctctg cctatacagt tgaactcggt acagaagtaa atgagttcgc 2881 ctgtgttgtg gcagatgctg tcataaaaac tttgcaacca gtatctgaat tacttacacc 2941 actgggcatt gatttagatg agtggagtat ggctacatac tacttatttg atgagtctgg 3001 tgagtttaaa ttggcttcac atatgtattg ttctttctac cctccagatg aggatgaaga 3061 agaaggtgat tgtgaagaag aagagtttga gccatcaact caatatgagt atggtactga 3121 agatgattac caaggtaaac ctttggaatt tggtgccact tctgctgctc ttcaacctga 3181 agaagagcaa gaagaagatt ggttagatga tgatagtcaa caaactgttg gtcaacaaga 3241 cggcagtgag gacaatcaga caactactat tcaaacaatt gttgaggttc aacctcaatt 3301 agagatggaa cttacaccag ttgttcagac tattgaagtg aatagtttta gtggttattt 3361 aaaacttact gacaatgtat acattaaaaa tgcagacatt gtggaagaag ctaaaaaggt 3421 aaaaccaaca gtggttgtta atgcagccaa tgtttacctt aaacatggag gaggtgttgc 3481 aggagcctta aataaggcta ctaacaatgc catgcaagtt gaatctgatg attacatagc 3541 tactaatgga ccacttaaag tgggtggtag ttgtgtttta agcggacaca atcttgctaa 3601 acactgtctt catgttgtcg gcccaaatgt taacaaaggt gaagacattc aacttcttaa 3661 gagtgcttat gaaaatttta atcagcacga agttctactt gcaccattat tatcagctgg 3721 tatttttggt gctgacccta tacattcttt aagagtttgt gtagatactg ttcgcacaaa 3781 tgtctactta gctgtctttg ataaaaatct ctatgacaaa cttgtttcaa gctttttgga 3841 aatgaagagt gaaaagcaag ttgaacaaaa gatcgctgag attcctaaag aggaagttaa 3901 gccatttata actgaaagta aaccttcagt tgaacagaga aaacaagatg ataagaaaat 3961 caaagcttgt gttgaagaag ttacaacaac tctggaagaa actaagttcc tcacagaaaa 4021 cttgttactt tatattgaca ttaatggcaa tcttcatcca gattctgcca ctcttgttag 4081 tgacattgac atcactttct taaagaaaga tgctccatat atagtgggtg atgttgttca 4141 agagggtgtt ttaactgctg tggttatacc tactaaaaag gctggtggca ctactgaaat 4201 gctagcgaaa gctttgagaa aagtgccaac agacaattat ataaccactt acccgggtca 4261 gggtttaaat ggttacactg tagaggaggc aaagacagtg cttaaaaagt gtaaaagtgc 4321 cttttacatt ctaccatcta ttatctctaa tgagaagcaa gaaattcttg gaactgtttc 4381 ttggaatttg cgagaaatgc ttgcacatgc agaagaaaca cgcaaattaa tgcctgtctg 4441 tgtggaaact aaagccatag tttcaactat acagcgtaaa tataagggta ttaaaataca 4501 agagggtgtg gttgattatg gtgctagatt ttacttttac accagtaaaa caactgtagc 4561 gtcacttatc aacacactta acgatctaaa tgaaactctt gttacaatgc cacttggcta 4621 tgtaacacat ggcttaaatt tggaagaagc tgctcggtat atgagatctc tcaaagtgcc 4681 agctacagtt tctgtttctt cacctgatgc tgttacagcg tataatggtt atcttacttc 4741 ttcttctaaa acacctgaag aacattttat tgaaaccatc tcacttgctg gttcctataa 4801 agattggtcc tattctggac aatctacaca actaggtata gaatttctta agagaggtga 4861 taaaagtgta tattacacta gtaatcctac cacattccac ctagatggtg aagttatcac 4921 ctttgacaat cttaagacac ttctttcttt gagagaagtg aggactatta aggtgtttac 4981 aacagtagac aacattaacc tccacacgca agttgtggac atgtcaatga catatggaca 5041 acagtttggt ccaacttatt tggatggagc tgatgttact aaaataaaac ctcataattc 5101 acatgaaggt aaaacatttt atgttttacc taatgatgac actctacgtg ttgaggcttt 5161 tgagtactac cacacaactg atcctagttt tctgggtagg tacatgtcag cattaaatca 5221 cactaaaaag tggaaatacc cacaagttaa tggtttaact tctattaaat gggcagataa 5281 caactgttat cttgccactg cattgttaac actccaacaa atagagttga agtttaatcc 5341 acctgctcta caagatgctt attacagagc aagggctggt gaagctgcta acttttgtgc 5401 acttatctta gcctactgta ataagacagt aggtgagtta ggtgatgtta gagaaacaat 5461 gagttacttg tttcaacatg ccaatttaga ttcttgcaaa agagtcttga acgtggtgtg 5521 taaaacttgt ggacaacagc agacaaccct taagggtgta gaagctgtta tgtacatggg 5581 cacactttct tatgaacaat ttaagaaagg tgttcagata ccttgtacgt gtggtaaaca 5641 agctacaaaa tatctagtac aacaggagtc accttttgtt atgatgtcag caccacctgc 5701 tcagtatgaa cttaagcatg gtacatttac ttgtgctagt gagtacactg gtaattacca 5761 gtgtggtcac tataaacata taacttctaa agaaactttg tattgcatag acggtgcttt 5821 acttacaaag tcctcagaat acaaaggtcc tattacggat gttttctaca aagaaaacag 5881 ttacacaaca accataaaac cagttactta taaattggat ggtgttgttt gtacagaaat 5941 tgaccctaag ttggacaatt attataagaa agacaattct tatttcacag agcaaccaat 6001 tgatcttgta ccaaaccaac catatccaaa cgcaagcttc gataatttta agtttgtatg 6061 tgataatatc aaatttgctg atgatttaaa ccagttaact ggttataaga aacctgcttc 6121 aagagagctt aaagttacat ttttccctga cttaaatggt gatgtggtgg ctattgatta 6181 taaacactac acaccctctt ttaagaaagg agctaaattg ttacataaac ctattgtttg 6241 gcatgttaac aatgcaacta ataaagccac gtataaacca aatacctggt gtatacgttg 6301 tctttggagc acaaaaccag ttgaaacatc aaattcgttt gatgtactga agtcagagga 6361 cgcgcaggga atggataatc ttgcctgcga agatctaaaa ccagtctctg aagaagtagt 6421 ggaaaatcct accatacaga aagacgttct tgagtgtaat gtgaaaacta ccgaagttgt 6481 aggagacatt atacttaaac cagcaaataa tagtttaaaa attacagaag aggttggcca 6541 cacagatcta atggctgctt atgtagacaa ttctagtctt actattaaga aacctaatga 6601 attatctaga gtattaggtt tgaaaaccct tgctactcat ggtttagctg ctgttaatag 6661 tgtcccttgg gatactatag ctaattatgc taagcctttt cttaacaaag ttgttagtac 6721 aactactaac atagttacac ggtgtttaaa ccgtgtttgt actaattata tgccttattt 6781 ctttacttta ttgctacaat tgtgtacttt tactagaagt acaaattcta gaattaaagc 6841 atctatgccg actactatag caaagaatac tgttaagagt gtcggtaaat tttgtctaga 6901 ggcttcattt aattatttga agtcacctaa tttttctaaa ctgataaata ttataatttg 6961 gtttttacta ttaagtgttt gcctaggttc tttaatctac tcaaccgctg ctttaggtgt 7021 tttaatgtct aatttaggca tgccttctta ctgtactggt tacagagaag gctatttgaa 7081 ctctactaat gtcactattg caacctactg tactggttct ataccttgta gtgtttgtct 7141 tagtggttta gattctttag acacctatcc ttctttagaa actatacaaa ttaccatttc 7201 atcttttaaa tgggatttaa ctgcttttgg cttagttgca gagtggtttt tggcatatat 7261 tcttttcact aggtttttct atgtacttgg attggctgca atcatgcaat tgtttttcag 7321 ctattttgca gtacatttta ttagtaattc ttggcttatg tggttaataa ttaatcttgt 7381 acaaatggcc ccgatttcag ctatggttag aatgtacatc ttctttgcat cattttatta 7441 tgtatggaaa agttatgtgc atgttgtaga cggttgtaat tcatcaactt gtatgatgtg 7501 ttacaaacgt aatagagcaa caagagtcga atgtacaact attgttaatg gtgttagaag 7561 gtccttttat gtctatgcta atggaggtaa aggcttttgc aaactacaca attggaattg 7621 tgttaattgt gatacattct gtgctggtag tacatttatt agtgatgaag ttgcgagaga 7681 cttgtcacta cagtttaaaa gaccaataaa tcctactgac cagtcttctt acatcgttga 7741 tagtgttaca gtgaagaatg gttccatcca tctttacttt gataaagctg gtcaaaagac 7801 ttatgaaaga cattctctct ctcattttgt taacttagac aacctgagag ctaataacac 7861 taaaggttca ttgcctatta atgttatagt ttttgatggt aaatcaaaat gtgaagaatc 7921 atctgcaaaa tcagcgtctg tttactacag tcagcttatg tgtcaaccta tactgttact 7981 agatcaggca ttagtgtctg atgttggtga tagtgcggaa gttgcagtta aaatgtttga 8041 tgcttacgtt aatacgtttt catcaacttt taacgtacca atggaaaaac tcaaaacact 8101 agttgcaact gcagaagctg aacttgcaaa gaatgtgtcc ttagacaatg tcttatctac 8161 ttttatttca gcagctcggc aagggtttgt tgattcagat gtagaaacta aagatgttgt 8221 tgaatgtctt aaattgtcac atcaatctga catagaagtt actggcgata gttgtaataa 8281 ctatatgctc acctataaca aagttgaaaa catgacaccc cgtgaccttg gtgcttgtat 8341 tgactgtagt gcgcgtcata ttaatgcgca ggtagcaaaa agtcacaaca ttgctttgat 8401 atggaacgtt aaagatttca tgtcattgtc tgaacaacta cgaaaacaaa tacgtagtgc 8461 tgctaaaaag aataacttac cttttaagtt gacatgtgca actactagac aagttgttaa 8521 tgttgtaaca acaaagatag cacttaaggg tggtaaaatt gttaataatt ggttgaagca 8581 gttaattaaa gttacacttg tgttcctttt tgttgctgct attttctatt taataacacc 8641 tgttcatgtc atgtctaaac atactgactt ttcaagtgaa atcataggat acaaggctat 8701 tgatggtggt gtcactcgtg acatagcatc tacagatact tgttttgcta acaaacatgc 8761 tgattttgac acatggttta gccagcgtgg tggtagttat actaatgaca aagcttgccc 8821 attgattgct gcagtcataa caagagaagt gggttttgtc gtgcctggtt tgcctggcac 8881 gatattacgc acaactaatg gtgacttttt gcatttctta cctagagttt ttagtgcagt 8941 tggtaacatc tgttacacac catcaaaact tatagagtac actgactttg caacatcagc 9001 ttgtgttttg gctgctgaat gtacaatttt taaagatgct tctggtaagc cagtaccata 9061 ttgttatgat accaatgtac tagaaggttc tgttgcttat gaaagtttac gccctgacac 9121 acgttatgtg ctcatggatg gctctattat tcaatttcct aacacctacc ttgaaggttc 9181 tgttagagtg gtaacaactt ttgattctga gtactgtagg cacggcactt gtgaaagatc 9241 agaagctggt gtttgtgtat ctactagtgg tagatgggta cttaacaatg attattacag 9301 atctttacca ggagttttct gtggtgtaga tgctgtaaat ttacttacta atatgtttac 9361 accactaatt caacctattg gtgctttgga catatcagca tctatagtag ctggtggtat 9421 tgtagctatc gtagtaacat gccttgccta ctattttatg aggtttagaa gagcttttgg 9481 tgaatacagt catgtagttg cctttaatac tttactattc cttatgtcat tcactgtact 9541 ctgtttaaca ccagtttact cattcttacc tggtgtttat tctgttattt acttgtactt 9601 gacattttat cttactaatg atgtttcttt tttagcacat attcagtgga tggttatgtt 9661 cacaccttta gtacctttct ggataacaat tgcttatatc atttgtattt ccacaaagca 9721 tttctattgg ttctttagta attacctaaa gagacgtgta gtctttaatg gtgtttcctt 9781 tagtactttt gaagaagctg cgctgtgcac ctttttgtta aataaagaaa tgtatctaaa 9841 gttgcgtagt gatgtgctat tacctcttac gcaatataat agatacttag ctctttataa 9901 taagtacaag tattttagtg gagcaatgga tacaactagc tacagagaag ctgcttgttg 9961 tcatctcgca aaggctctca atgacttcag taactcaggt tctgatgttc tttaccaacc 10021 accacaaacc tctatcacct cagctgtttt gcagagtggt tttagaaaaa tggcattccc 10081 atctggtaaa gttgagggtt gtatggtaca agtaacttgt ggtacaacta cacttaacgg 10141 tctttggctt gatgacgtag tttactgtcc aagacatgtg atctgcacct ctgaagacat 10201 gcttaaccct aattatgaag atttactcat tcgtaagtct aatcataatt tcttggtaca 10261 ggctggtaat gttcaactca gggttattgg acattctatg caaaattgtg tacttaagct 10321 taaggttgat acagccaatc ctaagacacc taagtataag tttgttcgca ttcaaccagg 10381 acagactttt tcagtgttag cttgttacaa tggttcacca tctggtgttt accaatgtgc 10441 tatgaggccc aatttcacta ttaagggttc attccttaat ggttcatgtg gtagtgttgg 10501 ttttaacata gattatgact gtgtctcttt ttgttacatg caccatatgg aattaccaac 10561 tggagttcat gctggcacag acttagaagg taacttttat ggaccttttg ttgacaggca 10621 aacagcacaa gcagctggta cggacacaac tattacagtt aatgttttag cttggttgta 10681 cgctgctgtt ataaatggag acaggtggtt tctcaatcga tttaccacaa ctcttaatga 10741 ctttaacctt gtggctatga agtacaatta tgaacctcta acacaagacc atgttgacat 10801 actaggacct ctttctgctc aaactggaat tgccgtttta gatatgtgtg cttcattaaa 10861 agaattactg caaaatggta tgaatggacg taccatattg ggtagtgctt tattagaaga 10921 tgaatttaca ccttttgatg ttgttagaca atgctcaggt gttactttcc aaagtgcagt 10981 gaaaagaaca atcaagggta cacaccactg gttgttactc acaattttga cttcactttt 11041 agttttagtc cagagtactc aatggtcttt gttctttttt ttgtatgaaa atgccttttt 11101 accttttgct atgggtatta ttgctatgtc tgcttttgca atgatgtttg tcaaacataa 11161 gcatgcattt ctctgtttgt ttttgttacc ttctcttgcc actgtagctt attttaatat 11221 ggtctatatg cctgctagtt gggtgatgcg tattatgaca tggttggata tggttgatac 11281 tagtttgtct ggttttaagc taaaagactg tgttatgtat gcatcagctg tagtgttact 11341 aatccttatg acagcaagaa ctgtgtatga tgatggtgct aggagagtgt ggacacttat 11401 gaatgtcttg acactcgttt ataaagttta ttatggtaat gctttagatc aagccatttc 11461 catgtgggct cttataatct ctgttacttc taactactca ggtgtagtta caactgtcat 11521 gtttttggcc agaggtattg tttttatgtg tgttgagtat tgccctattt tcttcataac 11581 tggtaataca cttcagtgta taatgctagt ttattgtttc ttaggctatt tttgtacttg 11641 ttactttggc ctcttttgtt tactcaaccg ctactttaga ctgactcttg gtgtttatga 11701 ttacttagtt tctacacagg agtttagata tatgaattca cagggactac tcccacccaa 11761 gaatagcata gatgccttca aactcaacat taaattgttg ggtgttggtg gcaaaccttg 11821 tatcaaagta gccactgtac agtctaaaat gtcagatgta aagtgcacat cagtagtctt 11881 actctcagtt ttgcaacaac tcagagtaga atcatcatct aaattgtggg ctcaatgtgt 11941 ccagttacac aatgacattc tcttagctaa agatactact gaagcctttg aaaaaatggt 12001 ttcactactt tctgttttgc tttccatgca gggtgctgta gacataaaca agctttgtga 12061 agaaatgctg gacaacaggg caaccttaca agctatagcc tcagagttta gttcccttcc 12121 atcatatgca gcttttgcta ctgctcaaga agcttatgag caggctgttg ctaatggtga 12181 ttctgaagtt gttcttaaaa agttgaagaa gtctttgaat gtggctaaat ctgaatttga 12241 ccgtgatgca gccatgcaac gtaagttgga aaagatggct gatcaagcta tgacccaaat 12301 gtataaacag gctagatctg aggacaagag ggcaaaagtt actagtgcta tgcagacaat 12361 gcttttcact atgcttagaa agttggataa tgatgcactc aacaacatta tcaacaatgc 12421 aagagatggt tgtgttccct tgaacataat acctcttaca acagcagcca aactaatggt 12481 tgtcatacca gactataaca catataaaaa tacgtgtgat ggtacaacat ttacttatgc 12541 atcagcattg tgggaaatcc aacaggttgt agatgcagat agtaaaattg ttcaacttag 12601 tgaaattagt atggacaatt cacctaattt agcatggcct cttattgtaa cagctttaag 12661 ggccaattct gctgtcaaat tacagaataa tgagcttagt cctgttgcac tacgacagat 12721 gtcttgtgct gccggtacta cacaaactgc ttgcactgat gacaatgcgt tagcttacta 12781 caacacaaca aagggaggta ggtttgtact tgcactgtta tccgatttac aggatttgaa 12841 atgggctaga ttccctaaga gtgatggaac tggtactatc tatacagaac tggaaccacc 12901 ttgtaggttt gttacagaca cacctaaagg tcctaaagtg aagtatttat actttattaa 12961 aggattaaac aacctaaata gaggtatggt acttggtagt ttagctgcca cagtacgtct 13021 acaagctggt aatgcaacag aagtgcctgc caattcaact gtattatctt tctgtgcttt 13081 tgctgtagat gctgctaaag cttacaaaga ttatctagct agtgggggac aaccaatcac 13141 taattgtgtt aagatgttgt gtacacacac tggtactggt caggcaataa cagttacacc 13201 ggaagccaat atggatcaag aatcctttgg tggtgcatcg tgttgtctgt actgccgttg 13261 ccacatagat catccaaatc ctaaaggatt ttgtgactta aaaggtaagt atgtacaaat 13321 acctacaact tgtgctaatg accctgtggg ttttacactt aaaaacacag tctgtaccgt 13381 ctgcggtatg tggaaaggtt atggctgtag ttgtgatcaa ctccgcgaac ccatgcttca 13441 gtcagctgat gcacaatcgt ttttaaacgg gtttgcggtg taagtgcagc ccgtcttaca 13501 ccgtgcggca caggcactag tactgatgtc gtatacaggg cttttgacat ctacaatgat 13561 aaagtagctg gttttgctaa attcctaaaa actaattgtt gtcgcttcca agaaaaggac 13621 gaagatgaca atttaattga ttcttacttt gtagttaaga gacacacttt ctctaactac 13681 caacatgaag aaacaattta taatttactt aaggattgtc cagctgttgc taaacatgac 13741 ttctttaagt ttagaataga cggtgacatg gtaccacata tatcacgtca acgtcttact 13801 aaatacacaa tggcagacct cgtctatgct ttaaggcatt ttgatgaagg taattgtgac 13861 acattaaaag aaatacttgt cacatacaat tgttgtgatg atgattattt caataaaaag 13921 gactggtatg attttgtaga aaacccagat atattacgcg tatacgccaa cttaggtgaa 13981 cgtgtacgcc aagctttgtt aaaaacagta caattctgtg atgccatgcg aaatgctggt 14041 attgttggtg tactgacatt agataatcaa gatctcaatg gtaactggta tgatttcggt 14101 gatttcatac aaaccacgcc aggtagtgga gttcctgttg tagattctta ttattcattg 14161 ttaatgccta tattaacctt gaccagggct ttaactgcag agtcacatgt tgacactgac 14221 ttaacaaagc cttacattaa gtgggatttg ttaaaatatg acttcacgga agagaggtta 14281 aaactctttg accgttattt taaatattgg gatcagacat accacccaaa ttgtgttaac 14341 tgtttggatg acagatgcat tctgcattgt gcaaacttta atgttttatt ctctacagtg 14401 ttcccaccta caagttttgg accactagtg agaaaaatat ttgttgatgg tgttccattt 14461 gtagtttcaa ctggatacca cttcagagag ctaggtgttg tacataatca ggatgtaaac 14521 ttacatagct ctagacttag ttttaaggaa ttacttgtgt atgctgctga ccctgctatg 14581 cacgctgctt ctggtaatct attactagat aaacgcacta cgtgcttttc agtagctgca 14641 cttactaaca atgttgcttt tcaaactgtc aaacccggta attttaacaa agacttctat 14701 gactttgctg tgtctaaggg tttctttaag gaaggaagtt ctgttgaatt aaaacacttc 14761 ttctttgctc aggatggtaa tgctgctatc agcgattatg actactatcg ttataatcta 14821 ccaacaatgt gtgatatcag acaactacta tttgtagttg aagttgttga taagtacttt 14881 gattgttacg atggtggctg tattaatgct aaccaagtca tcgtcaacaa cctagacaaa 14941 tcagctggtt ttccatttaa taaatggggt aaggctagac tttattatga ttcaatgagt 15001 tatgaggatc aagatgcact tttcgcatat acaaaacgta atgtcatccc tactataact 15061 caaatgaatc ttaagtatgc cattagtgca aagaatagag ctcgcaccgt agctggtgtc 15121 tctatctgta gtactatgac caatagacag tttcatcaaa aattattgaa atcaatagcc 15181 gccactagag gagctactgt agtaattgga acaagcaaat tctatggtgg ttggcacaac 15241 atgttaaaaa ctgtttatag tgatgtagaa aaccctcacc ttatgggttg ggattatcct 15301 aaatgtgata gagccatgcc taacatgctt agaattatgg cctcacttgt tcttgctcgc 15361 aaacatacaa cgtgttgtag cttgtcacac cgtttctata gattagctaa tgagtgtgct 15421 caagtattga gtgaaatggt catgtgtggc ggttcactat atgttaaacc aggtggaacc 15481 tcatcaggag atgccacaac tgcttatgct aatagtgttt ttaacatttg tcaagctgtc 15541 acggccaatg ttaatgcact tttatctact gatggtaaca aaattgccga taagtatgtc 15601 cgcaatttac aacacagact ttatgagtgt ctctatagaa atagagatgt tgacacagac 15661 tttgtgaatg agttttacgc atatttgcgt aaacatttct caatgatgat actctctgac 15721 gatgctgttg tgtgtttcaa tagcacttat gcatctcaag gtctagtggc tagcataaag 15781 aactttaagt cagttcttta ttatcaaaac aatgttttta tgtctgaagc aaaatgttgg 15841 actgagactg accttactaa aggacctcat gaattttgct ctcaacatac aatgctagtt 15901 aaacagggtg atgattatgt gtaccttcct tacccagatc catcaagaat cctaggggcc 15961 ggctgttttg tagatgatat cgtaaaaaca gatggtacac ttatgattga acggttcgtg 16021 tctttagcta tagatgctta cccacttact aaacatccta atcaggagta tgctgatgtc 16081 tttcatttgt acttacaata cataagaaag ctacatgatg agttaacagg acacatgtta 16141 gacatgtatt ctgttatgct tactaatgat aacacttcaa ggtattggga acctgagttt 16201 tatgaggcta tgtacacacc gcatacagtc ttacaggctg ttggggcttg tgttctttgc 16261 aattcacaga cttcattaag atgtggtgct tgcatacgta gaccattctt atgttgtaaa 16321 tgctgttacg accatgtcat atcaacatca cataaattag tcttgtctgt taatccgtat 16381 gtttgcaatg ctccaggttg tgatgtcaca gatgtgactc aactttactt aggaggtatg 16441 agctattatt gtaaatcaca taaaccaccc attagttttc cattgtgtgc taatggacaa 16501 gtttttggtt tatataaaaa tacatgtgtt ggtagcgata atgttactga ctttaatgca 16561 attgcaacat gtgactggac aaatgctggt gattacattt tagctaacac ctgtactgaa 16621 agactcaagc tttttgcagc agaaacgctc aaagctactg aggagacatt taaactgtct 16681 tatggtattg ctactgtacg tgaagtgctg tctgacagag aattacatct ttcatgggaa 16741 gttggtaaac ctagaccacc acttaaccga aattatgtct ttactggtta tcgtgtaact 16801 aaaaacagta aagtacaaat aggagagtac acctttgaaa aaggtgacta tggtgatgct 16861 gttgtttacc gaggtacaac aacttacaaa ttaaatgttg gtgattattt tgtgctgaca 16921 tcacatacag taatgccatt aagtgcacct acactagtgc cacaagagca ctatgttaga 16981 attactggct tatacccaac actcaatatc tcagatgagt tttctagcaa tgttgcaaat 17041 tatcaaaagg ttggtatgca aaagtattct acactccagg gaccacctgg tactggtaag 17101 agtcattttg ctattggcct agctctctac tacccttctg ctcgcatagt gtatacagct 17161 tgctctcatg ccgctgttga tgcactatgt gagaaggcat taaaatattt gcctatagat 17221 aaatgtagta gaattatacc tgcacgtgct cgtgtagagt gttttgataa attcaaagtg 17281 aattcaacat tagaacagta tgtcttttgt actgtaaatg cattgcctga gacgacagca 17341 gatatagttg tctttgatga aatttcaatg gccacaaatt atgatttgag tgttgtcaat 17401 gccagattac gtgctaagca ctatgtgtac attggcgacc ctgctcaatt acctgcacca 17461 cgcacattgc taactaaggg cacactagaa ccagaatatt tcaattcagt gtgtagactt 17521 atgaaaacta taggtccaga catgttcctc ggaacttgtc ggcgttgtcc tgctgaaatt 17581 gttgacactg tgagtgcttt ggtttatgat aataagctta aagcacataa agacaaatca 17641 gctcaatgct ttaaaatgtt ttataagggt gttatcacgc atgatgtttc atctgcaatt 17701 aacaggccac aaataggcgt ggtaagagaa ttccttacac gtaaccctgc ttggagaaaa 17761 gctgtcttta tttcacctta taattcacag aatgctgtag cctcaaagat tttgggacta 17821 ccaactcaaa ctgttgattc atcacagggc tcagaatatg actatgtcat attcactcaa 17881 accactgaaa cagctcactc ttgtaatgta aacagattta atgttgctat taccagagca 17941 aaagtaggca tactttgcat aatgtctgat agagaccttt atgacaagtt gcaatttaca 18001 agtcttgaaa ttccacgtag gaatgtggca actttacaag ctgaaaatgt aacaggactc 18061 tttaaagatt gtagtaaggt aatcactggg ttacatccta cacaggcacc tacacacctc 18121 agtgttgaca ctaaattcaa aactgaaggt ttatgtgttg acatacctgg catacctaag 18181 gacatgacct atagaagact catctctatg atgggtttta aaatgaatta tcaagttaat 18241 ggttacccta acatgtttat cacccgcgaa gaagctataa gacatgtacg tgcatggatt 18301 ggcttcgatg tcgaggggtg tcatgctact agagaagctg ttggtaccaa tttaccttta 18361 cagctaggtt tttctacagg tgttaaccta gttgctgtac ctacaggtta tgttgataca 18421 cctaataata cagatttttc cagagttagt gctaaaccac cgcctggaga tcaatttaaa 18481 cacctcatac cacttatgta caaaggactt ccttggaatg tagtgcgtat aaagattgta 18541 caaatgttaa gtgacacact taaaaatctc tctgacagag tcgtatttgt cttatgggca 18601 catggctttg agttgacatc tatgaagtat tttgtgaaaa taggacctga gcgcacctgt 18661 tgtctatgtg atagacgtgc cacatgcttt tccactgctt cagacactta tgcctgttgg 18721 catcattcta ttggatttga ttacgtctat aatccgttta tgattgatgt tcaacaatgg 18781 ggttttacag gtaacctaca aagcaaccat gatctgtatt gtcaagtcca tggtaatgca 18841 catgtagcta gttgtgatgc aatcatgact aggtgtctag ctgtccacga gtgctttgtt 18901 aagcgtgttg actggactat tgaatatcct ataattggtg atgaactgaa gattaatgcg 18961 gcttgtagaa aggttcaaca catggttgtt aaagctgcat tattagcaga caaattccca 19021 gttcttcacg acattggtaa ccctaaagct attaagtgtg tacctcaagc tgatgtagaa 19081 tggaagttct atgatgcaca gccttgtagt gacaaagctt ataaaataga agaattattc 19141 tattcttatg ccacacattc tgacaaattc acagatggtg tatgcctatt ttggaattgc 19201 aatgtcgata gatatcctgc taattccatt gtttgtagat ttgacactag agtgctatct 19261 aaccttaact tgcctggttg tgatggtggc agtttgtatg taaataaaca tgcattccac 19321 acaccagctt ttgataaaag tgcttttgtt aatttaaaac aattaccatt tttctattac 19381 tctgacagtc catgtgagtc tcatggaaaa caagtagtgt cagatataga ttatgtacca 19441 ctaaagtctg ctacgtgtat aacacgttgc aatttaggtg gtgctgtctg tagacatcat 19501 gctaatgagt acagattgta tctcgatgct tataacatga tgatctcagc tggctttagc 19561 ttgtgggttt acaaacaatt tgatacttat aacctctgga acacttttac aagacttcag 19621 agtttagaaa atgtggcttt taatgttgta aataagggac actttgatgg acaacagggt 19681 gaagtaccag tttctatcat taataacact gtttacacaa aagttgatgg tgttgatgta 19741 gaattgtttg aaaataaaac aacattacct gttaatgtag catttgagct ttgggctaag 19801 cgcaacatta aaccagtacc agaggtgaaa atactcaata atttgggtgt ggacattgct 19861 gctaatactg tgatctggga ctacaaaaga gatgctccag cacatatatc tactattggt 19921 gtttgttcta tgactgacat agccaagaaa ccaactgaaa cgatttgtgc accactcact 19981 gtcttttttg atggtagagt tgatggtcaa gtagacttat ttagaaatgc ccgtaatggt 20041 gttcttatta cagaaggtag tgttaaaggt ttacaaccat ctgtaggtcc caaacaagct 20101 agtcttaatg gagtcacatt aattggagaa gccgtaaaaa cacagttcaa ttattataag 20161 aaagttgatg gtgttgtcca acaattacct gaaacttact ttactcagag tagaaattta 20221 caagaattta aacccaggag tcaaatggaa attgatttct tagaattagc tatggatgaa 20281 ttcattgaac ggtataaatt agaaggctat gccttcgaac atatcgttta tggagatttt 20341 agtcatagtc agttaggtgg tttacatcta ctgattggac tagctaaacg ttttaaggaa 20401 tcaccttttg aattagaaga ttttattcct atggacagta cagttaaaaa ctatttcata 20461 acagatgcgc aaacaggttc atctaagtgt gtgtgttctg ttattgattt attacttgat 20521 gattttgttg aaataataaa atcccaagat ttatctgtag tttctaaggt tgtcaaagtg 20581 actattgact atacagaaat ttcatttatg ctttggtgta aagatggcca tgtagaaaca 20641 ttttacccaa aattacaatc tagtcaagcg tggcaaccgg gtgttgctat gcctaatctt 20701 tacaaaatgc aaagaatgct attagaaaag tgtgaccttc aaaattatgg tgatagtgca 20761 acattaccta aaggcataat gatgaatgtc gcaaaatata ctcaactgtg tcaatattta 20821 aacacattaa cattagctgt accctataat atgagagtta tacattttgg tgctggttct 20881 gataaaggag ttgcaccagg tacagctgtt ttaagacagt ggttgcctac gggtacgctg 20941 cttgtcgatt cagatcttaa tgactttgtc tctgatgcag attcaacttt gattggtgat 21001 tgtgcaactg tacatacagc taataaatgg gatctcatta ttagtgatat gtacgaccct 21061 aagactaaaa atgttacaaa agaaaatgac tctaaagagg gttttttcac ttacatttgt 21121 gggtttatac aacaaaagct agctcttgga ggttccgtgg ctataaagat aacagaacat 21181 tcttggaatg ctgatcttta taagctcatg ggacacttcg catggtggac agcctttgtt 21241 actaatgtga atgcgtcatc atctgaagca tttttaattg gatgtaatta tcttggcaaa 21301 ccacgcgaac aaatagatgg ttatgtcatg catgcaaatt acatattttg gaggaataca 21361 aatccaattc agttgtcttc ctattcttta tttgacatga gtaaatttcc ccttaaatta 21421 aggggtactg ctgttatgtc tttaaaagaa ggtcaaatca atgatatgat tttatctctt 21481 cttagtaaag gtagacttat aattagagaa aacaacagag ttgttatttc tagtgatgtt 21541 cttgttaaca actaaacgaa caatgtttgt ttttcttgtt ttattgccac tagtctctag 21601 tcagtgtgtt aatcttacaa ccagaactca attaccccct gcatacacta attctttcac 21661 acgtggtgtt tattaccctg acaaagtttt cagatcctca gttttacatt caactcagga 21721 cttgttctta cctttctttt ccaatgttac ttggttccat gctatacatg tctctgggac 21781 caatggtact aagaggtttg ataaccctgt cctaccattt aatgatggtg tttattttgc 21841 ttccactgag aagtctaaca taataagagg ctggattttt ggtactactt tagattcgaa 21901 gacccagtcc ctacttattg ttaataacgc tactaatgtt gttattaaag tctgtgaatt 21961 tcaattttgt aatgatccat ttttgggtgt ttattaccac aaaaacaaca aaagttggat 22021 ggaaagtgag ttcagagttt attctagtgc gaataattgc acttttgaat atgtctctca 22081 gccttttctt atggaccttg aaggaaaaca gggtaatttc aaaaatctta gggaatttgt 22141 gtttaagaat attgatggtt attttaaaat atattctaag cacacgccta ttaatttagt 22201 gcgtgatctc cctcagggtt tttcggcttt agaaccattg gtagatttgc caataggtat 22261 taacatcact aggtttcaaa ctttacttgc tttacataga agttatttga ctcctggtga 22321 ttcttcttca ggttggacag ctggtgctgc agcttattat gtgggttatc ttcaacctag 22381 gacttttcta ttaaaatata atgaaaatgg aaccattaca gatgctgtag actgtgcact 22441 tgaccctctc tcagaaacaa agtgtacgtt gaaatccttc actgtagaaa aaggaatcta 22501 tcaaacttct aactttagag tccaaccaac agaatctatt gttagatttc ctaatattac 22561 aaacttgtgc ccttttggtg aagtttttaa cgccaccaga tttgcatctg tttatgcttg 22621 gaacaggaag agaatcagca actgtgttgc tgattattct gtcctatata attccgcatc 22681 attttccact tttaagtgtt atggagtgtc tcctactaaa ttaaatgatc tctgctttac 22741 taatgtctat gcagattcat ttgtaattag aggtgatgaa gtcagacaaa tcgctccagg 22801 gcaaactgga aagattgctg attataatta taaattacca gatgatttta caggctgcgt 22861 tatagcttgg aattctaaca atcttgattc taaggttggt ggtaattata attacctgta 22921 tagattgttt aggaagtcta atctcaaacc ttttgagaga gatatttcaa ctgaaatcta 22981 tcaggccggt agcacacctt gtaatggtgt tgaaggtttt aattgttact ttcctttaca 23041 atcatatggt ttccaaccca ctaatggtgt tggttaccaa ccatacagag tagtagtact 23101 ttcttttgaa cttctacatg caccagcaac tgtttgtgga cctaaaaagt ctactaattt 23161 ggttaaaaac aaatgtgtca atttcaactt caatggttta acaggcacag gtgttcttac 23221 tgagtctaac aaaaagtttc tgcctttcca acaatttggc agagacattg ctgacactac 23281 tgatgctgtc cgtgatccac agacacttga gattcttgac attacaccat gttcttttgg 23341 tggtgtcagt gttataacac caggaacaaa tacttctaac caggttgctg ttctttatca 23401 ggatgttaac tgcacagaag tccctgttgc tattcatgca gatcaactta ctcctacttg 23461 gcgtgtttat tctacaggtt ctaatgtttt tcaaacacgt gcaggctgtt taataggggc 23521 tgaacatgtc aacaactcat atgagtgtga catacccatt ggtgcaggta tatgcgctag 23581 ttatcagact cagactaatt ctcctcggcg ggcacgtagt gtagctagtc aatccatcat 23641 tgcctacact atgtcacttg gtgcagaaaa ttcagttgct tactctaata actctattgc 23701 catacccaca aattttacta ttagtgttac cacagaaatt ctaccagtgt ctatgaccaa 23761 gacatcagta gattgtacaa tgtacatttg tggtgattca actgaatgca gcaatctttt 23821 gttgcaatat ggcagttttt gtacacaatt aaaccgtgct ttaactggaa tagctgttga 23881 acaagacaaa aacacccaag aagtttttgc acaagtcaaa caaatttaca aaacaccacc 23941 aattaaagat tttggtggtt ttaatttttc acaaatatta ccagatccat caaaaccaag 24001 caagaggtca tttattgaag atctactttt caacaaagtg acacttgcag atgctggctt 24061 catcaaacaa tatggtgatt gccttggtga tattgctgct agagacctca tttgtgcaca 24121 aaagtttaac ggccttactg ttttgccacc tttgctcaca gatgaaatga ttgctcaata 24181 cacttctgca ctgttagcgg gtacaatcac ttctggttgg acctttggtg caggtgctgc 24241 attacaaata ccatttgcta tgcaaatggc ttataggttt aatggtattg gagttacaca 24301 gaatgttctc tatgagaacc aaaaattgat tgccaaccaa tttaatagtg ctattggcaa 24361 aattcaagac tcactttctt ccacagcaag tgcacttgga aaacttcaag atgtggtcaa 24421 ccaaaatgca caagctttaa acacgcttgt taaacaactt agctccaatt ttggtgcaat 24481 ttcaagtgtt ttaaatgata tcctttcacg tcttgacaaa gttgaggctg aagtgcaaat 24541 tgataggttg atcacaggca gacttcaaag tttgcagaca tatgtgactc aacaattaat 24601 tagagctgca gaaatcagag cttctgctaa tcttgctgct actaaaatgt cagagtgtgt 24661 acttggacaa tcaaaaagag ttgatttttg tggaaagggc tatcatctta tgtccttccc 24721 tcagtcagca cctcatggtg tagtcttctt gcatgtgact tatgtccctg cacaagaaaa 24781 gaacttcaca actgctcctg ccatttgtca tgatggaaaa gcacactttc ctcgtgaagg 24841 tgtctttgtt tcaaatggca cacactggtt tgtaacacaa aggaattttt atgaaccaca 24901 aatcattact acagacaaca catttgtgtc tggtaactgt gatgttgtaa taggaattgt 24961 caacaacaca gtttatgatc ctttgcaacc tgaattagac tcattcaagg aggagttaga 25021 taaatatttt aagaatcata catcaccaga tgttgattta ggtgacatct ctggcattaa 25081 tgcttcagtt gtaaacattc aaaaagaaat tgaccgcctc aatgaggttg ccaagaattt 25141 aaatgaatct ctcatcgatc tccaagaact tggaaagtat gagcagtata taaaatggcc 25201 atggtacatt tggctaggtt ttatagctgg cttgattgcc atagtaatgg tgacaattat 25261 gctttgctgt atgaccagtt gctgtagttg tctcaagggc tgttgttctt gtggatcctg 25321 ctgcaaattt gatgaagacg actctgagcc agtgctcaaa ggagtcaaat tacattacac 25381 ataaacgaac ttatggattt gtttatgaga atcttcacaa ttggaactgt aactttgaag 25441 caaggtgaaa tcaaggatgc tactccttca gattttgttc gcgctactgc aacgataccg 25501 atacaagcct cactcccttt cggatggctt attgttggcg ttgcacttct tgctgttttt 25561 cagagcgctt ccaaaatcat aaccctcaaa aagagatggc aactagcact ctccaagggt 25621 gttcactttg tttgcaactt gctgttgttg tttgtaacag tttactcaca ccttttgctc 25681 gttgctgctg gccttgaagc cccttttctc tatctttatg ctttagtcta cttcttgcag 25741 agtataaact ttgtaagaat aataatgagg ctttggcttt gctggaaatg ccgttccaaa 25801 aacccattac tttatgatgc caactatttt ctttgctggc atactaattg ttacgactat 25861 tgtatacctt acaatagtgt aacttcttca attgtcatta cttcaggtga tggcacaaca 25921 agtcctattt ctgaacatga ctaccagatt ggtggttata ctgaaaaatg ggaatctgga 25981 gtaaaagact gtgttgtatt acacagttac ttcacttcag actattacca gctgtactca 26041 actcaattga gtacagacac tggtgttgaa catgttacct tcttcatcta caataaaatt 26101 gttgatgagc ctgaagaaca tgtccaaatt cacacaatcg acggttcatc cggagttgtt 26161 aatccagtaa tggaaccaat ttatgatgaa ccgacgacga ctactagcgt gcctttgtaa 26221 gcacaagctg atgagtacga acttatgtac tcattcgttt cggaagagac aggtacgtta 26281 atagttaata gcgtacttct ttttcttgct ttcgtggtat tcttgctagt tacactagcc 26341 atccttactg cgcttcgatt gtgtgcgtac tgctgcaata ttgttaacgt gagtcttgta 26401 aaaccttctt tttacgttta ctctcgtgtt aaaaatctga attcttctag agttcctgat 26461 cttctggtct aaacgaacta aatattatat tagtttttct gtttggaact ttaattttag 26521 ccatggcaga ttccaacggt actattaccg ttgaagagct taaaaagctc cttgaacaat 26581 ggaacctagt aataggtttc ctattcctta catggatttg tcttctacaa tttgcctatg 26641 ccaacaggaa taggtttttg tatataatta agttaatttt cctctggctg ttatggccag 26701 taactttagc ttgttttgtg cttgctgctg tttacagaat aaattggatc accggtggaa 26761 ttgctatcgc aatggcttgt cttgtaggct tgatgtggct cagctacttc attgcttctt 26821 tcagactgtt tgcgcgtacg cgttccatgt ggtcattcaa tccagaaact aacattcttc 26881 tcaacgtgcc actccatggc actattctga ccagaccgct tctagaaagt gaactcgtaa 26941 tcggagctgt gatccttcgt ggacatcttc gtattgctgg acaccatcta ggacgctgtg 27001 acatcaagga cctgcctaaa gaaatcactg ttgctacatc acgaacgctt tcttattaca 27061 aattgggagc ttcgcagcgt gtagcaggtg actcaggttt tgctgcatac agtcgctaca 27121 ggattggcaa ctataaatta aacacagacc attccagtag cagtgacaat attgctttgc 27181 ttgtacagta agtgacaaca gatgtttcat ctcgttgact ttcaggttac tatagcagag 27241 atattactaa ttattatgag gacttttaaa gtttccattt ggaatcttga ttacatcata 27301 aacctcataa ttaaaaattt atctaagtca ctaactgaga ataaatattc tcaattagat 27361 gaagagcaac caatggagat tgattaaacg aacatgaaaa ttattctttt cttggcactg 27421 ataacactcg ctacttgtga gctttatcac taccaagagt gtgttagagg tacaacagta 27481 cttttaaaag aaccttgctc ttctggaaca tacgagggca attcaccatt tcatcctcta 27541 gctgataaca aatttgcact gacttgcttt agcactcaat ttgcttttgc ttgtcctgac 27601 ggcgtaaaac acgtctatca gttacgtgcc agatcagttt cacctaaact gttcatcaga 27661 caagaggaag ttcaagaact ttactctcca atttttctta ttgttgcggc aatagtgttt 27721 ataacacttt gcttcacact caaaagaaag acagaatgat tgaactttca ttaattgact 27781 tctatttgtg ctttttagcc tttctgctat tccttgtttt aattatgctt attatctttt 27841 ggttctcact tgaactgcaa gatcataatg aaacttgtca cgcctaaacg aacatgaaat 27901 ttcttgtttt cttaggaatc atcacaactg tagctgcatt tcaccaagaa tgtagtttac 27961 agtcatgtac tcaacatcaa ccatatgtag ttgatgaccc gtgtcctatt cacttctatt 28021 ctaaatggta tattagagta ggagctagaa aatcagcacc tttaattgaa ttgtgcgtgg 28081 atgaggctgg ttctaaatca cccattcagt acatcgatat cggtaattat acagtttcct 28141 gtttaccttt tacaattaat tgccaggaac ctaaattggg tagtcttgta gtgcgttgtt 28201 cgttctatga agacttttta gagtatcatg acgttcgtgt tgttttagat ttcatctaaa 28261 cgaacaaact aaaatgtctg ataatggacc ccaaaatcag cgaaatgcac cccgcattac 28321 gtttggtgga ccctcagatt caactggcag taaccagaat ggagaacgca gtggggcgcg 28381 atcaaaacaa cgtcggcccc aaggtttacc caataatact gcgtcttggt tcaccgctct 28441 cactcaacat ggcaaggaag accttaaatt ccctcgagga caaggcgttc caattaacac 28501 caatagcagt ccagatgacc aaattggcta ctaccgaaga gctaccagac gaattcgtgg 28561 tggtgacggt aaaatgaaag atctcagtcc aagatggtat ttctactacc taggaactgg 28621 gccagaagct ggacttccct atggtgctaa caaagacggc atcatatggg ttgcaactga 28681 gggagccttg aatacaccaa aagatcacat tggcacccgc aatcctgcta acaatgctgc 28741 aatcgtgcta caacttcctc aaggaacaac attgccaaaa ggcttctacg cagaagggag 28801 cagaggcggc agtcaagcct cttctcgttc ctcatcacgt agtcgcaaca gttcaagaaa 28861 ttcaactcca ggcagcagta ggggaacttc tcctgctaga atggctggca atggcggtga 28921 tgctgctctt gctttgctgc tgcttgacag attgaaccag cttgagagca aaatgtctgg 28981 taaaggccaa caacaacaag gccaaactgt cactaagaaa tctgctgctg aggcttctaa 29041 gaagcctcgg caaaaacgta ctgccactaa agcatacaat gtaacacaag ctttcggcag 29101 acgtggtcca gaacaaaccc aaggaaattt tggggaccag gaactaatca gacaaggaac 29161 tgattacaaa cattggccgc aaattgcaca atttgccccc agcgcttcag cgttcttcgg 29221 aatgtcgcgc attggcatgg aagtcacacc ttcgggaacg tggttgacct acacaggtgc 29281 catcaaattg gatgacaaag atccaaattt caaagatcaa gtcattttgc tgaataagca 29341 tattgacgca tacaaaacat tcccaccaac agagcctaaa aaggacaaaa agaagaaggc 29401 tgatgaaact caagccttac cgcagagaca gaagaaacag caaactgtga ctcttcttcc 29461 tgctgcagat ttggatgatt tctccaaaca attgcaacaa tccatgagca gtgctgactc 29521 aactcaggcc taaactcatg cagaccacac aaggcagatg ggctatataa acgttttcgc 29581 ttttccgttt acgatatata gtctactctt gtgcagaatg aattctcgta actacatagc 29641 acaagtagat gtagttaact ttaatctcac atagcaatct ttaatcagtg tgtaacatta 29701 gggaggactt gaaagagcca ccacattttc accgaggcca cgcggagtac gatcgagtgt 29761 acagtgaaca atgctaggga gagctgccta tatggaagag ccctaatgtg taaaattaat 29821 tttagtagtg ctatccccat gtgattttaa tagcttctta ggagaatgac aaaaaaaaaa 29881 aaaaaaaaaa aaaaaaaaaa aaa

Wuhan Municipal Health and Health Committee's report on pneumonia of new coronavirus infection Issuing authority: Wuhan City health committee | Published: 2020-01-18 00:10:55 | Hits: 1389 | Font Size: Da Zhong Small At 04:00 on January 16, 2020 , 3 patients were discharged from the hospital and no new deaths were reported. After comprehensive research and judgment on the clinical manifestations, epidemiological history, and laboratory test results of the national, provincial and municipal expert groups, 4 new cases of pneumonitis infected with new coronavirus have been added in our city. At present, the new cases have been arranged for transfer to Wuhan All cases were treated at Jinyintan Hospital. All the patients were in stable condition without critical illness. The time of onset of the cases was concentrated from January 5th to 8th. Related epidemiological investigations and search of close contacts were underway. In addition, Thailand and Japan each reported a case of pneumonia with a new coronavirus infection from Wuhan. Currently, Thai diagnosed cases are being hospitalized; Japanese diagnosed cases have been discharged. Close contacts in the country are conducting follow-up and medical observations. As of now, 45 cases of pneumonitis with new-type coronavirus infection have been reported in our city, 15 cases have been cured and discharged, 5 cases are being treated in severe cases, and 2 cases have died. The remaining patients are in stable condition. All patients received isolation treatment at designated medical institutions in Wuhan. A total of 763 close contacts have been tracked, 665 medical observations have been lifted, and 98 people are still receiving medical observations. Among the close contacts, no related cases were found. January 17, 2020 http://wjw.wuhan.gov.cn/front/web/showDetail/2020011809064

Partial sequence of BetaCoV/Kanagawa/1/2020 is 369 BP and is identical to all published 2019-nCoV sequences.

Top 100 matches at Genbank Sequences producing significant alignments: Select for downloading or viewing reports Description Max Score Total Score Query Cover E value Per. Ident Accession Select seq MG772934.1 Bat SARS-like coronavirus isolate bat-SL-CoVZXC21, complete genome 545 545 99% 4e-151 92.92% MG772934.1 Select seq MG772933.1 Bat SARS-like coronavirus isolate bat-SL-CoVZC45, complete genome 540 540 100% 2e-149 92.41% MG772933.1 Select seq DQ648857.1 Bat coronavirus (BtCoV/279/2005), complete genome 398 398 95% 1e-106 84.99% DQ648857.1 Select seq KY417149.1 Bat SARS-like coronavirus isolate Rs4255, complete genome 394 394 95% 2e-105 84.70% KY417149.1 Select seq KJ473814.1 BtRs-BetaCoV/HuB2013, complete genome 394 394 95% 2e-105 84.70% KJ473814.1 Select seq KF367457.1 Bat SARS-like coronavirus WIV1, complete genome 394 394 95% 2e-105 84.70% KF367457.1 Select seq KC881006.1 Bat SARS-like coronavirus Rs3367, complete genome 394 394 95% 2e-105 84.70% KC881006.1 Select seq FJ588686.1 Bat SARS CoV Rs672/2006, complete genome 394 394 95% 2e-105 84.70% FJ588686.1 Select seq AY304488.1 SARS coronavirus SZ16, complete genome 394 394 95% 2e-105 84.70% AY304488.1 Select seq MK211378.1 Coronavirus BtRs-BetaCoV/YN2018D, complete genome 389 389 95% 7e-104 84.42% MK211378.1 Select seq MK211377.1 Coronavirus BtRs-BetaCoV/YN2018C, complete genome 389 389 95% 7e-104 84.42% MK211377.1 Select seq MK062184.1 SARS coronavirus Urbani isolate icSARS-C7-MA, complete genome 389 389 95% 7e-104 84.42% MK062184.1 Select seq MK062183.1 SARS coronavirus Urbani isolate icSARS-C7, complete genome 389 389 95% 7e-104 84.42% MK062183.1 Select seq MK062182.1 SARS coronavirus Urbani isolate icSARS-C3-MA, complete genome 389 389 95% 7e-104 84.42% MK062182.1 Select seq MK062181.1 SARS coronavirus Urbani isolate icSARS-C3, complete genome 389 389 95% 7e-104 84.42% MK062181.1 Select seq MK062180.1 SARS coronavirus Urbani isolate icSARS-MA, complete genome 389 389 95% 7e-104 84.42% MK062180.1 Select seq MK062179.1 SARS coronavirus Urbani isolate icSARS, complete genome 389 389 95% 7e-104 84.42% MK062179.1 Select seq KY417152.1 Bat SARS-like coronavirus isolate Rs9401, complete genome 389 389 95% 7e-104 84.42% KY417152.1 Select seq KY417145.1 Bat SARS-like coronavirus isolate Rf4092, complete genome 389 389 95% 7e-104 84.42% KY417145.1 Select seq KY417144.1 Bat SARS-like coronavirus isolate Rs4084, complete genome 389 389 95% 7e-104 84.42% KY417144.1 Select seq KY417142.1 Bat SARS-like coronavirus isolate As6526, complete genome 389 389 95% 7e-104 84.42% KY417142.1 Select seq KF514407.1 SARS coronavirus ExoN1 strain SARS/VeroE6_lab/USA/ExoN1_c5.7P20/2010, complete genome 389 389 95% 7e-104 84.42% KF514407.1 Select seq JX993987.1 Bat coronavirus Rp/Shaanxi2011, complete genome 389 389 95% 7e-104 84.42% JX993987.1 Select seq JX163928.1 SARS coronavirus isolate Tor2/FP1-10895, complete genome 389 389 95% 7e-104 84.42% JX163928.1 Select seq JX163927.1 SARS coronavirus isolate Tor2/FP1-10851, complete genome 389 389 95% 7e-104 84.42% JX163927.1 Select seq JX163926.1 SARS coronavirus isolate Tor2/FP1-10912, complete genome 389 389 95% 7e-104 84.42% JX163926.1 Select seq JX163925.1 SARS coronavirus isolate Tor2/FP1-10895, complete genome 389 389 95% 7e-104 84.42% JX163925.1 Select seq JX163924.1 SARS coronavirus isolate Tor2/FP1-10851, complete genome 389 389 95% 7e-104 84.42% JX163924.1 Select seq JX163923.1 SARS coronavirus isolate Tor2/FP1-10912, complete genome 389 389 95% 7e-104 84.42% JX163923.1 Select seq JX162087.1 SARS coronavirus ExoN1 isolate c5P10, complete genome 389 389 95% 7e-104 84.42% JX162087.1 Select seq JN854286.1 SARS coronavirus HKU-39849 isolate recSARS-CoV HKU-39849, complete genome 389 389 95% 7e-104 84.42% JN854286.1 Select seq JQ316196.1 SARS coronavirus HKU-39849 isolate UOB, complete genome 389 389 95% 7e-104 84.42% JQ316196.1 Select seq JF292922.1 SARS coronavirus ExoN1 isolate c5P1, complete genome 389 389 95% 7e-104 84.42% JF292922.1 Select seq JF292915.1 SARS coronavirus MA15 isolate d4ym5, complete genome 389 389 95% 7e-104 84.42% JF292915.1 Select seq JF292909.1 SARS coronavirus MA15 isolate d2ym4, complete genome 389 389 95% 7e-104 84.42% JF292909.1 Select seq JF292906.1 SARS coronavirus MA15 ExoN1 isolate d3om5, complete genome 389 389 95% 7e-104 84.42% JF292906.1 Select seq JF292905.1 SARS coronavirus MA15 ExoN1 isolate d3om4, complete genome 389 389 95% 7e-104 84.42% JF292905.1 Select seq JF292903.1 SARS coronavirus MA15 ExoN1 isolate d4ym5, complete genome 389 389 95% 7e-104 84.42% JF292903.1 Select seq HQ890541.1 SARS coronavirus MA15 isolate d2ym1, complete genome 389 389 95% 7e-104 84.42% HQ890541.1 Select seq HQ890538.1 SARS coronavirus MA15 ExoN1 isolate d2om5, complete genome 389 389 95% 7e-104 84.42% HQ890538.1 Select seq HQ890535.1 SARS coronavirus MA15 ExoN1 isolate d2om2, complete genome 389 389 95% 7e-104 84.42% HQ890535.1 Select seq HQ890532.1 SARS coronavirus MA15 ExoN1 isolate d4ym2, complete genome 389 389 95% 7e-104 84.42% HQ890532.1 Select seq HQ890531.1 SARS coronavirus MA15 ExoN1 isolate d4ym1, complete genome 389 389 95% 7e-104 84.42% HQ890531.1 Select seq HQ890529.1 SARS coronavirus MA15 ExoN1 isolate d2ym4, complete genome 389 389 95% 7e-104 84.42% HQ890529.1 Select seq HQ890526.1 SARS coronavirus MA15 ExoN1 isolate d2ym1, complete genome 389 389 95% 7e-104 84.42% HQ890526.1 Select seq GU553365.1 SARS coronavirus HKU-39849 isolate TCVSP-HARROD-00003, complete genome 389 389 95% 7e-104 84.42% GU553365.1 Select seq GU553363.1 SARS coronavirus HKU-39849 isolate TCVSP-HARROD-00001, complete genome 389 389 95% 7e-104 84.42% GU553363.1 Select seq FJ882962.1 SARS coronavirus MA15 ExoN1 isolate P3pp10, complete genome 389 389 95% 7e-104 84.42% FJ882962.1 Select seq FJ882961.1 SARS coronavirus MA15 isolate P3pp5, complete genome 389 389 95% 7e-104 84.42% FJ882961.1 Select seq FJ882959.1 SARS coronavirus MA15 ExoN1 isolate P3pp6, complete genome 389 389 95% 7e-104 84.42% FJ882959.1 Select seq FJ882958.1 SARS coronavirus MA15 isolate P3pp7, complete genome 389 389 95% 7e-104 84.42% FJ882958.1 Select seq FJ882957.1 SARS coronavirus MA15, complete genome 389 389 95% 7e-104 84.42% FJ882957.1 Select seq FJ882956.1 SARS coronavirus ExoN1 isolate P3pp53, complete genome 389 389 95% 7e-104 84.42% FJ882956.1 Select seq FJ882954.1 SARS coronavirus ExoN1 isolate P3pp46, complete genome 389 389 95% 7e-104 84.42% FJ882954.1 Select seq FJ882953.1 SARS coronavirus MA15 ExoN1 isolate P3pp4, complete genome 389 389 95% 7e-104 84.42% FJ882953.1 Select seq FJ882952.1 SARS coronavirus MA15 isolate P3pp4, complete genome 389 389 95% 7e-104 84.42% FJ882952.1 Select seq FJ882951.1 SARS coronavirus MA15 ExoN1 isolate P3pp3, complete genome 389 389 95% 7e-104 84.42% FJ882951.1 Select seq FJ882950.1 SARS coronavirus ExoN1 isolate P3pp60, complete genome 389 389 95% 7e-104 84.42% FJ882950.1 Select seq FJ882949.1 SARS coronavirus wtic-MB isolate P3pp23, complete genome 389 389 95% 7e-104 84.42% FJ882949.1 Select seq FJ882948.1 SARS coronavirus MA15 isolate P3pp3, complete genome 389 389 95% 7e-104 84.42% FJ882948.1 Select seq FJ882947.1 SARS coronavirus wtic-MB isolate P3pp7, complete genome 389 389 95% 7e-104 84.42% FJ882947.1 Select seq FJ882945.1 SARS coronavirus MA15 isolate P3pp6, complete genome 389 389 95% 7e-104 84.42% FJ882945.1 Select seq FJ882944.1 SARS coronavirus ExoN1 isolate P3pp23, complete genome 389 389 95% 7e-104 84.42% FJ882944.1 Select seq FJ882943.1 SARS coronavirus MA15 ExoN1, complete genome 389 389 95% 7e-104 84.42% FJ882943.1 Select seq FJ882942.1 SARS coronavirus MA15 ExoN1 isolate P3pp5, complete genome 389 389 95% 7e-104 84.42% FJ882942.1 Select seq FJ882941.1 SARS coronavirus ExoN1 isolate P3pp8, complete genome 389 389 95% 7e-104 84.42% FJ882941.1 Select seq FJ882940.1 SARS coronavirus ExoN1 isolate P3pp37, complete genome 389 389 95% 7e-104 84.42% FJ882940.1 Select seq FJ882939.1 SARS coronavirus wtic-MB isolate P3pp16, complete genome 389 389 95% 7e-104 84.42% FJ882939.1 Select seq FJ882938.1 SARS coronavirus wtic-MB, complete genome 389 389 95% 7e-104 84.42% FJ882938.1 Select seq FJ882937.1 SARS coronavirus wtic-MB isolate P3pp18, complete genome 389 389 95% 7e-104 84.42% FJ882937.1 Select seq FJ882936.1 SARS coronavirus wtic-MB isolate P3pp2, complete genome 389 389 95% 7e-104 84.42% FJ882936.1 Select seq FJ882935.1 SARS coronavirus wtic-MB isolate P3pp21, complete genome 389 389 95% 7e-104 84.42% FJ882935.1 Select seq FJ882934.1 SARS coronavirus wtic-MB isolate P3pp29, complete genome 389 389 95% 7e-104 84.42% FJ882934.1 Select seq FJ882933.1 SARS coronavirus wtic-MB isolate P3pp6, complete genome 389 389 95% 7e-104 84.42% FJ882933.1 Select seq FJ882932.1 SARS coronavirus wtic-MB isolate P3pp14, complete genome 389 389 95% 7e-104 84.42% FJ882932.1 Select seq FJ882931.1 SARS coronavirus ExoN1 isolate P3pp12, complete genome 389 389 95% 7e-104 84.42% FJ882931.1 Select seq FJ882930.1 SARS coronavirus ExoN1, complete genome 389 389 95% 7e-104 84.42% FJ882930.1 Select seq FJ882929.1 SARS coronavirus ExoN1 isolate P3pp1, complete genome 389 389 95% 7e-104 84.42% FJ882929.1 Select seq FJ882928.1 SARS coronavirus ExoN1 isolate P1pp1, complete genome 389 389 95% 7e-104 84.42% FJ882928.1 Select seq FJ882927.1 SARS coronavirus wtic-MB isolate P1pp1, complete genome 389 389 95% 7e-104 84.42% FJ882927.1 Select seq FJ882926.1 SARS coronavirus ExoN1, complete genome 389 389 95% 7e-104 84.42% FJ882926.1 Select seq FJ959407.1 SARS coronavirus isolate A001, complete genome 389 389 95% 7e-104 84.42% FJ959407.1 Select seq FJ882963.1 SARS coronavirus P2, complete genome 389 389 95% 7e-104 84.42% FJ882963.1 Select seq EU371564.1 SARS coronavirus BJ182-12, complete genome 389 389 95% 7e-104 84.42% EU371564.1 Select seq EU371563.1 SARS coronavirus BJ182-8, complete genome 389 389 95% 7e-104 84.42% EU371563.1 Select seq EU371562.1 SARS coronavirus BJ182-4, complete genome 389 389 95% 7e-104 84.42% EU371562.1 Select seq EU371561.1 SARS coronavirus BJ182b, complete genome 389 389 95% 7e-104 84.42% EU371561.1 Select seq EU371560.1 SARS coronavirus BJ182a, complete genome 389 389 95% 7e-104 84.42% EU371560.1 Select seq EU371559.1 SARS coronavirus ZJ02, complete genome 389 389 95% 7e-104 84.42% EU371559.1 Select seq FJ429166.1 Recombinant SARS coronavirus, complete sequence 389 389 95% 7e-104 84.42% FJ429166.1 Select seq DQ898174.1 SARS coronavirus strain CV7, complete genome 389 389 95% 7e-104 84.42% DQ898174.1 Select seq DQ640652.1 SARS coronavirus GDH-BJH01, complete genome 389 389 95% 7e-104 84.42% DQ640652.1 Select seq AY864806.1 SARS coronavirus BJ202, complete genome 389 389 95% 7e-104 84.42% AY864806.1 Select seq AY864805.1 SARS coronavirus BJ162, complete genome 389 389 95% 7e-104 84.42% AY864805.1 Select seq DQ497008.1 SARS coronavirus strain MA-15, complete genome 389 389 95% 7e-104 84.42% DQ497008.1 Select seq AB257344.1 SARS coronavirus Frankfurt 1 genomic RNA, nearly complete genome, clone: persistent virus #21 389 389 95% 7e-104 84.42% AB257344.1 Select seq AY686864.1 SARS coronavirus B039, complete genome 389 389 95% 7e-104 84.42% AY686864.1 Select seq AY772062.1 SARS coronavirus WH20, complete genome 389 389 95% 7e-104 84.42% AY772062.1 Select seq AY613950.1 SARS coronavirus PC4-227, complete genome 389 389 95% 7e-104 84.42% AY613950.1 Select seq AY613949.1 SARS coronavirus PC4-136, complete genome 389 389 95% 7e-104 84.42% AY613949.1

Virus name: BetaCoV/Kanagawa/1/2020 Accession ID: EPI_ISL_402126 Type: betacoronavirus Passage details/history: Original Sample information Collection date: 2020-01-14 Location: Kanagawa Prefecture, Japan Host: Human Additional location information: Gender: Male Patient age: 30s Patient status: Live Specimen source: Throat swab Additional host information: Patient infected in Wuhan, China Outbreak: Last vaccinated: Treatment: Sequencing technology: Assembly method: Coverage: Institute information Originating lab: Dept. of Virology III, National Institute of Infectious Diseases Address: 4-7-1 Gakuen, Musashi-Murayama, Tokyo 208-0011, Japan Sample ID given by the sample provider: NIID_01162020 Submitting lab: Dept. of Virology III, National Institute of Infectious Diseases Address: 4-7-1 Gakuen, Musashi-Murayama, Tokyo 208-0011, Japan Sample ID given by the submitting laboratory: NIID_01162020 Authors: Naganori Nao, Kazuya Shirato, Shutoku Matsuyama, Makoto Takeda Submitter information Submission Date: Jan-16-2020 Address: Dept. of Virology III, National Institute of Infectious Diseases, 4-7-1 Gakuen, Musashi-Murayama, Tokyo 208-0011, Japan FASTA >BetaCoV/Kanagawa/1/2020|EPI_ISL_402126

Partial Sequence Released at GISAID

Update information on Thailand responding to the novel coronavirus 17 January 2020 News release Current situation: On 17th January 2020, the Ministry of Public Health of Thailand reported an second imported case of infection caused by the novel coronavirus recently identified in Wuhan, China. The concerned individual is a Chinese national who was found to have fever on arrival at Suvarnabhumi airport on 13th January. A clinical diagnosis of mild pneumonia was made after referral to a government hospital. Laboratory testing subsequently confirmed that the novel coronavirus was the cause. WHO acknowledges the capacity of Thailand’s laboratories to do the complex genetic analyses necessary to confirm the diagnosis. Background: Since early December, a number of cases of pneumonia have been detected in persons from Wuhan city in China. Chinese authorities identified a new coronavirus as the agent causing these cases. Coronaviruses are common - many cause less severe illness such as the common cold; other are known to cause more severe illness (SARS and Middle East Respiratory Syndrome, MERS). Chinese scientists have sequenced and made available the genetic material of this virus – a remarkable achievement in such a short time. This will be critical to helping public health authorities around the world understand this illness and track it. The way these patients became infected is not yet known. To date, there has been no confirmation of human to human transmission of this new coronavirus. There have been no infections reported among health care workers, which can be an early indicator of person to person spread. At present, WHO does not recommend any specific health measures for travelers in relation to this event. WHO advises against the application of any travel or trade restrictions on China based on the information available. If travelers develop respiratory illness before, during or after travel, they should seek medical attention and share travel history with their health care provider. The World Health Organization is working with Thailand and other countries to track further understand infections caused by this new coronavirus and to ensure that they are prevented and controlled. This includes, Facilitating information sharing on this and other relevant health events between countries In the longer term, using the International Health Regulations to develop and strengthen the capacities of countries to detect and respond to infections like the new coronavirus. Providing all countries with a technical package of interim guidance, including Case definitions to help with identification of cases Information on laboratory methodologies to identify this and other respiratory viruses, Guidance on how to protect health care workers and others; Information for clinicians on case management Guidance on Risk Communication The following guidelines are also being developed Advice for people visiting markets Guidance on entry & exit screening at airports and other ‘points of entry’ Guidance on case investigation and contact tracing https://www.who.int/thailand/news/detail/17-01-2020-update-information-on-thailand-responding-to-the-novel-coronavirus

Media Advisory For Immediate Release Friday, January 17, 2020 Contact: CDC Media Relations (404) 639-3286 CDC Telebriefing: Update on 2019 Novel Coronavirus (2019-nCoV) What The Centers for Disease Control and Prevention (CDC) will provide an update on the 2019 Novel Coronavirus and proactive actions CDC is taking to be prepared. Who Nancy Messonnier, MD, Director, National Center for Immunization and Respiratory Diseases Martin Cetron, MD, Director, Division of Global Migration and Quarantine When Friday, January 17, at 1:00 p.m. ET Dial-In Media: 888-946-7204 Non-Media: 888-603-9752 INTERNATIONAL: 1-773-756-4803 TRANSCRIPT A transcript will be available following the briefing at CDC’s web site: www.cdc.gov/media.

17 January 2020 Imperial College London Estimating the potential total number of novel Coronavirus cases in Wuhan City, China Natsuko Imai, Ilaria Dorigatti, Anne Cori, Steven Riley, Neil M. Ferguson WHO Collaborating Centre for Infectious Disease Modelling MRC Centre for Global Infectious Disease Analysis, J-IDEA, Imperial College London, UK Correspondence: [email protected] V2 (updated to include second Thai case) Background On the 31st December 2019, the World Health Organization (WHO) China Country Office was informed of cases of pneumonia of unknown aetiology in Wuhan City, Hubei Province, China [1]. A novel Coronavirus (2019-nCoV) related to the Middle Eastern Respiratory Syndrome virus and the Severe Acute Respiratory Syndrome virus has since been implicated [2]. As of 16th January 2020, 41 cases (including two deaths [3]) have been confirmed in Wuhan City with three confirmed cases in travellers detected in Thailand (2 cases) and Japan (1 case) [4–7]. Most cases have been epidemiologically linked to exposure at a seafood market in Wuhan which has been closed since 1 January 2020 in efforts to contain the outbreak. Although both travellers have a history of travel to Wuhan City, they did not visit the seafood market implicated in the other cases [2]. Using the number of cases detected outside China, it is possible (see Methods) to infer the number of clinically comparable cases within Wuhan City that may have occurred thus far. Summary We estimate that a total of 1,723 cases of 2019-nCoV in Wuhan City (95% CI: 427 – 4,471) had onset of symptoms by 12th January 2020 (the last reported onset date of any case). This estimate is based on the following assumptions: • Wuhan International Airport has a catchment population of 19 million individuals [1]. • There is a mean 10-day delay between infection and detection, comprising a 5-6 day incubation period [8,9] and a 4-5 day delay from symptom onset to detection/hospitalisation of a case (the cases detected in Thailand and Japan were hospitalised 3 and 7 days after onset, respectively) [4,10]. • Total volume of international travel from Wuhan over the last two months has been 3,301 passengers per day. This estimate is derived from the 3,418 foreign passengers per day in the top 20 country destinations based on 2018 IATA data [11], and uses 2016 IATA data held by Imperial College to correct for the travel surge at Chinese New Year present in the latter data (which has not happened yet this year) and for travel to countries outside the top 20 destination list.

Conclusions It is likely that the Wuhan outbreak of a novel coronavirus has caused substantially more cases of moderate or severe respiratory illness than currently reported. The estimates presented here suggest surveillance should be expanded to include all hospitalised cases of pneumonia or severe respiratory disease in the Wuhan area and other well-connected Chinese cities. This analysis does not directly address transmission routes, but past experience with SARS and MERS-CoV outbreaks of similar scale suggests currently selfsustaining human-to-human transmission should not be ruled out.

Report from MRC Centre for Global Infectious Disease Analysis estimates 1200-6000 2019-nCoV cases in Wuhan based on confirmed exported cases on international commercial airline flights out of Wuhan https://www.imperial.ac.uk/media/imperial-college/medicine/sph/ide/gida-fellowships/Report.pdf

A fish market in Wuhan, China, from where people have been confirmed to have been infected with a new coronavirus. | CNS / VIA KYODO NATIONAL / SCIENCE & HEALTH Japan confirms first case of coronavirus that has infected dozens in China KYODO, STAFF REPORT JAN 16, 2020 Japan has confirmed its first case of pneumonia caused by a new coronavirus from China, the health ministry said Thursday. A Chinese national in his 30s who lives in Kanagawa Prefecture tested positive for the virus, the ministry said. He returned from Wuhan on Jan. 6 and was hospitalized on Jan. 10, but has already recovered and was discharged from the hospital on Wednesday. A ministry official said there are no other confirmed cases in Japan. The pneumonia-like virus has infected dozens of people in Wuhan, with preliminary evidence suggesting the outbreak was associated with exposure at a seafood market. The man treated in Japan had not visited the Wuhan seafood market, according to the health ministry. It is possible that he came in close contact with a person infected with the virus while in the city, the ministry said. Japanese authorities said he possibly caught the disease from a carrier in the Chinese city, and there are currently no suspected cases of secondary infection in Japan, including among his family members who live with him or doctors who have treated him. “The chances are slim that the infection will spread (in Japan),” a health ministry official said. Coronaviruses usually cause common-cold symptoms, infecting the nose, sinuses or upper throat, and are spread through sneezing, coughing or direct contact. However, some types lead to more serious, sometimes deadly respiratory diseases, such as severe acute respiratory syndrome or Middle East respiratory syndrome. SARS killed 349 people in mainland China and 299 in Hong Kong in 2002 and 2003. The man developed a fever on Jan. 3 while in Wuhan. He is now at home recuperating, the ministry said. His fever is gone but he has a slight cough. The man passed the quarantine test at the airport upon his return because he had taken some medicine. While the Japanese government declined to reveal which airport the man arrived at, transport minister Kazuyoshi Akaba said his ministry will “do everything it can” to detect possible patients at airports and seaports. His infection was confirmed Wednesday through a laboratory test by the National Institute of Infectious Diseases, leading the government to set up an information-gathering task force at the crisis management center under the Prime Minister’s Office that day. The health ministry issued a message to the public emphasizing hand-washing and other preventive measures similar to those taken against the common cold or influenza. It also called on those who have visited Wuhan and have experienced fever and coughing to wear masks and visit medical institutions promptly. It advised them to report that they have been to Wuhan when seeing a doctor. The pneumonia caused by the virus, which the World Health Organization recognized Tuesday as a novel coronavirus, has infected 41 people in Wuhan, with preliminary evidence suggesting the outbreak was associated with exposure at a seafood market, as many of them worked or were customers there. The infected resident in Japan has told health authorities that he did not visit the seafood market, making it likely that he had close contact with a carrier elsewhere. The Chinese city’s public health authorities have said they are investigating a case of an outbreak within one family over the possibility that the virus could be transmitted human to human. A Japanese health ministry official said the virus might be transmitted among humans if a person spends a long time in proximity to a carrier. Satoshi Kutsuna, an expert at the Disease Control and Prevention Center under the National Center for Global Health and Medicine, said in a web article that people don’t need to be excessively worried about the virus. Although the infection case between the couple suggests the possibility of human-to-human transmission, examinations on nearly 1,000 people who came in contact with the infected patients have shown they were not infected. This indicates that “it’s unlikely that it will spread widely around the globe,” Kutsuna wrote. Still, some Japanese travelers to China voiced concerns. “I thought the virus would come to Japan but it was sooner than I expected,” said Yoshihiro Miki, a 40-year-old from Saitama Prefecture, who was at Narita Airport and headed to Shanghai for several days. “A person died, so I’m worried. I’ll stay away from crowded places,”said a 30-year-old man from Tokyo’s Kita Ward who was headed to a destination near Wuhan. One person among the 41 infected has died but WHO said on its website Sunday that the patient had “other underlying health conditions.” Thailand’s Public Health Ministry reported Monday that a 61-year-old Chinese tourist from Wuhan was confirmed to have the viral pneumonia. SARS was identified in 2003, spreading worldwide and killing 774 people. It may have originated in bats. MERS, which is thought to have originated from camels, was first reported in Saudi Arabia in 2012. Those syndromes were ruled out as the cause of the outbreak in Wuhan. The Japanese health ministry has also said that those who have visited Wuhan should wear masks and get a medical checkup as soon as possible if they find themselves with a fever or cough. They should also inform medical institutions that they have returned from the city. https://www.japantimes.co.jp/news/2020/01/16/national/science-health/japan-first-coronavirus-case/#.XiHN7MhKjIW

Thailand detected a second visitor from China infected with a coronavirus, identified in Wuhan, in Hubei province of China, health officials said. This came hours after China reported a second death, an elderly man, from the dangerous disease. In Thailand, the 74-year-old Chinese woman is being treated at hospital after presenting with symptoms at the capital's airport, Suvarnabhumi on January 13, according to the health ministry. Tests showed that a 74-year-old woman, quarantined since arriving in Thailand on Monday was infected, health permanent secretary Sukhum Karnchanapimai said today, the Bangkok Post reports. She was diagnosed with pneumonia linked to the new coronavirus, which has stirred alarm after killing two in China and hospitalising dozens. It has also been detected in Japan. "People don't have to panic as there is no spread of the virus in Thailand," the ministry said in its statement. The woman, whose condition is improving, arrived from the central Chinese city of Wuhan -- believed to be at the epicentre of the outbreak. It came after Thai doctors diagnosed another Chinese traveller with mild pneumonia on January 8, later confirmed to have been caused by the new virus. The World Health Organisation has said "much remains to be understood" about the coronavirus from the same family as SARS (Severe Acute Respiratory Syndrome), which claimed hundreds of lives more than a decade ago. Thai health officials have stepped up monitoring at four airports receiving daily flights from Wuhan - Suvarnabhumi, Don Mueng, Chiang Mai and Phuket - and others that receive charter flights from the Chinese city, the Bangkok Post reports. Since Jan 3, 13,624 passengers had been screened on arrival, officials said. Health officials also asked Thai AirAsia and China Southern Airlines, which run direct daily flights from Wuhan, to halt boarding by those suffering from high fever and respiratory symptoms, and reschedule their flights. -AFP/The Standard https://www.thestandard.com.hk/breaking-news/section/6/140336/Thailand-reports-second-Chinese-woman-infected-with-Wuhan-coronavirus

On the other hand, a 69-year-old local man who was reported to be infected yesterday was found to have nothing to do with Wuhan pneumonia after investigation. https://www.zaobao.com.sg/realtime/singapore/story20200117-1022005

Alert and response operations Diseases Biorisk reduction Disease outbreak news Novel Coronavirus – Japan (ex-China) Disease outbreak news 17 January 2020 On 15 January 2020, the Ministry of Health, Labour and Welfare, Japan (MHLW) reported an imported case of laboratory-confirmed 2019-novel coronavirus (2019-nCoV) from Wuhan, Hubei Province, China. The case-patient is male, between the age of 30-39 years, living in Japan. The case-patient travelled to Wuhan, China in late December and developed fever on 3 January 2020 while staying in Wuhan. He did not visit the Huanan Seafood Wholesale Market or any other live animal markets in Wuhan. He has indicated that he was in close contact with a person with pneumonia. On 6 January, he traveled back to Japan and tested negative for influenza when he visited a local clinic on the same day. On 10 January 2020, due to his continued symptoms of cough, sore throat and fever, he visited a local hospital and was found to have abnormal chest x-ray with infiltrates. He was admitted to the hospital on the same day and had remained febrile until 14 January. On 14 January, his attending doctor notified the case to a local public health authority under the surveillance system for “Unidentified Serious Infectious Illness”. Samples were collected and sent to the National Institute of Infectious Diseases (NIID), and at NIID, polymerase chain reaction (PCR) testing and sequencing was performed twice, which identified very small amount of 2019-nCoV RNA on 15 January 2020. On 15 January, the case-patient was afebrile and was discharged from hospital. Currently, he is staying at home in a stable condition. Public health response Contact tracing and other epidemiological investigations are underway by the local health authorities in Japan; The Japanese Government has scaled up a whole-of-government coordination mechanism on the 16 January; The MHLW has strengthened surveillance for undiagnosed severe acute respiratory illnesses since the report of undiagnosed pneumonia in Wuhan, China; From 6 January, MHLW requested local health governments to be aware of the respiratory illnesses in Wuhan by using the existing surveillance system for serious infectious illness with unknown etiology; NIID is supporting local authorities on epidemiologic investigations including contact tracing; Quarantine and screening measures have been enhanced for travelers from Wuhan city at the point of entries since 7 January; NIID established an in-house PCR assay for nCoV on 16 January; Revision of the risk assessment by NIID is being conducted, including case definition of close contacts; The public risk communication has been enhanced; A hotline has been established among the different ministries in the government; The MHLW is working closely with WHO and other related Member States to foster mutual investigations and information sharing. WHO risk assessment This was the second exported case of novel coronavirus from Wuhan city, China. Since the initial report of cases in Wuhan city on 31 December 2019, and as of 12 January 2020, 41 laboratory-confirmed cases of nCoV infection, including 2 deaths in cases with underlying medical conditions have been reported to WHO. Two cases have been reported from Thailand. The source of the outbreak is still under investigation in Wuhan. Preliminary investigations have identified environmental samples positive for nCoV in Huanan Seafood Wholesale Market in Wuhan City, however some laboratory-confirmed patients did not report visiting this market. To date, there is no reported infection among healthcare workers in China, Thailand or Japan. No additional cases have been reported since 3 January in China. Additional investigations are needed to determine how the patients were infected, whether human-to-human transmission has been observed, mode(s) of transmission, the clinical spectrum of disease, and the extent of infection, including presence of subclinical cases that are undetected with current surveillance. It is critical to review all available information to fully understand the extent of transmissibility between people and likelihood of zoonotic spillover. WHO advice Although the source of the novel coronavirus causing this cluster of pneumonia and the mode(s) of transmission are unknown, it would be prudent to remind populations and health workers of the basic principles to reduce the general risk of transmission of acute respiratory infections: Avoiding close contact with people suffering from acute respiratory infections; Frequent hand-washing, especially after direct contact with ill people or their environment; Avoiding unprotected contact with farm or wild animals; People with symptoms of acute respiratory infection should practice cough etiquette (maintain distance, cover coughs and sneezes with disposable tissues or clothing, and wash hands); Within healthcare facilities, enhance standard infection prevention and control practices in hospitals, especially in emergency departments; WHO does not recommend any specific health measures for travelers. In case of symptoms suggestive of respiratory illness either during or after travel, the travelers are encouraged to seek medical attention and share their travel history with their health care provider. Travel guidance has been updated. Health authorities should work with travel, transport and tourism sectors to provide travellers with information to reduce the general risk of acute respiratory infections via travel health clinics, travel agencies, conveyance operators and at points of entry. WHO has provided interim guidance for novel coronaviruses WHO advises against the application of any travel or trade restrictions on Japan based on the information currently available on this event. For more information on novel coronavirus, please see: Technical guidance for novel coronavirus, WHO WHO travel advice for international travel and trade in relation to the outbreak of pneumonia caused by a new coronavirus in China Press statement by Ministry of Health, Labour and Welfare, Japan on 16 January 2020 (in Japanese) Press statement by Ministry of Health, Labour and Welfare, Japan on 6 January 2020 (in Japanese) Notice sent out from Health and Food Safety Planning Division, Quarantine Station Operation Management Office (in Japanese) Wuhan Municipal Health Commission's briefing on the pneumonia epidemic situation, (in Chinese) Disease outbreak news, Novel Coronavirus – Thailand (ex-China), 14 January 2020 https://www.who.int/csr/don/17-january-2020-novel-coronavirus-japan-ex-china/en/

China Wuhan's new virus pneumonia causes doubts online January 17, 2020 19:06pneumonia In Wuhan, Hubei Province, China, pneumonia that seems to be caused by a new type of coronavirus is continuing, and on the Chinese Internet, there is a question posted on the Internet such as "Why is there no other example in China than Wuhan?" Meanwhile, Chinese authorities have tightened information controls, including removing comments that complain to medical institutions. A Chinese man living in Kanagawa Prefecture who had traveled to Wuhan in Japan returned to Japan and complained of pneumonia, was confirmed to be infected with the new coronavirus, and also visited Thailand from Wuhan for sightseeing in Thailand. Two women have been infected. Meanwhile, in China, health authorities in Wuhan have reported that 41 cases have been confirmed and two people have died, but no cases have been reported outside of Wuhan. Under such circumstances, there are questions on the Chinese Internet, such as "Why is there no other example in Japan than Wuhan?" Or "Very strange. Does this virus spread only in foreign countries?" Others have cast doubt on the authorities' announcements, such as "I don't believe in government news" or "I shouldn't hide data." On the other hand, in Chinese Twitter Weibo, Wuhan's medical institutions have too many patients with fever, and comments that complained to medical institutions that they were refused hospitalization were deleted immediately, so that fears did not spread. Chinese authorities are strengthening information controls. https://www3.nhk.or.jp/news/html/20200117/k10012249681000.html

Tweets (in Chinese) are raising concerns about censorship of negative information in China regarding 2019-nCoV and atypical pneumonia cases. This thread will document concerns.

Jan 16 update Another Fatality From The New SARS-Like Coronavirus And Another New Case In JapanSecond SARS 2.0 Infected Patient (69M) DiesSARS-Like Coronavirus Spreads To JapanCDC Issues Update And Warning on SARS 2.0 http://mediaarchives.gsradio.net/rense/special/rense_011620_hr1.mp3

http://mediaarchives.gsradio.net/rense/special/rense_011620_hr1.mp3

http://mediaarchives.gsradio.net/rense/special/rense_011620_hr1.mp3

http://mediaarchives.gsradio.net/rense/special/rense_011620_hr1.mp3

Thailand announces a SECOND case of Chinese coronavirus that has killed two people The 74-year-old woman was from the Chinese city of Wuhan She was quarantined on her arrival into Thailand at an airport A total of 41 cases of pneumonia have been linked to the virus in Wuhan Two patients have died in the past two weeks, both males in their 60s Thais have been urged to remain calm as the country ramped up checks By VANESSA CHALMERS HEALTH REPORTER FOR MAILONLINE PUBLISHED: 00:06 EST, 17 January 2020 | UPDATED: 04:44 EST, 17 January 2020 Officials in Thailand have announced a second case of the new Chinese coronavirus that has killed two people. The 74-year-old woman had been quarantined since her arrival on Monday, with tests later confirming she had caught the infection. She is from the Chinese city of Wuhan, where 41 cases of 'unexplained pneumonia' have been linked to the new type of coronavirus. Two patients have died, with officials announcing the second fatality yesterday. Both patients were male and in their 60s. Thais have been urged to remain calm as the country ramps up checks of Chinese tourists ahead of the Lunar New Year holidays. Japan reported its first case of the infection on Thursday – a man who returned from visiting Wuhan, a city home to 11million people. The World Health Organization (WHO) has said the virus could spread and reportedly warned hospitals worldwide to prepare for cases. Thailand has announced a second case of Chinese coronavirus that has killed two people. One case has been detected in Japan. A total of 41 patients have been confirmed in Wuhan, a Chinese city where the outbreak began The 74-year-old tourist was intercepted at Thailand's biggest airport Suvarnabhumi on January 13. The Chinese woman, 74, was from the Chinese city of Wuhan, where 41 cases of 'unexplained pneumonia' have been linked to the new type of coronavirus. Pictured, a notice for passengers from Wuhan is displayed in Japan, where one case has been detected Coronaviruses are a large family of viruses that can cause infections ranging from the common cold to the deadly SARS, which killed hundreds of people in China and Hong Kong in the early 2000s. The new coronavirus, which causes cold-like symptoms including a runny nose, headache, cough, sore throat and a fever, has never been seen before and has not yet been named. The WHO has said 'much remains to be understood' about the coronavirus, which has been described as 'novel'. Forty-one cases have been contained in the Chinese city of Wuhan since December and dozens more have been hospitalised as suspected patients. Among the confirmed cases, two have died, five are in a serious condition, 12 have been discharged and the rest are stable. The 74-year-old tourist was intercepted at Thailand's biggest airport Suvarnabhumi on January 13 with symptoms of lung infection, the country's public health ministry said. It is hoped she will return home soon after being treated in the same hospital, east of Bangkok, as a Chinese woman who was diagnosed with the virus after entering the country last week. The 61-year-old, quarantined on January 8, was the first case of the coronavirus to be detected outside of China, raising fears the virus would spread rapidly. Japan confirmed its first case of infection from the new virus - a man in his 30s from Tokyo who had recently visited Wuhan. Pictured, pedestrians in Tokyo wearing protective masks Forty-one cases have been contained in the Chinese city of Wuhan since December. The majority of patients have been traced to the Huanan Wholesale Seafood Market (pictured) THE NEW CORONAVIRUS IN CHINA TIMELINE December 31 2019: The WHO China Country Office was informed of cases of pneumonia of unknown cause detected in Wuhan City, Hubei Province of China. Around 44 suspected cases were reported in the month of December. January 1 2020: A seafood market was closed for environmental sanitation and disinfection after being closely linked with the patients. January 5 2020: Doctors ruled out severe acute respiratory syndrome (SARS) as being the cause of the virus, as well as bird flu, Middle East respiratory syndrome and adenovirus. Meanwhile, Hong Kong reported January 9 2020: A preliminary investigation identified the respiratory disease as a new type of coronavirus, Chinese state media reported. Officials at Wuhan Municipal Health Commission reported the outbreak's first death on January 9, a 61-year-old man. January 13 2020: A Chinese woman in Thailand was the first confirmed case of the mystery virus outside of China. The 61-year-old was quarantined on January 8, but has since returned home in a stable condition after having treatment, the Thai Health Ministry said. January 14 2020: The WHO told hospitals around the globe to prepare, in the 'possible' event of the infection spreading. It said there is some 'limited' human-to-human transmission of the virus. Two days previously, the UN agency said there was 'no clear evidence of human to human transmission'. January 16 2020: A man in Tokyo is confirmed to have tested positive for the disease after travelling to the Chinese city of Wuhan. A second death, a 69-year-old man, was reported by officials at Wuhan Municipal Health Commission. He died in the early hours of January 15 at Jinyintan Hospital in Wuhan city having first been admitted to hospital on December 31. January 17 2020: Thailand announces it has detected a second case. The 74-year-old woman had been quarantined since her arrival on Monday. She lived in Wuhan. A statement from the country's public health ministry said on Friday: 'People don't have to panic as there is no spread of the virus in Thailand.' Monitoring at four airports that have daily flights from Wuhan - Suvarnabhumi, Don Mueng, Chiang Mai and Phuket - has been increased, Thailand's Public Health Ministry added. Some 13,624 passengers across the airports have been scanned with thermal checkers since January 3. It comes just days before Lunar New Year holidays next week, when nearly a million Chinese visitors are expected to arrive in Thailand. Some 1.4billion Chinese citizens will be travelling abroad, leaving airports scrambling to implement surveillance in Singapore, Hong Kong, Indonesia, Thailand and Japan. Yesterday, Japan's health ministry announced its first case, a man who had been hospitalised with pneumonia symptoms after travelling to Wuhan earlier this month. Though the known cases of the pneumonia outbreak so far involve only individuals who have travelled to or live in Wuhan, the WHO has warned that a wider outbreak is possible. Uncertainty around the exact cause of the outbreak remains, though a seafood market in the city is suspected to be the epicentre. The majority of the infected patients in Wuhan have been traced to the Huanan Wholesale Seafood Market, which has been shut down since January 1. 'Environmental samples' taken from the market tested positive for the virus, Wuhan health authorities said. The first patient diagnosed with the novel strain was a regular customer at the seafood market on Wuhan's outskirts. The 61-year-old man has since died, the Wuhan Municipal Health Commission said last week. He also suffered from abdominal tumours and chronic liver disease. A statement from the commission yesterday revealed a second death at 12.45am on January 15. The patient, known only as Xiong, fell ill on December 31, 2019. His condition worsened on January 4 and he was transferred to the Jinyintan Hospital of Wuhan. He had severe cardiomyopathy – a heart condition, abnormal kidney function, and seriously damaged organs. It is not clear if these were complications of the virus or underlying conditions. Some 1.4billion Chinese citizens will be travelling abroad during Lunar New Year. Airports have stepped up surveillance, including in Japan (pictured) 'Environmental samples' taken from the market tested positive for the virus, Wuhan health authorities said. Although the virus was initially thought to be transmitted by animals, due to the connection with the food market, the WHO said there is now 'limited evidence' of human-to-human transmission. Hospitals have also been alerted of the potential threat of spread. Dr Maria Van Kerkhove, acting head of WHO's emerging diseases unit, said hospitals worldwide had been given guidance about infection control. This includes the potential of 'super spreading' in health care settings, which is when a few ill patients can transmit the virus to dozens at a time. Discussing the potential spread of the virus, Dr Kerkhove said: 'This is something on our radar, it is possible, we need to prepare ourselves.' Some hospitals in China have already been directed to report cases of fever in anyone who has travelled to Wuhan in the past 14 days. https://www.dailymail.co.uk/health/article-7897965/Thailand-finds-second-case-new-Chinese-virus-says-no-outbreak.html

Today (17 January 2020) at the Department of Disease Control Ministry of Public Health Nonthaburi Province Dr. Sukhum Kanchanapimai, Permanent Secretary of the Ministry of Public Health, together with Dr. Suwanchai Wattana Yingcharoenchai Director-General of the Department of Disease Control Announcing the situation of people with pneumonia from Wuhan, China, said the Ministry of Public Health. The Department of Disease Control has screened travelers at the airport on January 13, 2020, with 1 additional confirmed case of coronary pneumonia from 2019 which is a Chinese female aged 74 years. At Bamrasnaradu Institute Under medical supervision https://pr.moph.go.th/?url=pr/detail/2/04/137232/